Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 148596957

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|148596957 myosin binding protein C, cardiac [Homo sapiens]
         (1274 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|148596957 myosin binding protein C, cardiac [Homo sapiens]        2578   0.0  
gi|133908641 myosin binding protein C, fast type [Homo sapiens]      1224   0.0  
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...  1150   0.0  
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...  1147   0.0  
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...  1147   0.0  
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...  1139   0.0  
gi|55956914 myosin binding protein H [Homo sapiens]                   434   e-121
gi|194018539 myosin binding protein H-like [Homo sapiens]             344   4e-94
gi|110349719 titin isoform N2-A [Homo sapiens]                        286   9e-77
gi|110349717 titin isoform novex-2 [Homo sapiens]                     286   9e-77
gi|110349713 titin isoform novex-1 [Homo sapiens]                     286   9e-77
gi|110349715 titin isoform N2-B [Homo sapiens]                        286   9e-77
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     278   2e-74
gi|148839296 immunoglobulin-like and fibronectin type III domain...   238   4e-62
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   151   4e-36
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   151   4e-36
gi|140560917 myomesin 1 isoform b [Homo sapiens]                      135   2e-31
gi|156104903 myomesin 2 [Homo sapiens]                                126   1e-28
gi|144226847 obscurin-like 1 [Homo sapiens]                           124   4e-28
gi|155969693 myomesin family, member 3 [Homo sapiens]                 119   2e-26
gi|110349721 titin isoform novex-3 [Homo sapiens]                     118   4e-26
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      115   2e-25
gi|118572606 hemicentin 1 [Homo sapiens]                              111   4e-24
gi|193083163 roundabout, axon guidance receptor, homolog 2 isofo...   108   2e-23
gi|61888896 roundabout, axon guidance receptor, homolog 2 isofor...   108   2e-23
gi|169178458 PREDICTED: hemicentin 2 [Homo sapiens]                   108   4e-23
gi|239749684 PREDICTED: hemicentin 2 [Homo sapiens]                   108   4e-23
gi|169177000 PREDICTED: hemicentin 2 [Homo sapiens]                   108   4e-23
gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]      107   9e-23
gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]       107   9e-23

>gi|148596957 myosin binding protein C, cardiac [Homo sapiens]
          Length = 1274

 Score = 2578 bits (6681), Expect = 0.0
 Identities = 1274/1274 (100%), Positives = 1274/1274 (100%)

Query: 1    MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE 60
            MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE
Sbjct: 1    MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE 60

Query: 61   GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA 120
            GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA
Sbjct: 61   GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA 120

Query: 121  PAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG 180
            PAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG
Sbjct: 121  PAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG 180

Query: 181  ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE 240
            ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE
Sbjct: 181  ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE 240

Query: 241  VSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK 300
            VSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK
Sbjct: 241  VSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK 300

Query: 301  KRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK 360
            KRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK
Sbjct: 301  KRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK 360

Query: 361  KSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT 420
            KSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT
Sbjct: 361  KSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT 420

Query: 421  LTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE 480
            LTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE
Sbjct: 421  LTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE 480

Query: 481  GAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV 540
            GAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV
Sbjct: 481  GAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV 540

Query: 541  QEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK 600
            QEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK
Sbjct: 541  QEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK 600

Query: 601  LTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV 660
            LTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV
Sbjct: 601  LTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV 660

Query: 661  VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE 720
            VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE
Sbjct: 661  VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE 720

Query: 721  TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI 780
            TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI
Sbjct: 721  TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI 780

Query: 781  SNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV 840
            SNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV
Sbjct: 781  SNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV 840

Query: 841  VYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG 900
            VYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG
Sbjct: 841  VYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG 900

Query: 901  LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960
            LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE
Sbjct: 901  LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960

Query: 961  PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS 1020
            PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS
Sbjct: 961  PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS 1020

Query: 1021 IRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL 1080
            IRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL
Sbjct: 1021 IRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL 1080

Query: 1081 NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF 1140
            NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF
Sbjct: 1081 NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF 1140

Query: 1141 SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200
            SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML
Sbjct: 1141 SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200

Query: 1201 CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
            CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG
Sbjct: 1201 CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260

Query: 1261 EARCECRLEVRVPQ 1274
            EARCECRLEVRVPQ
Sbjct: 1261 EARCECRLEVRVPQ 1274


>gi|133908641 myosin binding protein C, fast type [Homo sapiens]
          Length = 1141

 Score = 1224 bits (3167), Expect = 0.0
 Identities = 628/1186 (52%), Positives = 795/1186 (67%), Gaps = 76/1186 (6%)

Query: 98   EKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLF 157
            ++A P  APA AP E   AP E  +P AE                         +P G+F
Sbjct: 23   KEAPPKEAPAEAPKE---APPEDQSPTAE-------------------------EPTGVF 54

Query: 158  VMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRAS 217
            + +P    V  G      A+V G  L   P +KWFKGKW++L SK G      +S++ AS
Sbjct: 55   LKKPDSVSVETGKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSAS 114

Query: 218  KVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLA 277
             VY  ELHI        G YR EV  KD  D   FN+ V           L +F+RTS  
Sbjct: 115  NVYTVELHIGKVVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLESFKRTS-- 172

Query: 278  GGGRRISDSHEDTGILDFSSLLKKRDSFRTPR------DSKLEAPAEEDVWEILRQAPPS 331
                      +  G LDFS LLKKR+     +      D  L  P E  +WE+L+ A  S
Sbjct: 173  ------EKKSDTAGELDFSGLLKKREVVEEEKKKKKKDDDDLGIPPE--IWELLKGAKKS 224

Query: 332  EYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHD 391
            EYE+IAFQYG+TDLRGMLKRLK  + + KKS AF KKL+PAYQV +G+KI+L VE++D D
Sbjct: 225  EYEKIAFQYGITDLRGMLKRLKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPD 284

Query: 392  AEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKE 451
              +KW KNGQEI+ S SKY+FE++G KR LTI++C+LADDAAY+  V  EKC TELFVKE
Sbjct: 285  LTLKWFKNGQEIKPS-SKYVFENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKE 343

Query: 452  PPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFK--YRFKKDGQR 509
            PPVLI  PLEDQ V VG RVE   EVSEEGAQV W+KDGVELTRE++FK  YRFKKDG+R
Sbjct: 344  PPVLIVTPLEDQQVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKR 403

Query: 510  HHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVS 569
            H LI ++ + ED G Y + T+GGQ  AELIV+EK+LEV Q IADL V A +QAVFKCEVS
Sbjct: 404  HILIFSDVVQEDRGRYQVITNGGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVS 463

Query: 570  DENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKL 629
            DE V G W KNG E+ P  RI +SH+GR HKL IDDV P DE DY+FVP+G+A +LSAKL
Sbjct: 464  DEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKL 523

Query: 630  HFMEVKIDFVPRQEPPKIHLDCPGRIPD-TIVVVAGNKLRLDVPISGDPAPTVIWQKAIT 688
            +F+E+K+++VP+QEPPKIHLDC G+  +  IVVVAGNKLRLDV I+G+P P   W K   
Sbjct: 524  NFLEIKVEYVPKQEPPKIHLDCSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLK--- 580

Query: 689  QGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGV 748
                             GD        ++   TEGR R+E   D S F +E A++EDEG 
Sbjct: 581  -----------------GD--------EVFTTTEGRTRIEKRVDCSSFVIESAQREDEGR 615

Query: 749  YTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYIL 808
            YT+ V NPVGED  ++ ++V+DVPD P A +I++VGED   + WEPP YDGG+P+ GY++
Sbjct: 616  YTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMYDGGKPVTGYLV 675

Query: 809  ERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIG 868
            ERKKK S RWM+LNF++  E ++E+ +MIEG++YEMRV+AVNAIG+S+PS  ++PFMPI 
Sbjct: 676  ERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQPSMNTKPFMPIA 735

Query: 869  PPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTS 928
            P SEP HL VEDV+DTT +LKWRPP R+GAGG+DGY VEYC EG  EWV A     E   
Sbjct: 736  PTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWVPANTEPVERCG 795

Query: 929  ILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVG 988
              VK+LPTGAR+LFRV   N+AG   P T  +PVT++EI + P+++LPRHLRQT  +KVG
Sbjct: 796  FTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPRHLRQTYIRKVG 855

Query: 989  EPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVR 1048
            E +NL++PFQGKPRPQV WTK G PL    V +R S  DT+ F+R A R  SG Y+++V+
Sbjct: 856  EQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAARSDSGEYELSVQ 915

Query: 1049 IENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKK 1108
            IENM+D AT+ ++VV+K  PP ++ V + WG N  +EW+ P+D GN+E+ GY VQKADKK
Sbjct: 916  IENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEIMGYFVQKADKK 975

Query: 1109 TMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYE 1168
            TMEWF V E  R T C V +LI+GN YYFRV+++N+ G SD    +K    I + GIT++
Sbjct: 976  TMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNTARILKTGITFK 1035

Query: 1169 PPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFR 1228
            P  YK  DF  AP F  PL++R V+AGY+A L CAVRG PKPK+ W KN +++ ED +F 
Sbjct: 1036 PFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKNKMEIREDPKFL 1095

Query: 1229 MFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
            + + QGVLTL IR+P PFD G Y CRA N  GEA  EC+LEVRVPQ
Sbjct: 1096 ITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRVPQ 1141



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 21  VAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA 80
           V A   AVF+ E     V  +W + G ++  S +  ++  G  H L + +V P D+G Y 
Sbjct: 450 VKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRITISHVGRFHKLVIDDVRPEDEGDYT 509

Query: 81  VIAG------SSKVKF-DLKVIEAEKAEP 102
            +        S+K+ F ++KV    K EP
Sbjct: 510 FVPDGYALSLSAKLNFLEIKVEYVPKQEP 538



 Score = 38.9 bits (89), Expect = 0.032
 Identities = 28/103 (27%), Positives = 45/103 (43%), Gaps = 5/103 (4%)

Query: 7   KPVSAFSKK-PRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHT 65
           K  +AF+KK   + +V  G+      E     + ++W + G +I  S+KY     G +  
Sbjct: 253 KKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVFENVGKKRI 312

Query: 66  LTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAP 108
           LT+ +   AD  +Y V     K   +L V    K  P+L   P
Sbjct: 313 LTINKCTLADDAAYEVAVKDEKCFTELFV----KEPPVLIVTP 351



 Score = 37.7 bits (86), Expect = 0.071
 Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 20  EVAAGSPAVFEAETERAGVKVRWQRGGSDISASN----KYGLATEGTRHTLTVREVGPAD 75
           +V  G       E    G +V W + G +++  +    +Y    +G RH L   +V   D
Sbjct: 356 QVFVGDRVEMAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQED 415

Query: 76  QGSYAVIAGSSKVKFDLKVIEAE 98
           +G Y VI    + + +L V E +
Sbjct: 416 RGRYQVITNGGQCEAELIVEEKQ 438


>gi|46049110 myosin binding protein C, slow type isoform 4 [Homo
            sapiens]
          Length = 1123

 Score = 1150 bits (2974), Expect = 0.0
 Identities = 583/1186 (49%), Positives = 775/1186 (65%), Gaps = 77/1186 (6%)

Query: 96   EAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGES-------APSPKGSSSAALNGPTPG 148
            E  K E    PAPAP      P E P+   E G +         +P G   A  N     
Sbjct: 3    EPTKKEENEVPAPAP------PPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQN----- 51

Query: 149  APDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQ 208
            A      LF+ +PQ G V VG  ITF A+V    LL+ P +KWFKGKW+DL+SK G+HLQ
Sbjct: 52   ANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQ 111

Query: 209  LHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG-DLDL 267
            L ++++R S+VY FE+ I  A+  F G+YRCEV+ KDKFD  +F+L VHE+ GT  ++D+
Sbjct: 112  LKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDI 171

Query: 268  LSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQ 327
             SAF+R+          +  ED G LDFS LLK+R+        + E   + DVWE+L+ 
Sbjct: 172  RSAFKRSG---------EGQEDAGELDFSGLLKRREV------KQQEEEPQVDVWELLKN 216

Query: 328  APPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVEL 387
            A PSEYE+IAFQYG+TDLRGMLKRLK MRR+EKKS AF K L+PAYQV KG ++R  VEL
Sbjct: 217  AKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVEL 276

Query: 388  ADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTEL 447
            AD   EVKW KNGQEI+ S +KYIFE  G +R L I+ C + DD+ Y    G EKCSTEL
Sbjct: 277  ADPKLEVKWYKNGQEIRPS-TKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335

Query: 448  FVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDG 507
            FV+EPP+++T+ LED     G+RVE ECEVSE+ A VKW K+G E+      +YR + +G
Sbjct: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395

Query: 508  QRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCE 567
            ++H LII  A   DA  Y++ T+GGQ+ A+L V  K L++   + D  V    +   KCE
Sbjct: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455

Query: 568  VSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSA 627
            +S EN+ G W KNG  +    R+KV H GR+HKL I +    DE DY F P+ +   L A
Sbjct: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514

Query: 628  KLHFMEVKIDFVPRQEPPKIHLDCPGRIPD-TIVVVAGNKLRLDVPISGDPAPTVIWQKA 686
            K+H ++          PPKI LD  G   D T+ V+AGNKLRL++PISG+P P  +W + 
Sbjct: 515  KVHVID----------PPKIILD--GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR- 561

Query: 687  ITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDE 746
                               GD        K + E  GR+R E+  D S   ++ AE++D 
Sbjct: 562  -------------------GD--------KAIMEGSGRIRTESYPDSSTLVIDIAERDDS 594

Query: 747  GVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGY 806
            GVY + +KN  GE   ++ VKV+D PD P AP ++ VG+D C + WEPPAYDGG PILGY
Sbjct: 595  GVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654

Query: 807  ILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP 866
             +ERKKK+S RWMRLNFDL +E + E ++MIEGV YE+R++AVNAIG+S+PS  S+PF+P
Sbjct: 655  FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVP 714

Query: 867  IGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH 926
            +   S PT L V+ V+DTTV+++WRPP+ +GA GLDGY +EYC EG  +W+ A + L + 
Sbjct: 715  LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774

Query: 927  TSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKK 986
            T   +  LPT A++  RV+A N AG   P   ++P+ V+EI++ P++++PRHL+QT  ++
Sbjct: 775  TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834

Query: 987  VGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT 1046
            VGE VNL+IPFQGKPRP++TW K+G  +   +++IRNS TDTI+FIR A R HSG Y + 
Sbjct: 835  VGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894

Query: 1047 VRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD 1106
            V+++   + A++ +Q++D+P PPQ +++ D WG NVAL W PP+D GN  + GYT+QKAD
Sbjct: 895  VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954

Query: 1107 KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGIT 1166
            KK+MEWFTV+EHY RT   + EL+IGN YYFRVFS+NM G S+ A  TKE   I R G  
Sbjct: 955  KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKI 1014

Query: 1167 YEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDAR 1226
            Y+ P Y+  DFSEAP FTQPLVN   IAGY A L C+VRG+PKPKI+W KN + + +D R
Sbjct: 1015 YKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPR 1074

Query: 1227 FRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272
            +RMFS QGV TLEIRKP P+DGG Y C+A N  G    EC+LEV+V
Sbjct: 1075 YRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 6/131 (4%)

Query: 6   KKPVSAFSK-KPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRH 64
           +K  +AF+K    + +V  G    F  E     ++V+W + G +I  S KY    +G + 
Sbjct: 248 EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307

Query: 65  TLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPA 124
            L +      D   Y V AG  K   +L V      EP +       + T   GE     
Sbjct: 308 ILFINNCQMTDDSEYYVTAGDEKCSTELFV-----REPPIMVTKQLEDTTAYCGERVELE 362

Query: 125 AELGESAPSPK 135
            E+ E   + K
Sbjct: 363 CEVSEDDANVK 373



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 6   KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDI--SASNKYGLATEGTR 63
           ++P    +K+        G     E E       V+W + G +I     ++Y +  EG +
Sbjct: 338 REPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKK 397

Query: 64  HTLTVREVGPADQGSYAVIA----GSSKVKFDLKVIE 96
           H L +     AD   Y+V+      S+K+  DLK ++
Sbjct: 398 HILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLK 434


>gi|46049125 myosin binding protein C, slow type isoform 2 [Homo
            sapiens]
          Length = 1148

 Score = 1147 bits (2966), Expect = 0.0
 Identities = 582/1189 (48%), Positives = 775/1189 (65%), Gaps = 78/1189 (6%)

Query: 105  APAPAPAEATGAPGEAPAPAAELGESAPS---PKGSSSAALNGPTPG--APDDPIG---- 155
            APAP P E +        PA +  E +P    P G  S AL          + P G    
Sbjct: 14   APAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSDWTLVETPPGEEQA 73

Query: 156  ----------LFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQ 205
                      LF+ +PQ G V VG  ITF A+V    LL+ P +KWFKGKW+DL+SK G+
Sbjct: 74   KQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGK 133

Query: 206  HLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG-D 264
            HLQL ++++R S+VY FE+ I  A+  F G+YRCEV+ KDKFD  +F+L VHE+ GT  +
Sbjct: 134  HLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN 193

Query: 265  LDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEI 324
            +D+ SAF+R+          +  ED G LDFS LLK+R+        + E   + DVWE+
Sbjct: 194  IDIRSAFKRSG---------EGQEDAGELDFSGLLKRREV------KQQEEEPQVDVWEL 238

Query: 325  LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLT 384
            L+ A PSEYE+IAFQYG+TDLRGMLKRLK MRR+EKKS AF K L+PAYQV KG ++R  
Sbjct: 239  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFV 298

Query: 385  VELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCS 444
            VELAD   EVKW KNGQEI+ S +KYIFE  G +R L I+ C + DD+ Y    G EKCS
Sbjct: 299  VELADPKLEVKWYKNGQEIRPS-TKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCS 357

Query: 445  TELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFK 504
            TELFV+EPP+++T+ LED     G+RVE ECEVSE+ A VKW K+G E+      +YR +
Sbjct: 358  TELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIR 417

Query: 505  KDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVF 564
             +G++H LII  A   DA  Y++ T+GGQ+ A+L V  K L++   + D  V    +   
Sbjct: 418  VEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICL 477

Query: 565  KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
            KCE+S EN+ G W KNG  +    R+KV H GR+HKL I +    DE DY F P+ +   
Sbjct: 478  KCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 536

Query: 625  LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPD-TIVVVAGNKLRLDVPISGDPAPTVIW 683
            L AK+H ++          PPKI LD  G   D T+ V+AGNKLRL++PISG+P P  +W
Sbjct: 537  LPAKVHVID----------PPKIILD--GLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 584

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEK 743
             +                    GD        K + E  GR+R E+  D S   ++ AE+
Sbjct: 585  SR--------------------GD--------KAIMEGSGRIRTESYPDSSTLVIDIAER 616

Query: 744  EDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI 803
            +D GVY + +KN  GE   ++ VKV+D PD P AP ++ VG+D C + WEPPAYDGG PI
Sbjct: 617  DDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 676

Query: 804  LGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQP 863
            LGY +ERKKK+S RWMRLNFDL +E + E ++MIEGV YE+R++AVNAIG+S+PS  S+P
Sbjct: 677  LGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRP 736

Query: 864  FMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGL 923
            F+P+   S PT L V+ V+DTTV+++WRPP+ +GA GLDGY +EYC EG  +W+ A + L
Sbjct: 737  FVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDL 796

Query: 924  TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
             + T   +  LPT A++  RV+A N AG   P   ++P+ V+EI++ P++++PRHL+QT 
Sbjct: 797  IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTY 856

Query: 984  QKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTY 1043
             ++VGE VNL+IPFQGKPRP++TW K+G  +   +++IRNS TDTI+FIR A R HSG Y
Sbjct: 857  IRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKY 916

Query: 1044 QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             + V+++   + A++ +Q++D+P PPQ +++ D WG NVAL W PP+D GN  + GYT+Q
Sbjct: 917  DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 976

Query: 1104 KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
            KADKK+MEWFTV+EHY RT   + EL+IGN YYFRVFS+NM G S+ A  TKE   I R 
Sbjct: 977  KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1036

Query: 1164 GITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGE 1223
            G  Y+ P Y+  DFSEAP FTQPLVN   IAGY A L C+VRG+PKPKI+W KN + + +
Sbjct: 1037 GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1096

Query: 1224 DARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272
            D R+RMFS QGV TLEIRKP P+DGG Y C+A N  G    EC+LEV+V
Sbjct: 1097 DPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1145



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 6/131 (4%)

Query: 6   KKPVSAFSK-KPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRH 64
           +K  +AF+K    + +V  G    F  E     ++V+W + G +I  S KY    +G + 
Sbjct: 273 EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 332

Query: 65  TLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPA 124
            L +      D   Y V AG  K   +L V      EP +       + T   GE     
Sbjct: 333 ILFINNCQMTDDSEYYVTAGDEKCSTELFV-----REPPIMVTKQLEDTTAYCGERVELE 387

Query: 125 AELGESAPSPK 135
            E+ E   + K
Sbjct: 388 CEVSEDDANVK 398



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 6   KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDI--SASNKYGLATEGTR 63
           ++P    +K+        G     E E       V+W + G +I     ++Y +  EG +
Sbjct: 363 REPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKK 422

Query: 64  HTLTVREVGPADQGSYAVIA----GSSKVKFDLKVIE 96
           H L +     AD   Y+V+      S+K+  DLK ++
Sbjct: 423 HILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLK 459


>gi|45976288 myosin binding protein C, slow type isoform 1 [Homo
            sapiens]
          Length = 1171

 Score = 1147 bits (2966), Expect = 0.0
 Identities = 582/1189 (48%), Positives = 775/1189 (65%), Gaps = 78/1189 (6%)

Query: 105  APAPAPAEATGAPGEAPAPAAELGESAPS---PKGSSSAALNGPTPG--APDDPIG---- 155
            APAP P E +        PA +  E +P    P G  S AL          + P G    
Sbjct: 14   APAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSDWTLVETPPGEEQA 73

Query: 156  ----------LFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQ 205
                      LF+ +PQ G V VG  ITF A+V    LL+ P +KWFKGKW+DL+SK G+
Sbjct: 74   KQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGK 133

Query: 206  HLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG-D 264
            HLQL ++++R S+VY FE+ I  A+  F G+YRCEV+ KDKFD  +F+L VHE+ GT  +
Sbjct: 134  HLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN 193

Query: 265  LDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEI 324
            +D+ SAF+R+          +  ED G LDFS LLK+R+        + E   + DVWE+
Sbjct: 194  IDIRSAFKRSG---------EGQEDAGELDFSGLLKRREV------KQQEEEPQVDVWEL 238

Query: 325  LRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLT 384
            L+ A PSEYE+IAFQYG+TDLRGMLKRLK MRR+EKKS AF K L+PAYQV KG ++R  
Sbjct: 239  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFV 298

Query: 385  VELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCS 444
            VELAD   EVKW KNGQEI+ S +KYIFE  G +R L I+ C + DD+ Y    G EKCS
Sbjct: 299  VELADPKLEVKWYKNGQEIRPS-TKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCS 357

Query: 445  TELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFK 504
            TELFV+EPP+++T+ LED     G+RVE ECEVSE+ A VKW K+G E+      +YR +
Sbjct: 358  TELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIR 417

Query: 505  KDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVF 564
             +G++H LII  A   DA  Y++ T+GGQ+ A+L V  K L++   + D  V    +   
Sbjct: 418  VEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICL 477

Query: 565  KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
            KCE+S EN+ G W KNG  +    R+KV H GR+HKL I +    DE DY F P+ +   
Sbjct: 478  KCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 536

Query: 625  LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPD-TIVVVAGNKLRLDVPISGDPAPTVIW 683
            L AK+H ++          PPKI LD  G   D T+ V+AGNKLRL++PISG+P P  +W
Sbjct: 537  LPAKVHVID----------PPKIILD--GLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 584

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEK 743
             +                    GD        K + E  GR+R E+  D S   ++ AE+
Sbjct: 585  SR--------------------GD--------KAIMEGSGRIRTESYPDSSTLVIDIAER 616

Query: 744  EDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI 803
            +D GVY + +KN  GE   ++ VKV+D PD P AP ++ VG+D C + WEPPAYDGG PI
Sbjct: 617  DDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 676

Query: 804  LGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQP 863
            LGY +ERKKK+S RWMRLNFDL +E + E ++MIEGV YE+R++AVNAIG+S+PS  S+P
Sbjct: 677  LGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRP 736

Query: 864  FMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGL 923
            F+P+   S PT L V+ V+DTTV+++WRPP+ +GA GLDGY +EYC EG  +W+ A + L
Sbjct: 737  FVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDL 796

Query: 924  TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
             + T   +  LPT A++  RV+A N AG   P   ++P+ V+EI++ P++++PRHL+QT 
Sbjct: 797  IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTY 856

Query: 984  QKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTY 1043
             ++VGE VNL+IPFQGKPRP++TW K+G  +   +++IRNS TDTI+FIR A R HSG Y
Sbjct: 857  IRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKY 916

Query: 1044 QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             + V+++   + A++ +Q++D+P PPQ +++ D WG NVAL W PP+D GN  + GYT+Q
Sbjct: 917  DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 976

Query: 1104 KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
            KADKK+MEWFTV+EHY RT   + EL+IGN YYFRVFS+NM G S+ A  TKE   I R 
Sbjct: 977  KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1036

Query: 1164 GITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGE 1223
            G  Y+ P Y+  DFSEAP FTQPLVN   IAGY A L C+VRG+PKPKI+W KN + + +
Sbjct: 1037 GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1096

Query: 1224 DARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272
            D R+RMFS QGV TLEIRKP P+DGG Y C+A N  G    EC+LEV+V
Sbjct: 1097 DPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1145



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 6/131 (4%)

Query: 6   KKPVSAFSK-KPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRH 64
           +K  +AF+K    + +V  G    F  E     ++V+W + G +I  S KY    +G + 
Sbjct: 273 EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 332

Query: 65  TLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPA 124
            L +      D   Y V AG  K   +L V      EP +       + T   GE     
Sbjct: 333 ILFINNCQMTDDSEYYVTAGDEKCSTELFV-----REPPIMVTKQLEDTTAYCGERVELE 387

Query: 125 AELGESAPSPK 135
            E+ E   + K
Sbjct: 388 CEVSEDDANVK 398



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 6   KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDI--SASNKYGLATEGTR 63
           ++P    +K+        G     E E       V+W + G +I     ++Y +  EG +
Sbjct: 363 REPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKK 422

Query: 64  HTLTVREVGPADQGSYAVIA----GSSKVKFDLKVIE 96
           H L +     AD   Y+V+      S+K+  DLK ++
Sbjct: 423 HILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLK 459


>gi|46049119 myosin binding protein C, slow type isoform 3 [Homo
            sapiens]
          Length = 1141

 Score = 1139 bits (2946), Expect = 0.0
 Identities = 583/1204 (48%), Positives = 776/1204 (64%), Gaps = 95/1204 (7%)

Query: 96   EAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGES-------APSPKGSSSAALNGPTPG 148
            E  K E    PAPAP      P E P+   E G +         +P G   A  N     
Sbjct: 3    EPTKKEENEVPAPAP------PPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQN----- 51

Query: 149  APDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQ 208
            A      LF+ +PQ G V VG  ITF A+V    LL+ P +KWFKGKW+DL+SK G+HLQ
Sbjct: 52   ANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQ 111

Query: 209  LHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG-DLDL 267
            L ++++R S+VY FE+ I  A+  F G+YRCEV+ KDKFD  +F+L VHE+ GT  ++D+
Sbjct: 112  LKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDI 171

Query: 268  LSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQ 327
             SAF+R+          +  ED G LDFS LLK+R+        + E   + DVWE+L+ 
Sbjct: 172  RSAFKRSG---------EGQEDAGELDFSGLLKRREV------KQQEEEPQVDVWELLKN 216

Query: 328  APPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVEL 387
            A PSEYE+IAFQYG+TDLRGMLKRLK MRR+EKKS AF K L+PAYQV KG ++R  VEL
Sbjct: 217  AKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVEL 276

Query: 388  ADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTEL 447
            AD   EVKW KNGQEI+ S +KYIFE  G +R L I+ C + DD+ Y    G EKCSTEL
Sbjct: 277  ADPKLEVKWYKNGQEIRPS-TKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335

Query: 448  FVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDG 507
            FV+EPP+++T+ LED     G+RVE ECEVSE+ A VKW K+G E+      +YR + +G
Sbjct: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395

Query: 508  QRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCE 567
            ++H LII  A   DA  Y++ T+GGQ+ A+L V  K L++   + D  V    +   KCE
Sbjct: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455

Query: 568  VSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSA 627
            +S EN+ G W KNG  +    R+KV H GR+HKL I +    DE DY F P+ +   L A
Sbjct: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514

Query: 628  KLHFMEVKIDFVPRQEPPKIHLDCPGRIPD-TIVVVAGNKLRLDVPISGDPAPTVIWQKA 686
            K+H ++          PPKI LD  G   D T+ V+AGNKLRL++PISG+P P  +W + 
Sbjct: 515  KVHVID----------PPKIILD--GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR- 561

Query: 687  ITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDE 746
                               GD        K + E  GR+R E+  D S   ++ AE++D 
Sbjct: 562  -------------------GD--------KAIMEGSGRIRTESYPDSSTLVIDIAERDDS 594

Query: 747  GVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGY 806
            GVY + +KN  GE   ++ VKV+D PD P AP ++ VG+D C + WEPPAYDGG PILGY
Sbjct: 595  GVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654

Query: 807  ILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP 866
             +ERKKK+S RWMRLNFDL +E + E ++MIEGV YE+R++AVNAIG+S+PS  S+PF+P
Sbjct: 655  FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVP 714

Query: 867  IGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCS------------ 914
            +   S PT L V+ V+DTTV+++WRPP+ +GA GLDGY +EYC EG +            
Sbjct: 715  LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAA 774

Query: 915  ------EWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEIL 968
                  +W+ A + L + T   +  LPT A++  RV+A N AG   P   ++P+ V+EI+
Sbjct: 775  YDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 834

Query: 969  QRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDT 1028
            + P++++PRHL+QT  ++VGE VNL+IPFQGKPRP++TW K+G  +   +++IRNS TDT
Sbjct: 835  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT 894

Query: 1029 ILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKP 1088
            I+FIR A R HSG Y + V+++   + A++ +Q++D+P PPQ +++ D WG NVAL W P
Sbjct: 895  IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTP 954

Query: 1089 PQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS 1148
            P+D GN  + GYT+QKADKK+MEWFTV+EHY RT   + EL+IGN YYFRVFS+NM G S
Sbjct: 955  PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014

Query: 1149 DRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSP 1208
            + A  TKE   I R G  Y+ P Y+  DFSEAP FTQPLVN   IAGY A L C+VRG+P
Sbjct: 1015 EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNP 1074

Query: 1209 KPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRL 1268
            KPKI+W KN + + +D R+RMFS QGV TLEIRKP P+DGG Y C+A N  G    EC+L
Sbjct: 1075 KPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134

Query: 1269 EVRV 1272
            EV+V
Sbjct: 1135 EVKV 1138



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 6/131 (4%)

Query: 6   KKPVSAFSK-KPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRH 64
           +K  +AF+K    + +V  G    F  E     ++V+W + G +I  S KY    +G + 
Sbjct: 248 EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307

Query: 65  TLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPA 124
            L +      D   Y V AG  K   +L V      EP +       + T   GE     
Sbjct: 308 ILFINNCQMTDDSEYYVTAGDEKCSTELFV-----REPPIMVTKQLEDTTAYCGERVELE 362

Query: 125 AELGESAPSPK 135
            E+ E   + K
Sbjct: 363 CEVSEDDANVK 373



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 6   KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDI--SASNKYGLATEGTR 63
           ++P    +K+        G     E E       V+W + G +I     ++Y +  EG +
Sbjct: 338 REPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKK 397

Query: 64  HTLTVREVGPADQGSYAVIA----GSSKVKFDLKVIE 96
           H L +     AD   Y+V+      S+K+  DLK ++
Sbjct: 398 HILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLK 434


>gi|55956914 myosin binding protein H [Homo sapiens]
          Length = 477

 Score =  434 bits (1117), Expect = e-121
 Identities = 211/424 (49%), Positives = 281/424 (66%), Gaps = 5/424 (1%)

Query: 848  AVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVE 907
            A  A   ++P+P S+       PS P  L ++DVS ++V++ W PPER+G  GL GY +E
Sbjct: 54   APTASTATKPAPPSEDV-----PSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLE 108

Query: 908  YCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEI 967
             C EG SEWV         T   V++L  G + L RV A + AG G P    +P+ ++E 
Sbjct: 109  LCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIREN 168

Query: 968  LQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTD 1027
            ++ P++++PRHLRQT  ++VGE VNL IPFQGKP+PQ TWT  G  L  + VS+R    D
Sbjct: 169  IEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRVSMRTGDQD 228

Query: 1028 TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWK 1087
            +ILFIR+A+R  SG Y++TVR+E++E KA + + V++KP PP  +R+ D WG N AL+W 
Sbjct: 229  SILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWT 288

Query: 1088 PPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF 1147
            PPQD GNTEL GY VQKADKKT +WFTVLE Y  T C + +LIIGN Y FRVFS+N+ G 
Sbjct: 289  PPQDTGNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGL 348

Query: 1148 SDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGS 1207
            S  A  TKE   I +  I  +P  +   DFSEAPSFTQPL + +   GY+  L C+VR S
Sbjct: 349  STSATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRAS 408

Query: 1208 PKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECR 1267
            PKPKI W KN +++  + ++R  S+QGV TLEIRKP PFD G+Y C+A N+ GEA  +CR
Sbjct: 409  PKPKIIWMKNKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCR 468

Query: 1268 LEVR 1271
            LEV+
Sbjct: 469  LEVK 472



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 51/213 (23%), Positives = 88/213 (41%), Gaps = 33/213 (15%)

Query: 643 EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
           E PKI +  P  +  T +   G  + L +P  G P P   W       +   A  +    
Sbjct: 170 EAPKIRV--PRHLRQTYIRQVGETVNLQIPFQGKPKPQATWT------HNGHALDSQRVS 221

Query: 703 EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
             TGD D                        SI  +  A++ D G Y +TV+    E + 
Sbjct: 222 MRTGDQD------------------------SILFIRSAQRSDSGRYELTVRVEDLEAKA 257

Query: 763 NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
            + + VI+ P  P++ ++ +V   +  +QW PP   G   +LGY++++  KK+ +W  + 
Sbjct: 258 VIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLGYMVQKADKKTGQWFTV- 316

Query: 823 FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMS 855
            +     +     +I G  Y  RV++ N  G+S
Sbjct: 317 LERYHPTTCTISDLIIGNSYSFRVFSENLCGLS 349



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 43/164 (26%), Positives = 68/164 (41%), Gaps = 15/164 (9%)

Query: 701 APEDTGDSDEWVFDKKLLCETEGRVRV-ETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
           +PE+T         K    E  G V V E+T++  +   +    +     T T   P  E
Sbjct: 13  SPEETASESA----KVPTAEPPGEVAVSESTREEQVPKPQAPAPQAPTASTATKPAPPSE 68

Query: 760 DQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWM 819
           D          VP AP    + +V   S TV WEPP   G   + GY+LE  ++ +  W+
Sbjct: 69  D----------VPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWV 118

Query: 820 RLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQP 863
            ++   +       R +  G  + +RV AV++ G   P+   QP
Sbjct: 119 PVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQP 162


>gi|194018539 myosin binding protein H-like [Homo sapiens]
          Length = 354

 Score =  344 bits (882), Expect = 4e-94
 Identities = 162/324 (50%), Positives = 214/324 (66%)

Query: 950  AGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTK 1009
            A PG    +  P  +  I + P++ LPR LRQT  +KVG+ VNLLIPFQGKP+PQ  WT 
Sbjct: 30   ASPGQGAGSPTPQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTH 89

Query: 1010 EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPP 1069
            +G  L    VS+RN   D+ILFIR A+R  SG YQ+ V++  +E  AT+ + V+++P PP
Sbjct: 90   DGCALDTRRVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDILVIERPGPP 149

Query: 1070 QDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPEL 1129
            Q +++ D WG +  LEW PPQD GNT L GYTVQKAD K+  WFTVLEHY RT C+V +L
Sbjct: 150  QSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDL 209

Query: 1130 IIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVN 1189
            IIGN Y FRVF++N  G S+ A  T +   I +    Y+   +   DFSEAP FTQPL +
Sbjct: 210  IIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLAD 269

Query: 1190 RSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGG 1249
             + + GY   L C VR SP+PKI W KN +D+  + ++R  +  G+ +LEIRKP PFDGG
Sbjct: 270  CTTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGG 329

Query: 1250 IYVCRATNLQGEARCECRLEVRVP 1273
            IY C+A N  GEA  +CR++V+VP
Sbjct: 330  IYTCKAVNPLGEASVDCRVDVKVP 353



 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 66/260 (25%), Positives = 103/260 (39%), Gaps = 41/260 (15%)

Query: 600 KLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTI 659
           KL + + +PAD       P   A + + +L          P +E PKI L  P  +  T 
Sbjct: 14  KLKVKEASPADAEPPQASPGQGAGSPTPQL--------LPPIEEHPKIWL--PRALRQTY 63

Query: 660 VVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLC 719
           +   G+ + L +P  G P P  IW                         D    D +   
Sbjct: 64  IRKVGDTVNLLIPFQGKPKPQAIWTH-----------------------DGCALDTR--- 97

Query: 720 ETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPK 779
               RV V   +  SI  +  A++ D G Y + V+    E    + + VI+ P  P + K
Sbjct: 98  ----RVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDILVIERPGPPQSIK 153

Query: 780 ISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEG 839
           + +V   S T++W PP   G   +LGY +++   KS  W  +  +     S     +I G
Sbjct: 154 LVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTV-LEHYHRTSCIVSDLIIG 212

Query: 840 VVYEMRVYAVNAIGMSRPSP 859
             Y  RV+A N  G+S  +P
Sbjct: 213 NSYAFRVFAENQCGLSETAP 232



 Score = 56.2 bits (134), Expect = 2e-07
 Identities = 45/172 (26%), Positives = 68/172 (39%), Gaps = 19/172 (11%)

Query: 860  ASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA 919
            A+   + I  P  P  + + DV   + +L+W PP+  G   L GY+V+        W   
Sbjct: 136  ATIDILVIERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTV 195

Query: 920  LQGLTEHTSILVKDLPTGARLLFRVRAHNMAG--PGAPVTT-------------TEPVTV 964
            L+     TS +V DL  G    FRV A N  G    AP+TT             T+    
Sbjct: 196  LEHY-HRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQ 254

Query: 965  QEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAG 1016
            ++  + P+   P     T+    G    L    +  PRP++ W K    + G
Sbjct: 255  RDFSEAPKFTQPLADCTTV---TGYNTQLFCCVRASPRPKIIWLKNKMDIQG 303


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  286 bits (732), Expect = 9e-77
 Identities = 238/845 (28%), Positives = 366/845 (43%), Gaps = 77/845 (9%)

Query: 386   ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCST 445
             +L+   A VKW +NG+EI+  G KY FE  G+   L I  C L D+  Y C V   K   
Sbjct: 12845 QLSREKANVKWYRNGREIK-EGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 12903

Query: 446   ELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKK 505
              LFV+E PV I RP +D L   G  V F  E++++  +V+WL++ + + + +  K++   
Sbjct: 12904 RLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD--KHQMMS 12961

Query: 506   DGQRHHLIINEAMLEDAGHYALCTSGGQALAEL-IVQEKKLEVYQSIADLMVGAKDQAVF 564
             +G+ H L I +    D G Y       +A A+L +    K++       + VG     V 
Sbjct: 12962 EGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVV 13021

Query: 565   KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
               +   +     W K  + L   S   +          I +    D+  Y  V +    N
Sbjct: 13022 PYDAYPK-AEAEWFKENEPL---STKTIDTTAEQTSFRILEAKKGDKGRYKIVLQ----N 13073

Query: 625   LSAKLH-FMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW 683
                K   F+ +K+            +D PG + +           L+V  + D   ++ W
Sbjct: 13074 KHGKAEGFINLKV------------IDVPGPVRN-----------LEVTETFDGEVSLAW 13110

Query: 684   QKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEK 743
             ++ +T G         +  +    +     D+   CE               FTV G +K
Sbjct: 13111 EEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE---------------FTVTGLQK 13155

Query: 744   ED-EGVYTVTVKNPVGEDQVNLTVKVI------DVPDAPAAPKISNVGEDSCTVQWEPPA 796
                E ++ V+ +N VG  +   T   +      DVP  P    I++V     ++ WEPP 
Sbjct: 13156 GGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPE 13215

Query: 797   YDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSR 856
             YDGG  I  Y++E + K S RW        ++LS     ++EG  Y  RV A N IG+ +
Sbjct: 13216 YDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGK 13275

Query: 857   PSPASQPFM----PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG 912
             PS A+ PF+    PI  PS P +L   D + ++V LKW PP + G   + GY +E C EG
Sbjct: 13276 PSAAT-PFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEG 13334

Query: 913   CSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPR 972
                W+     L    +  V  L  G + L+RV A N AG   P     P+T  +    P 
Sbjct: 13335 KDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPT 13394

Query: 973   LQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILF 1031
             + L    +  ++  V  P+ +L+P  G PRP  TW    + L  G+ V ++       L 
Sbjct: 13395 MDLSA-FKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELV 13453

Query: 1032  IRAARRVHSGTYQVTVRIENMED--KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
             I  + R   G Y  T+++EN        + + V+ +PS P++L+  D    +V L W+PP
Sbjct: 13454 ISPSERSDKGIY--TLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPP 13511

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
              D G + L GY V+K +     W  V++        VP+L+ G  Y F+V ++N  G   
Sbjct: 13512 DDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCG-PG 13570

Query: 1150  RAATTKEPVFIPRPGITYEPP-NYKALDFSEAPSFT--QPLVN--RSVIAGYTAMLCCAV 1204
               A   EPV +  P    +PP N K  D +    F    P  N   S I GY    C   
Sbjct: 13571 EPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERC--P 13628

Query: 1205  RGSPK 1209
             RGS K
Sbjct: 13629 RGSDK 13633



 Score =  243 bits (619), Expect = 1e-63
 Identities = 204/708 (28%), Positives = 303/708 (42%), Gaps = 81/708 (11%)

Query: 567   EVSDENVRGVWLKNGKELVPDSRIKVSHI--GRVHKLTIDDVTPADEADYSFVPEGFACN 624
             +V DE  R     +  E  P+++ KV+ +  G+ +K  +  V  A E+D + VPE     
Sbjct: 17153 KVGDEEWRRA--NHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVK 17210

Query: 625   LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQ 684
                             R EPP++ LD        I V  G+ LRL   I G P P V W+
Sbjct: 17211 ---------------DRLEPPELILDANMAREQHIKV--GDTLRLSAIIKGVPFPKVTWK 17253

Query: 685   KAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKE 744
             K              DAP                     + R++ T   S   +  A  E
Sbjct: 17254 KEDR-----------DAPT--------------------KARIDVTPVGSKLEIRNAAHE 17282

Query: 745   DEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL 804
             D G+Y++TV+NP G   V++ V V+D P  P   ++S + +DSC + W+ P  DGG  I 
Sbjct: 17283 DGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVIT 17342

Query: 805   GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMS------RPS 858
              Y++ER+   S +W  L+    ++ SH A+ + EG  Y  RV A N  G        +P 
Sbjct: 17343 NYVVERRDVASAQWSPLS-ATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPI 17401

Query: 859   PASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVA 918
              A  P  P GPP +  H+   DV  T VSL W  P+R G   + GY VEY  EG  +W+ 
Sbjct: 17402 KALDPLHPPGPPKDLHHV---DVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK 17458

Query: 919   ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
                    +   +V  L  G    FRV+A N+ G G P  TT P+  QE L  P ++L   
Sbjct: 17459 F--KTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVK 17515

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARR 1037
             L + +  K G  V      +G P P   WT +G  +   E  ++      ++L I+   R
Sbjct: 17516 LIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 17575

Query: 1038  VHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTE 1096
               +G YQ+TV          + L V+D P PP   + + D    ++ + W+PP+D G + 
Sbjct: 17576 RDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSP 17635

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS---DRAAT 1153
             +  Y V+K D +   W  V     +T   +P L  G  Y FRV ++N +G     D   T
Sbjct: 17636 VINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPT 17695

Query: 1154  TKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVN-RSVIAGY------TAMLCCAVRG 1206
               +  F P P    +P      + +   S+T P  +  S I GY             V  
Sbjct: 17696 VAKHKFSP-PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNK 17754

Query: 1207  SPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCR 1254
             +P   + +   GL  G    FR+F++       + KP P    I  CR
Sbjct: 17755 TPIADLKFRVTGLYEGNTYEFRVFAEN---LAGLSKPSPSSDPIKACR 17799



 Score =  238 bits (608), Expect = 2e-62
 Identities = 190/681 (27%), Positives = 288/681 (42%), Gaps = 96/681 (14%)

Query: 344   DLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEI 403
             DLR +++ LK +   EKKS  F  K+            RL V L       KW KNG+E+
Sbjct: 12733 DLR-IVEPLKDIETMEKKSVTFWCKVN-----------RLNVTL-------KWTKNGEEV 12773

Query: 404   QMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQ 463
                 ++  +     K  LTI  C   D+  Y    G +K   EL + E P      LEDQ
Sbjct: 12774 PFD-NRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 12832

Query: 464   LVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAG 523
              V       F C++S E A VKW ++G E+  +E  KY+F+KDG  H LII +  L+D  
Sbjct: 12833 TVTEFDDAVFSCQLSREKANVKWYRNGREI--KEGKKYKFEKDGSIHRLIIKDCRLDDEC 12890

Query: 524   HYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKE 583
              YA      ++ A L V+E  +E+ +   D++       VF  E++ + V   WL+N   
Sbjct: 12891 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 12950

Query: 584   LVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE 643
             +V   + ++   G++H+L I D+ P D+ +Y F+         AK      K++      
Sbjct: 12951 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI---------AKDKEARAKLELA---A 12998

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
              PKI           +VV  G  L + VP    P     W K                  
Sbjct: 12999 APKIK-----TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKE----------------- 13036

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
                       ++ L  +T     ++TT +++ F +  A+K D+G Y + ++N  G+ +  
Sbjct: 13037 ----------NEPLSTKT-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGF 13081

Query: 764   LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF 823
             + +KVIDVP      +++   +   ++ WE P  DGG  I+GY++ER+  K   W+ L  
Sbjct: 13082 INLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWV-LAT 13140

Query: 824   DLIQELSHEARRMIE-GVVYEMRVYAVNAIGMSRPSPASQPF---MPIGPPSEPTHLAVE 879
             D  +        + + GV Y  RV A N +G   P     P         P  P ++ + 
Sbjct: 13141 DRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTIT 13200

Query: 880   DVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
             DV+   VSL W PPE  G   +  Y +E   +    W  A+    E  S  V D+  G  
Sbjct: 13201 DVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQE 13260

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
               FRVRA N  G G P   T  V V + ++RP                  PVNL    Q 
Sbjct: 13261 YSFRVRAQNRIGVGKPSAATPFVKVADPIERP----------------SPPVNLTSSDQT 13304

Query: 1000  KPRPQVTWTKE----GQPLAG 1016
             +   Q+ W       G P+ G
Sbjct: 13305 QSSVQLKWEPPLKDGGSPILG 13325



 Score =  236 bits (601), Expect = 1e-61
 Identities = 159/530 (30%), Positives = 248/530 (46%), Gaps = 48/530 (9%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R EPP+I LD   R    +V+ A   LRL V I G P P V W+KA              
Sbjct: 25101 RIEPPEIELDADLR--KVVVLRASATLRLFVTIKGRPEPEVKWEKA-------------- 25144

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                           + +L +   R ++E T   ++  ++   + D G Y +T++N  G  
Sbjct: 25145 --------------EGILTD---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSK 25187

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSYRW 818
                + V+V+D P AP    I  V +DS T+ WEPP  DGG  I  YI+E+++  +K+Y  
Sbjct: 25188 TAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYAT 25247

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAV 878
             +  N     + +     + EG  Y  RV A N  G+  P+  ++P     PP  P  + +
Sbjct: 25248 ITNN---CTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTL 25304

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
              DV+  T ++KW  PE  G   + GY VE   +G  +W    Q  T   +I    L  G 
Sbjct: 25305 VDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATI--SGLTAGE 25362

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
               +FRV A N  G   P     PV  ++I  +P ++LP H   T   K  E + + +PF+
Sbjct: 25363 EYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFK 25419

Query: 999   GKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             G+P+  V W K+GQ L     V++ +S T T L I+ A +   GTY++ V          
Sbjct: 25420 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 25479

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
             + + V+D+P PP  +R+ +    ++ + W PP+  G  ++  Y V+K +  +  W  V +
Sbjct: 25480 ITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ 25539

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVG---FSDRAATTKEPVFIPRPG 1164
                RT   +  L  G+ Y FRV ++N  G   +S+ +A   E  F P PG
Sbjct: 25540 AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSP-PG 25588



 Score =  234 bits (596), Expect = 5e-61
 Identities = 179/608 (29%), Positives = 272/608 (44%), Gaps = 59/608 (9%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W   G +L    R+ V    +V KLTI + T  D  +Y+   +      S       +K+
Sbjct: 29772 WFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSET-----IKV 29826

Query: 637   DFVPRQEPPK--IHLDCPGRIPDTIVVVAGNKLRLD--VPISGDPAPTVIWQKAITQGNK 692
               + +  PP   I +D    I  T + ++     LD   P+SG     V+ Q+       
Sbjct: 29827 IILDKPGPPTGPIKID---EIDATSITISWEPPELDGGAPLSG----YVVEQR------- 29872

Query: 693   APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                    DA                     G + V  +  RS F      + +E V+ V 
Sbjct: 29873 -------DA------------------HRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVA 29907

Query: 753   VKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYI 807
               N  G     + +V      I +P  P   +I +V  D  T+ W PP  DGG  + GYI
Sbjct: 29908 ATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYI 29967

Query: 808   LERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM-- 865
             +ERK+ ++ RW+R+N   +    + +  + EG+ YE RV A+NA G  +PS  S+P +  
Sbjct: 29968 VERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAM 30027

Query: 866   -PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLT 924
              PI PP +P +  V D + T+VSL W  PE  G   + GY +E       EW       T
Sbjct: 30028 DPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPT 30087

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
             +     +  LP GA   FRV A N  GPG P      V V E+L+ P  +L    ++ I 
Sbjct: 30088 KIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIF 30147

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
              + G  + L IP +GKP P   WTKEGQ ++ +   I  S T T L I+ A R  SGTY 
Sbjct: 30148 VRQGGVIRLTIPIKGKPFPICKWTKEGQDIS-KRAMIATSETHTELVIKEADRGDSGTYD 30206

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             + +  +  +    + ++V+  P+ P+  L   D    +V + W+PP D G  ++ GY ++
Sbjct: 30207 LVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILE 30266

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             + +     W+T+    R T  VV  L     Y+FRV ++N  G S +   ++EPV    P
Sbjct: 30267 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS-KPLKSEEPVTPKTP 30325

Query: 1164  GITYEPPN 1171
                 EPP+
Sbjct: 30326 LNPPEPPS 30333



 Score =  232 bits (591), Expect = 2e-60
 Identities = 155/508 (30%), Positives = 236/508 (46%), Gaps = 43/508 (8%)

Query: 702   PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG- 758
             P+D G S    +V +K+     +  V V +      +T+    +  E V+ +  +N  G 
Sbjct: 16241 PKDDGGSKITNYVIEKRE-ANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGI 16299

Query: 759   ----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
                 + +      +  VP AP  P +S+V  +S TV WE P YDGG P+ GY LE K   
Sbjct: 16300 GEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTT 16359

Query: 815   SYRWMRLNFDLIQEL----SHEARRMIEGVVYEMRVYAVNAIGM------SRPSPASQPF 864
             S RW R+N D I+ +    S++   +IEG  Y+ RVYA+NA G+      S P+ A  P 
Sbjct: 16360 SKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI 16419

Query: 865   MPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLT 924
              P GPP       V D + ++  L+W PP + G   + GY VEY  EG  EW        
Sbjct: 16420 APPGPPFPK----VTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEV 16475

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
               T ++V  L  GA   FRVRA N+AG G P   T+ + +++ L  P LQL   +R  I 
Sbjct: 16476 RGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIV 16535

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
                G  + ++    GKP P VTW    + L  +E +I  +   + + I+  +R H G Y 
Sbjct: 16536 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLP-QEATIETTAISSSMVIKNCQRSHQGVYS 16594

Query: 1045  VTVRIENMEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             +  + E  E K T+++ V+D P P        +    +  L W  P+D G + +  Y ++
Sbjct: 16595 LLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIE 16654

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF-----SDRAATTKEPV 1158
             K +     W  V     R +  V  LI G  Y+FR+ ++N +G      +  A   +EP+
Sbjct: 16655 KRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPI 16714

Query: 1159  FIP-RP-------------GITYEPPNY 1172
              +P RP              +T+ PP Y
Sbjct: 16715 TVPERPEDLEVKEVTKNTVTLTWNPPKY 16742



 Score =  232 bits (591), Expect = 2e-60
 Identities = 161/590 (27%), Positives = 263/590 (44%), Gaps = 48/590 (8%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P++ LD    +   IVV AG   R+ +P  G P P + W +                 
Sbjct: 24020 EAPELDLD--SELRKGIVVRAGGSARIHIPFKGRPTPEITWSR----------------- 24060

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                   +E  F  K        V++E   + +  +++  ++ D G Y + ++N  G    
Sbjct: 24061 ------EEGEFTDK--------VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSA 24106

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
              +TVKV+D P  P    +  V +DS  + WEPP  DGG  +  Y++++++     +  ++
Sbjct: 24107 FVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVS 24166

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVS 882
                  + S +   + EG +Y  RV A N  G+  P           PPS P  + + DVS
Sbjct: 24167 -SKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVS 24225

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
              T+ SL W  PE  G   + GY VE  P+G  +W  ++   ++  + +V  L +G    F
Sbjct: 24226 QTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKW--SIVAESKVCNAVVTGLSSGQEYQF 24283

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV+A+N  G   P     PV  +++  +P L+LP +   T   + GE + + IP  G+PR
Sbjct: 24284 RVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPR 24340

Query: 1003  PQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQ 1061
             P ++W K+G+PL     V++  + T T+L I+   +   G Y VT           L + 
Sbjct: 24341 PNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVI 24400

Query: 1062  VVDKPSPP-QDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             V++KP PP   +R  +     V + W+PP   G  ++  Y V+K D  T  W  V     
Sbjct: 24401 VLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA 24460

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
             RT   + +L  G  Y FR+F++N  G S  A    + V +  P   ++ P      F  +
Sbjct: 24461 RTTIKITKLKTGTEYQFRIFAENRYGKS--APLDSKAVIVQYP---FKEPGPPGTPFVTS 24515

Query: 1181  PSFTQPLV--NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFR 1228
              S  Q LV  +  V  G T ++   +    K  I W K      +D +F+
Sbjct: 24516 ISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 24565



 Score =  231 bits (588), Expect = 4e-60
 Identities = 175/602 (29%), Positives = 273/602 (45%), Gaps = 99/602 (16%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW------------------- 683
             EPP++ +D   R  D IVV AG  L+++  I+G P P + W                   
Sbjct: 25785 EPPRVMMDVKFR--DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTD 25842

Query: 684   ----------------QKAITQGNKAPAR-----------PAPDA--------------- 701
                             Q  +T  N A  R           P P A               
Sbjct: 25843 NHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSL 25902

Query: 702   ----PEDTG--DSDEWVFDKK-------LLCETEGRVRVETTKDRSIFTVEGAEKEDEGV 748
                 P++ G  D D ++ +K+        +CE  G +++ + K   +       K +E +
Sbjct: 25903 SWGRPQEDGGADIDYYIVEKRETSHLAWTICE--GELQMTSCKVTKLL------KGNEYI 25954

Query: 749   YTVTVKNP--VGEDQVNLTVKVID---VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI 803
             + VT  N   VGE   ++ +K +D   VP  P + +I++V ++S T+ W  P  DGG  I
Sbjct: 25955 FRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEI 26014

Query: 804   LGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQP 863
              GYI+ER++K S RW+R+N   + +L  ++  + EG  YE RVYA NA G+S PS  S  
Sbjct: 26015 SGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPL 26074

Query: 864   FM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAAL 920
                  P+  PS P+   + D   TT+++ W  P   G   + GY+VEY     ++W  ++
Sbjct: 26075 IRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSI 26134

Query: 921   QGL--TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
             Q L  TE+T   +  L TGA  +FRV++ N  G   P  +++P   +E  + P   +   
Sbjct: 26135 QSLRGTEYT---ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSE 26191

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRV 1038
             +R+T+  K G    + +PF+G+P P V W+K    L      +  + + T L I  A R 
Sbjct: 26192 MRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLR-TRAYVDTTDSRTSLTIENANRN 26250

Query: 1039  HSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
              SG Y +T++        TLV++V+D P PP ++ V D    +  L W  P++ G   + 
Sbjct: 26251 DSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVK 26310

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
              Y ++K +     W +V  +  R    V  L  G  YYFRV  +N  G     A TKE V
Sbjct: 26311 NYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVG-IPAETKEGV 26369

Query: 1159  FI 1160
              I
Sbjct: 26370 KI 26371



 Score =  230 bits (587), Expect = 6e-60
 Identities = 151/532 (28%), Positives = 240/532 (45%), Gaps = 42/532 (7%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R+E P   +D   R   T++V AG    + VP  G P P V+W K             PD
Sbjct: 26180 REEEPLFDIDSEMR--KTLIVKAGASFTMTVPFRGRPVPNVLWSK-------------PD 26224

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                 T                  R  V+TT  R+  T+E A + D G YT+T++N +   
Sbjct: 26225 TDLRT------------------RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 26266

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMR 820
              + L VKV+D P  P    + +V ++S  + W+ P  DGG P+  Y +E+++     W+ 
Sbjct: 26267 SLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVS 26326

Query: 821   LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVED 880
             +  +    LS++   + EG +Y  RV   N  G+  P+   +       PS P  L V  
Sbjct: 26327 VTNNC-NRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEKPSPPEKLGVTS 26385

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL 940
             +S  +VSL W  PE  G   +  Y VE   +G   WV     + + T  +V  L   +  
Sbjct: 26386 ISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEY 26443

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FRV A N AG   P     PV ++E L+ P + +      T+  + G  + + IP  GK
Sbjct: 26444 FFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGK 26503

Query: 1001  PRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLV 1059
             P P+VT +++G PL A    +   +  +  + ++ +    +G Y++T    +   KA + 
Sbjct: 26504 PLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFIN 26563

Query: 1060  LQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEH 1118
             + V+D+P PP   + ++D    +V L+W+PP+  G +++  Y + K +  T  W  V   
Sbjct: 26564 IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT 26623

Query: 1119  YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR----AATTKEPVFIPRPGIT 1166
               RT   V +L  G  Y FR+ ++N  G SD       T K P   P P  T
Sbjct: 26624 VARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPST 26675



 Score =  229 bits (585), Expect = 1e-59
 Identities = 167/615 (27%), Positives = 275/615 (44%), Gaps = 63/615 (10%)

Query: 565   KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
             +CE   +N    W++   +LVP+   KV+ + + +K  +  V+  ++A  S  P      
Sbjct: 13330 RCEEGKDN----WIRCNMKLVPELTYKVTGLEKGNKY-LYRVSAENKAGVSD-PSEILGP 13383

Query: 625   LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQ 684
             L+A   F+E  +D                   D + V+  N + + VP +G P PT  W 
Sbjct: 13384 LTADDAFVEPTMDL--------------SAFKDGLEVIVPNPITILVPSTGYPRPTATW- 13428

Query: 685   KAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKE 744
                                         F  K+L ET  RV+++T    +   +  +E+ 
Sbjct: 13429 ---------------------------CFGDKVL-ETGDRVKMKTLSAYAELVISPSERS 13460

Query: 745   DEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL 804
             D+G+YT+ ++N V      + V VI  P AP   K  ++ +DS  + WEPP  DGG P+ 
Sbjct: 13461 DKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLT 13520

Query: 805   GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPF 864
             GY++E+++     W ++  D + +L      +++G  Y  +V A N  G   P+   +P 
Sbjct: 13521 GYVVEKREVSRKTWTKV-MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPV 13579

Query: 865   ---MPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQ 921
                 P   P  P ++   D +  ++ L W PP+  G   + GY VE CP G  +WVA  +
Sbjct: 13580 NMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE 13639

Query: 922   GLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQ 981
              + E T + V  L  G    +RV+A N  G   P   TE +   +  + P + L   L  
Sbjct: 13640 PVAE-TKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLA 13698

Query: 982   TIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIRAARRVHS 1040
              +  K G  + L     GKP P++TWTK    L  ++ ++I N P  + + I  ++R  +
Sbjct: 13699 GLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDT 13758

Query: 1041  GTYQVTVRIENMEDKATLVLQ--VVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
             GTY   +   N+  +AT V++  V+DKP PP    +TD    +  L W PP+D G +++ 
Sbjct: 13759 GTY--IIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKIT 13816

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD----RAATT 1154
              Y V++    +  W  +    + T+    +LI    Y FRV ++NM G  +       T 
Sbjct: 13817 NYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITA 13876

Query: 1155  KEPVFIPRPGITYEP 1169
             K     P P    EP
Sbjct: 13877 KYQFDPPGPPTRLEP 13891



 Score =  225 bits (574), Expect = 2e-58
 Identities = 166/609 (27%), Positives = 271/609 (44%), Gaps = 60/609 (9%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P I LD   R    I + AG  LRL VPI G P P V W K                 
Sbjct: 22938 EAPDIDLDLELR--KIINIRAGGSLRLFVPIKGRPTPEVKWGKV---------------- 22979

Query: 703   EDTGDSDEWVFDKKLLCETEGRVR----VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG 758
                                +G +R    ++ T   +   ++   + D G YT+T++N  G
Sbjct: 22980 -------------------DGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSG 23020

Query: 759   EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSY 816
                  +TV+V+D P  P   K++ + +DS ++ WEPP  DGG  I  YI+E+++  +KSY
Sbjct: 23021 TKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSY 23080

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHL 876
               +  N     + S +  ++ EG  Y  RV A N  G+  P+  + P      P  P  +
Sbjct: 23081 AAVVTN---CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 23137

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V+DV+  +VSL W  PE  G   +  Y VE   +   +W    +   +    ++ +L  
Sbjct: 23138 TVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQ 23195

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G   LFRV A N  G   P +   P+  ++++  P ++ P     ++Q  VG+ + + +P
Sbjct: 23196 GEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVK-PAFSSYSVQ--VGQDLKIEVP 23252

Query: 997   FQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDK 1055
               G+P+P +TWTK+G PL     +++ +S   T L I+   +   G Y +TV     +  
Sbjct: 23253 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 23312

Query: 1056  ATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFT 1114
             A++ +  +DKP PP+  ++  D    ++ L W PP   G  ++  Y VQK D  T  W  
Sbjct: 23313 ASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDV 23372

Query: 1115  VLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKA 1174
             V     RT   V +L  G  Y FR+F++N  G S   A   +P+    P   Y+ P    
Sbjct: 23373 VSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS--FALESDPIVAQYP---YKEPGPPG 23427

Query: 1175  LDFSEAPSFTQPLV--NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSK 1232
               F+ A S    ++  +  V  G + ++   +    +  I W K    +  D +F+  + 
Sbjct: 23428 TPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNL 23487

Query: 1233  QGVLTLEIR 1241
             +  +  E R
Sbjct: 23488 EEGIEYEFR 23496



 Score =  224 bits (571), Expect = 4e-58
 Identities = 156/532 (29%), Positives = 231/532 (43%), Gaps = 44/532 (8%)

Query: 622   ACNLSAKLHFME--VKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAP 679
             A N+     + E   +I+ V R E P + L     +  T+ + AG  LRL V +SG P P
Sbjct: 29419 AVNVKGMSEYSESIAEIEPVERIEIPDLEL--ADDLKKTVTIRAGASLRLMVSVSGRPPP 29476

Query: 680   TVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE 739
              + W K   QG                             +   R  ++TT+  S+  V+
Sbjct: 29477 VITWSK---QG----------------------------IDLASRAIIDTTESYSLLIVD 29505

Query: 740   GAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDG 799
                + D G YT+  +N  G+    + VKV D P    + K+  V  DS T+ WE P  DG
Sbjct: 29506 KVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDG 29565

Query: 800   GQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP 859
             G P+  YI+E K++ + R  +       +  +    ++EG +Y  RV   N  G+  P  
Sbjct: 29566 GAPVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE 29624

Query: 860   ASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW--- 916
              S   +    P  P  L V DV+ +TV+L W  P   G   L GY +E C  G   W   
Sbjct: 29625 TSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKV 29684

Query: 917   VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLP 976
             V     + EHT   V  L  G + LFR+RA N  G   P  T   VTVQ++   P + L 
Sbjct: 29685 VTLKPTVLEHT---VTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLS 29741

Query: 977   RHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAA 1035
                ++TI    G PV L+IP  G+P P  +W   G  L   E V++        L IR  
Sbjct: 29742 TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRET 29801

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGN 1094
                 +G Y + ++        T+ + ++DKP PP   +++ +    ++ + W+PP+  G 
Sbjct: 29802 TIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGG 29861

Query: 1095  TELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
               L GY V++ D     W  V E   R+      L  GN Y FRV + N  G
Sbjct: 29862 APLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG 29913



 Score =  220 bits (561), Expect = 6e-57
 Identities = 171/617 (27%), Positives = 257/617 (41%), Gaps = 63/617 (10%)

Query: 575   GVWLKNGKELVPDSRIKVSHI--GRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFM 632
             G W K   E    +R  V+ +  G  +K  +  +  A + D        +C ++      
Sbjct: 28298 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGD--------SCEVTGT---- 28345

Query: 633   EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNK 692
                I  V R   P++ +D       T VV AG  +RL +   G P PT +W K       
Sbjct: 28346 ---IKAVDRLTAPELDIDA--NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSK------- 28393

Query: 693   APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                   PD+                      R  + TT   S  TVE   + D G YT+T
Sbjct: 28394 ------PDS------------------NLSLRADIHTTDSFSTLTVENCNRNDAGKYTLT 28429

Query: 753   VKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             V+N  G   +  TVKV+D P  P      +V   S T+ W+ P  DGG  I  Y++E+++
Sbjct: 28430 VENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKRE 28489

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSE 872
                  W  ++    +++  +   + EGV Y  RV AVN  G+  P    +P +    P+ 
Sbjct: 28490 ASRRSWQVISEKCTRQI-FKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAP 28548

Query: 873   PTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVK 932
             P  L V D S ++  L W  P+  G   + GY +E   +G   WV A  G T+  +  V+
Sbjct: 28549 PRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA--GHTKQLTFTVE 28606

Query: 933   DLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN 992
              L       FRV+A N AG   P      V ++E    P   L     Q I  K G P  
Sbjct: 28607 RLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFT 28666

Query: 993   LLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
             + +P  G+P P+VTW  E   L   + VSI  +   T L ++ + R  SG Y +T+    
Sbjct: 28667 IDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTA 28726

Query: 1052  MEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTM 1110
                  ++ + V+ +P P    + V+     +  L W  P+D G TE+  Y V+K +  T 
Sbjct: 28727 GVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTT 28786

Query: 1111  EWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS---DRAATTKEPVFIP-----R 1162
              W  V    +RT   V  L     Y FRV S+N  G S   + A    E  F+P     R
Sbjct: 28787 AWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTR 28846

Query: 1163  PGITYEPPNYKALDFSE 1179
             P + +   N  ++ + E
Sbjct: 28847 PEVYHVSANAMSIRWEE 28863



 Score =  219 bits (559), Expect = 1e-56
 Identities = 172/604 (28%), Positives = 278/604 (46%), Gaps = 64/604 (10%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W+K  +EL   +R+++        L++ D    D  +Y    +  A   S  ++   VK+
Sbjct: 22577 WIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVN---VKV 22633

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                         LD PG  P+  VV++G        ++ +   T+ W+  +  G      
Sbjct: 22634 ------------LDRPGP-PEGPVVISG--------VTAEKC-TLAWKPPLQDGGS---- 22667

Query: 697   PAPDAPEDTGDSDEWVFDKK---LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
                       D   ++ +++    L  T     V+T   +    +EG    +E  + +  
Sbjct: 22668 ----------DIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEG----NEYTFRIMA 22713

Query: 754   KNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYIL 808
              N  G     E +  +      VPDAP AP+++ V +DS  V WE PA DGG  ILGY+L
Sbjct: 22714 VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVL 22773

Query: 809   ERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPAS---QPFM 865
             E++ K+  RW R +  LI EL      +IE   YE RV A NA G+S PSP S   +   
Sbjct: 22774 EKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD 22833

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAAL--QGL 923
             PI  P  P +  V D++ ++V L W  P   G   + GY VE C     EW       G+
Sbjct: 22834 PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGI 22893

Query: 924   TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
              + T+I V+ L       FR+ A N AG G       P+ V+E L+ P + L   LR+ I
Sbjct: 22894 NK-TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKII 22952

Query: 984   QKKVGEPVNLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
               + G  + L +P +G+P P+V W K +G+      + + +S T  +L      R  SG 
Sbjct: 22953 NIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVL--DNVNRYDSGK 23010

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
             Y +T+   +    A + ++V+D PSPP +L+VT+    +V++ W+PP   G +++  Y V
Sbjct: 23011 YTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIV 23070

Query: 1103  QKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV---F 1159
             +K +     +  V+ +  +    + +L  G  YYFRV ++N  G     A T +P+    
Sbjct: 23071 EKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIG-LPAQTADPIKVAE 23129

Query: 1160  IPRP 1163
             +P+P
Sbjct: 23130 VPQP 23133



 Score =  219 bits (557), Expect = 2e-56
 Identities = 152/493 (30%), Positives = 234/493 (47%), Gaps = 38/493 (7%)

Query: 700   DAPEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFT----VEGAEKEDEGVYTVTV 753
             D PED G  +   ++ +K   CET+  V   +T   ++ T    V    + +E ++ V  
Sbjct: 18318 DPPEDDGGCEIQNYILEK---CETKRMVW--STYSATVLTPGTTVTRLIEGNEYIFRVRA 18372

Query: 754   KNPVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYIL 808
             +N +G      +  VI     D P  P  P+++ V ++  TV W PP YDGG+ I GY L
Sbjct: 18373 ENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFL 18432

Query: 809   ERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM--- 865
             E+K+K S RW+ +N   I E   + + ++    Y+ RV A N IG+  PS  S+P +   
Sbjct: 18433 EKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKD 18492

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP--------EGCSEWV 917
             PI PP  PT+  V D +  +++L W  P   G   + GY VE  P        EG     
Sbjct: 18493 PIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCN 18552

Query: 918   AALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPR 977
             AA Q + +     V  L       FRV A N  G G P    E +  +EIL+ P + L  
Sbjct: 18553 AAAQLVRK--EFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDA 18610

Query: 978   HLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
              +R+ +  + G P+ L    +G+P P+VTW K G      +  +    T   L I  + R
Sbjct: 18611 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTR 18670

Query: 1038  VHSGTYQVTVRIENMEDKATLV-LQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               SG Y +T+ +    +KA  V ++V+D P P  DL+V+D    +  + W PP++ G ++
Sbjct: 18671 DDSGKYSLTL-VNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQ 18729

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKE 1156
             +  Y V+K +     W TV    ++T   V  L+ GN YYFRV + N  G          
Sbjct: 18730 VTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYG-------PGV 18782

Query: 1157  PVFIPRPGITYEP 1169
             P  +P+P +  +P
Sbjct: 18783 PTDVPKPVLASDP 18795



 Score =  218 bits (554), Expect = 4e-56
 Identities = 174/627 (27%), Positives = 269/627 (42%), Gaps = 72/627 (11%)

Query: 573   VRGV------WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLS 626
             +RGV      W  +G E+  D    V        LTI +    D  +Y       A + +
Sbjct: 17534 IRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKT 17593

Query: 627   AKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKA 686
               +H                  LD PG     I +       LDV        T+ WQ  
Sbjct: 17594 VAVHLTV---------------LDVPGPPTGPINI-------LDVT---PEHMTISWQP- 17627

Query: 687   ITQGNKAPARPAPDAPEDTGDSD--EWVFDKK-LLCETEGRVRVETTKDRSIFTVEGAEK 743
                            P+D G S    ++ +K+    +T G V   ++K +    +   +K
Sbjct: 17628 ---------------PKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK--LKIPHLQK 17670

Query: 744   EDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD 798
               E V+ V  +N +G     +    +       P  P  P ++++ E++ TV W  P  D
Sbjct: 17671 GCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSD 17730

Query: 799   GGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPS 858
             GG PI GY +ER++    +W+R+N   I +L      + EG  YE RV+A N  G+S+PS
Sbjct: 17731 GGSPITGYYMERREVTG-KWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPS 17789

Query: 859   PASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSE 915
             P+S P     PI PP  P +  ++D S  T  L W  P   G   + GY VE    G ++
Sbjct: 17790 PSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQ 17849

Query: 916   WVAALQG-LTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQ 974
             W    +  L    +  V  L  G    FR++A N+ G G P    E V  ++IL  P ++
Sbjct: 17850 WNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE 17909

Query: 975   LPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIR 1033
             L    R  I  +VG+ + +L   +G+P P +TWTKEG+ L  E+ V +        L I+
Sbjct: 17910 LDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIK 17969

Query: 1034  AARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
              A R   G Y ++ +  +   + + ++ V+D+P P Q+L+VT+    N  + W+ P D G
Sbjct: 17970 EAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNG 18029

Query: 1094  NTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
              +E+  + V+        W  V     +   +   L+  N YYFRV ++N VG       
Sbjct: 18030 GSEITNFIVEYRKPNQKGWSIVASDVTK-RLIKANLLANNEYYFRVCAENKVGVGP-TIE 18087

Query: 1154  TKEPVF----IPRPGITYEPPNYKALD 1176
             TK P+     I RPG   EP N    D
Sbjct: 18088 TKTPILAINPIDRPG---EPENLHIAD 18111



 Score =  218 bits (554), Expect = 4e-56
 Identities = 153/548 (27%), Positives = 243/548 (44%), Gaps = 49/548 (8%)

Query: 633   EVKIDFVPRQ--EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQG 690
             E+K    P++  EPP+I LD   R    ++V AG  +RL   + G PAP V W+K    G
Sbjct: 18590 ELKEAIKPKEILEPPEIDLDASMR--KLVIVRAGCPIRLFAIVRGRPAPKVTWRKV---G 18644

Query: 691   NKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYT 750
                  R                             +V+     +   +  + ++D G Y+
Sbjct: 18645 IDNVVRKG---------------------------QVDLVDTMAFLVIPNSTRDDSGKYS 18677

Query: 751   VTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
             +T+ NP GE  V + V+V+D P   +  K+S+V + SC V W PP  DGG  +  YI+E+
Sbjct: 18678 LTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK 18737

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PI 867
             ++     W  +  + +++ S     ++ G  Y  RV AVN  G   P+   +P +   P+
Sbjct: 18738 READRKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPL 18796

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG--CSEWVAALQGLTE 925
               P  P  L V +++  + +L W PP R G   +DGY   Y  E      W      + +
Sbjct: 18797 SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTE--YSVVK 18854

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
               S++V  L  G +  FRV A N  G   P         +E L  P++ +P    + I  
Sbjct: 18855 DLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP----EQITI 18910

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
             K G+ + +     GKP P   W K E + +    +++  + + +IL I+   R  SG Y 
Sbjct: 18911 KAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYS 18970

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             +T    +  D   + + V+D P PPQ    ++D      +L W  P + G + +  Y V+
Sbjct: 18971 LTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVE 19030

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             K D    +W T L    +T C V +LI G  Y FRV ++N  G S+   + K     P  
Sbjct: 19031 KCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPF- 19089

Query: 1164  GITYEPPN 1171
             G+  EP N
Sbjct: 19090 GVPSEPKN 19097



 Score =  217 bits (552), Expect = 7e-56
 Identities = 151/520 (29%), Positives = 234/520 (45%), Gaps = 42/520 (8%)

Query: 636   IDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPA 695
             I+   R   P + LD   R  D IVV AG  +R+   +SG P PTV W            
Sbjct: 16513 IEMKDRLVSPDLQLDASVR--DRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--------E 16562

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
             R  P                           +ETT   S   ++  ++  +GVY++  KN
Sbjct: 16563 RTLPQ-----------------------EATIETTAISSSMVIKNCQRSHQGVYSLLAKN 16599

Query: 756   PVGEDQVNLTVKVIDVPDAPAAPKIS-NVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
               GE +  + V V+DVP     P ++ N+  +SC + W  P  DGG PI  Y++E+++  
Sbjct: 16600 EAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESD 16659

Query: 815   SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPS 871
                W  + + + ++ +   + +I+G  Y  R+ A N+IGM      S+  +   PI  P 
Sbjct: 16660 RRAWTPVTYTVTRQ-NATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPE 16718

Query: 872   EPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILV 931
              P  L V++V+  TV+L W PP+  G   +  Y +E    G  ++              V
Sbjct: 16719 RPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTV 16778

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
             K L  G    +RV A N+ G G P   T+P+T ++ L  P L L    + TI  +VGE  
Sbjct: 16779 KGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTI--RVGEAF 16836

Query: 992   NLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE 1050
              L   + GKP+P+V+W K E   L  +   I+ +P    L    A+R  SG Y V V   
Sbjct: 16837 ALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENS 16896

Query: 1051  NMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
                 K    + VVD+P PP   +   +     + + WKPP D G +++  Y ++K +   
Sbjct: 16897 TGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGK 16956

Query: 1110  MEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
               W  V     +T C V +L+ G  Y FR+ ++N+ G SD
Sbjct: 16957 DVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISD 16996



 Score =  214 bits (546), Expect = 3e-55
 Identities = 169/608 (27%), Positives = 283/608 (46%), Gaps = 58/608 (9%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P+I LD   R   +++  AG  +++ +P  G P PTV W+K                 
Sbjct: 27267 EAPEIDLDVALRT--SVIAKAGEDVQVLIPFKGRPPPTVTWRK----------------- 27307

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D+K L  ++ R  +E T   S+ T+    + D G Y +T++N VGE + 
Sbjct: 27308 -----------DEKNL-GSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKS 27355

Query: 763   N-LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
             + ++VKV+D P A    ++ +V   + T+ W+PP  DGG PI+ Y++E++      W  +
Sbjct: 27356 STVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVV 27415

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
             +       S +   + E   +  RV A N IG+  P   ++P      P+    L+++D 
Sbjct: 27416 SHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDS 27474

Query: 882   SDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLL 941
             + T+V L W  P+  G   +  Y VE   +G   W  A  G+++   I V  L   + L 
Sbjct: 27475 TKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA--GISKTCEIEVSQLKEQSVLE 27532

Query: 942   FRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKP 1001
             FRV A N  G   PVT   P+TV+E++  P + L       +  ++G  V+L +P++GKP
Sbjct: 27533 FRVFAKNEKGLSDPVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKP 27591

Query: 1002  RPQVTWTKEGQPLAGEEVSIRNSPTDT--ILFIRAARRVHSGTYQVTVRIENMEDKATLV 1059
             +P ++W K+G PL   E  +R S T+    L I+ A++ H G Y  TV ++N   +  + 
Sbjct: 27592 KPSISWLKDGLPLKESEF-VRFSKTENKITLSIKNAKKEHGGKY--TVILDNAVCRIAVP 27648

Query: 1060  LQVV--DKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
             + V+    PS P+  +R  +    +V L W  P+D G  E+  Y+++K +     W  V 
Sbjct: 27649 ITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVC 27708

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATT----KEPVFIPRPGITYEPPNY 1172
                 RT   VP L+    Y FRV ++N  G S    ++    K    IP P    +P  Y
Sbjct: 27709 SSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGP--PGKPVIY 27766

Query: 1173  KALDFSEAPSFTQPLVN-RSVIAGY-------TAMLCCAVRGSPKPKISWFKNGLDLGED 1224
                    + ++  P+ +  S + G+        ++L   V  SP     +   GL  G D
Sbjct: 27767 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLD 27826

Query: 1225  ARFRMFSK 1232
              +FR++++
Sbjct: 27827 YQFRVYAE 27834



 Score =  213 bits (543), Expect = 7e-55
 Identities = 137/438 (31%), Positives = 210/438 (47%), Gaps = 12/438 (2%)

Query: 732   DRSIFTVEGAEKEDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGED 786
             +  I T     K +E ++ V   N  G     E    +       P  P  P+++ + ++
Sbjct: 27021 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKN 27080

Query: 787   SCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRV 846
             S TV W  P  DGG  I GY LE++ KKS  W ++  + I++   +   + E   Y+ RV
Sbjct: 27081 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRV 27140

Query: 847   YAVNAIGM---SRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDG 903
              AVNA G    S PS   +   PI PP  P  + + D + ++++L W  P   G   + G
Sbjct: 27141 CAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTG 27200

Query: 904   YSVEYCPEGCSEWVA-ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPV 962
             Y VE       EW   + +G    T  +V +L  G    FRV A N AG G P+   EPV
Sbjct: 27201 YVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPV 27260

Query: 963   TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSI 1021
               ++IL+ P + L   LR ++  K GE V +LIPF+G+P P VTW K+ + L  +   SI
Sbjct: 27261 QAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSI 27320

Query: 1022  RNSPTDTILFIRAARRVHSGTYQVTVRIENMEDK-ATLVLQVVDKPSPPQDLRVTDAWGL 1080
              N+ + ++L I    R  +G Y +T+     E K +T+ ++V+D P+  Q L+V      
Sbjct: 27321 ENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRG 27380

Query: 1081  NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF 1140
              V L W PP   G + +  Y ++K D     W  V      T   + +L     ++FRV 
Sbjct: 27381 TVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVL 27440

Query: 1141  SQNMVGFSDRAATTKEPV 1158
             ++N +G  +   TT EPV
Sbjct: 27441 AENEIGIGEPCETT-EPV 27457



 Score =  212 bits (540), Expect = 2e-54
 Identities = 170/605 (28%), Positives = 264/605 (43%), Gaps = 59/605 (9%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R  PP+I LD   R    + + A   LRL VPI G PAP V W +               
Sbjct: 21854 RMLPPEIELDADLR--KVVTIRACCTLRLFVPIKGRPAPEVKWAR--------------- 21896

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                D G+S +             +  +E+T   ++  V    + D G Y +TV+N  G  
Sbjct: 21897 ---DHGESLD-------------KASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSK 21940

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSYRW 818
                + V+V+D P  P   K+  V + S T+ W+PP  DGG  I  YI+E+++  +K+Y  
Sbjct: 21941 SAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYST 22000

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAV 878
             +  N     + S +  ++ EG  Y  RV A N  G+  P+  ++       P  P  + +
Sbjct: 22001 VATN---CHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITL 22057

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
              DV+  +VSL W  PE  G   + GY VE   +G  +W  A     + T   +  L  G 
Sbjct: 22058 MDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKW--ATCATVKVTEATITGLIQGE 22115

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
                FRV A N  G   P   + PV  ++++  P  +L   L  T     GE + + +PF 
Sbjct: 22116 EYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFI 22172

Query: 999   GKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             G+P P VTW K+  PL     V+  ++  +++L I+ A R   G Y V +     E   T
Sbjct: 22173 GRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIET 22232

Query: 1058  LVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
             L + V+DKP PP   +++ +    ++ L W PP+  G + +  Y V+K D  T  W  V 
Sbjct: 22233 LNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS 22292

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALD 1176
                 RT      L  G  Y FR+ ++N  G S       EP     P     PP    + 
Sbjct: 22293 ATVARTTIKACRLKTGCEYQFRIAAENRYGKS--TYLNSEPTVAQYPFKVPGPPGTPVVT 22350

Query: 1177  FSEAPS----FTQPLVN-RSVIAGY-------TAMLCCAVRGSPKPKISWFKNGLDLGED 1224
              S   S    + +P+ +  S + GY        ++L   +  +P P+  +   GL+ G +
Sbjct: 22351 LSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVE 22410

Query: 1225  ARFRM 1229
               FR+
Sbjct: 22411 YEFRV 22415



 Score =  211 bits (537), Expect = 4e-54
 Identities = 158/561 (28%), Positives = 244/561 (43%), Gaps = 48/561 (8%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP+  LD   R   T+++ AG  +RL VP+ G P P + W K           P  +  +
Sbjct: 19690 PPEGELDADLR--KTLILRAGVTMRLYVPVKGRPPPKITWSK-----------PNVNLRD 19736

Query: 704   DTG-DSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
               G D     FD  L C                   E   K D G Y +T++N  G+ + 
Sbjct: 19737 RIGLDIKSTDFDTFLRC-------------------ENVNKYDAGKYILTLENSCGKKEY 19777

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
              + VKV+D P  P    +  + +DS  V WEPP  DGG PI+ Y+++++  +   W  + 
Sbjct: 19778 TIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVT 19837

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVS 882
              +   + S     + EG  Y  RV+A N  G+  P            P     L V  VS
Sbjct: 19838 TE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVS 19896

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
              ++ S+ W+ P   G   + GY V++  E  ++W   ++ L+   S   KDL  G    F
Sbjct: 19897 KSSCSIGWKKPHSDGGSRIIGYVVDFLTEE-NKWQRVMKSLSLQYS--AKDLTEGKEYTF 19953

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV A N  G G P   T  V  ++ +  P L L          K      L IP +GKP 
Sbjct: 19954 RVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPA 20011

Query: 1003  PQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQ 1061
             P V+W K   PLA +  VS+ +S  +T L +   ++  +G Y +T++      + T+ ++
Sbjct: 20012 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIK 20071

Query: 1062  VVDKPS-PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             VV KP  P   ++  +     + L+W PP+D G +E+  Y ++K D    +W T     +
Sbjct: 20072 VVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQ 20131

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP-GITYEPPNYKALDF-- 1177
             +T   V  L  G  Y FRV ++N  G  +      EP+    P  +   PP    +D   
Sbjct: 20132 KTTFRVTRLHEGMEYTFRVSAENKYGVGE--GLKSEPIVARHPFDVPDAPPPPNIVDVRH 20189

Query: 1178  -SEAPSFTQP-LVNRSVIAGY 1196
              S + ++T P     S I GY
Sbjct: 20190 DSVSLTWTDPKKTGGSPITGY 20210



 Score =  211 bits (537), Expect = 4e-54
 Identities = 149/517 (28%), Positives = 234/517 (45%), Gaps = 47/517 (9%)

Query: 636   IDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPA 695
             ++ V R+  P   LD   R   T+VV AG  +R+ VPI G PAP V W K          
Sbjct: 20765 VEIVEREMAPDFELDAELR--RTLVVRAGLSIRIFVPIKGRPAPEVTWTK---------- 20812

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
                        D+             + R  +E T+  ++  +    + D G + +T++N
Sbjct: 20813 -----------DN----------INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIEN 20851

Query: 756   PVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--K 813
             P G+    + V+V+D P      + +++ +DS T+ W+ P  DGG  I  YI+E+++  +
Sbjct: 20852 PAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATR 20911

Query: 814   KSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEP 873
             KSY           + +++   + EG  Y  RV A N  G+  P+  ++P      PS P
Sbjct: 20912 KSYSTATTK---CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPP 20968

Query: 874   THLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW--VAALQGLTEHTSILV 931
               L + D++ +TVSL W  P+  G   + GY +E   +G  +W  +  ++GL      +V
Sbjct: 20969 DSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGL----ECVV 21024

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
             ++L  G    F+V A N AG  AP   + PV V+E    P L L    ++ +  K G+ +
Sbjct: 21025 RNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNI 21083

Query: 992   NLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE 1050
              + IP  G+P+P VTW K  Q L   + V+   + T TIL I    R  SG Y +T R  
Sbjct: 21084 KVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNI 21143

Query: 1051  NMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
               E    + +QV D P PP   ++  +     V   W PP++ G   +  Y V+     +
Sbjct: 21144 VGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDS 21203

Query: 1110  MEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
               W  +     RT      L  G  Y FRV +QN  G
Sbjct: 21204 TTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYG 21240



 Score =  209 bits (531), Expect = 2e-53
 Identities = 164/608 (26%), Positives = 257/608 (42%), Gaps = 65/608 (10%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K   E+V  S + V        L I DVT  D   YS   E      S+     ++K+
Sbjct: 18932 WKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAEN-----SSGTDTQKIKV 18986

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKA-ITQGNKAPA 695
               +    PP+   D    I D           + +   G      I +K  +++G     
Sbjct: 18987 VVMDAPGPPQPPFD----ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRG----- 19037

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
                           +WV     + +T  RV            + G E     ++ V  +N
Sbjct: 19038 --------------DWVTALASVTKTSCRVGK---------LIPGQEY----IFRVRAEN 19070

Query: 756   PVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
               G  +   + K++      VP  P   +++ V +D   V W+ P  DGG PI+GY++ER
Sbjct: 19071 RFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIER 19130

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ---PFMPI 867
             K++ S  W++ N  L++   +    ++EG+ Y  R+YA+N  G S PS  ++     MP+
Sbjct: 19131 KERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPV 19190

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE-- 925
              PP +P    V DV+ +TVSL W  P+  G   + GY VE C     +WV       +  
Sbjct: 19191 DPPGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIP 19247

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
                     L   A+  FR  A        P   ++PVT+      PR+ L   ++  +  
Sbjct: 19248 QEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTV 19307

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTKEG---QPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
             K G  V L     GKP P V+W K+G   +P  G +++++ +     LF  +  R  SG 
Sbjct: 19308 KAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELF--SVNRKDSGD 19365

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
             Y +T    +    AT+ L+V+DKP PP  +++   +     L W+PP + G +E+  Y V
Sbjct: 19366 YTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIV 19425

Query: 1103  QKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPR 1162
              K +     W  V      T C V +LI G+ Y FR+ ++N  G  D   T  EP     
Sbjct: 19426 DKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFT--EPAIAKN 19483

Query: 1163  PGITYEPP 1170
             P   Y+PP
Sbjct: 19484 P---YDPP 19488



 Score =  207 bits (526), Expect = 7e-53
 Identities = 139/404 (34%), Positives = 194/404 (48%), Gaps = 13/404 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VPDAP  P ++ V +DS  V W  P +DGG+PI  YILE+++  S RW R+  D I   +
Sbjct: 17011 VPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYT 17069

Query: 831   H-EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTV 886
                   ++EG  YE RV A N IG+  PSP S+P     PI  PS P +    D +  +V
Sbjct: 17070 KFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 17129

Query: 887   SLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA--LQGLTEHTSILVKDLPTGARLLFRV 944
              L W+PP   G   + GY VEY   G  EW  A         T   V  L  G    FRV
Sbjct: 17130 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRV 17189

Query: 945   RAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
              A N AG   P    EPV V++ L+ P L L  ++ +    KVG+ + L    +G P P+
Sbjct: 17190 LAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPK 17249

Query: 1005  VTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVD 1064
             VTW KE +  A  +  I  +P  + L IR A     G Y +TV         ++ + V+D
Sbjct: 17250 VTWKKEDRD-APTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 17308

Query: 1065  KPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             KP PP+DL V++    +  L WK P D G + +  Y V++ D  + +W  +    ++   
Sbjct: 17309 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSH 17368

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPVFIPRP 1163
                 L  GN Y FRV ++N  G      T K     +P+  P P
Sbjct: 17369 FAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGP 17412



 Score =  206 bits (524), Expect = 1e-52
 Identities = 169/608 (27%), Positives = 260/608 (42%), Gaps = 74/608 (12%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV---PEGFACNLSAKLHFME 633
             W K+GKEL   +++++        L   D T  D   Y+     P GFA       H   
Sbjct: 21495 WSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFA------KHIFN 21548

Query: 634   VKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKA 693
             VK+            LD PG                  P  G  A T +  +      K 
Sbjct: 21549 VKV------------LDRPG------------------PPEGPLAVTEVTSE------KC 21572

Query: 694   PARPAPDAPEDTGDSDEWVFDKK---LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYT 750
                  P   +     D ++  K+    L  T     V+ TK +    ++G    +E ++ 
Sbjct: 21573 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKG----NEYIFR 21628

Query: 751   VTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILG 805
             V   N  G     E +  L V     PD P  P+++ + +DS  V W  P  DGG  I+ 
Sbjct: 21629 VMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIIN 21688

Query: 806   YILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM 865
             YI+ER+ K   RW++ N   + +L ++   + EG  YE R+ A NA G+S PSP S PF 
Sbjct: 21689 YIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTS-PFY 21747

Query: 866   PI-------GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW-- 916
                      GPP  P    V D S +++S+ W  P   G   + GY VE       EW  
Sbjct: 21748 KACDTVFKPGPPGNP---RVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQI 21804

Query: 917   VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLP 976
             V    GL + TS  +  L        R+ A N  G G P         ++ +  P ++L 
Sbjct: 21805 VTPPAGL-KATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELD 21863

Query: 977   RHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE-GQPLAGEEVSIRNSPTDTILFIRAA 1035
               LR+ +  +    + L +P +G+P P+V W ++ G+ L  ++ SI ++ + T+L +   
Sbjct: 21864 ADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL--DKASIESTSSYTLLIVGNV 21921

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
              R  SG Y +TV   +    A + ++V+D P PPQDL+V +    +V L W PP   G +
Sbjct: 21922 NRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGS 21981

Query: 1096  ELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK 1155
             ++  Y V+K +     + TV  +  +T   V +L  G  YYFRV ++N  G    A T +
Sbjct: 21982 KIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAE 22041

Query: 1156  EPVFIPRP 1163
                   RP
Sbjct: 22042 SVKASERP 22049



 Score =  205 bits (522), Expect = 2e-52
 Identities = 166/590 (28%), Positives = 260/590 (44%), Gaps = 57/590 (9%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K+G  L P   IK++    +  L +  V   D  DY+   E  + + SA +   ++K+
Sbjct: 19329 WKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI---KLKV 19385

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                         LD PG  P   V +  NK+  D  +       + W+  +  G      
Sbjct: 19386 ------------LDKPG--PPASVKI--NKMYSDRAM-------LSWEPPLEDGGS---- 19418

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNP 756
                       +   ++ DK+         +V  T   +  +VE   +  E  + +  +N 
Sbjct: 19419 ----------EITNYIVDKRETSRPNW-AQVSATVPITSCSVEKLIEGHEYQFRICAENK 19467

Query: 757   VGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERK 811
              G      T   I     D P     P ISN+ +D  TV W+PPA DGG PI GY+LE++
Sbjct: 19468 YGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKR 19527

Query: 812   KKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ------PFM 865
             + ++  W ++N   I E + +A  + EG  YE RV A+N  G  +PS AS+      P  
Sbjct: 19528 ETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 19587

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA-LQGLT 924
             P GPP+ P    V D + ++VSL W  P   G   + GY VE        WV   L    
Sbjct: 19588 PPGPPAFP---KVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNL 19644

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
             + T   V  L    +  FRV A N  G   P    +    ++IL  P  +L   LR+T+ 
Sbjct: 19645 QKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLI 19704

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTY 1043
              + G  + L +P +G+P P++TW+K    L     + I+++  DT L      +  +G Y
Sbjct: 19705 LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKY 19764

Query: 1044  QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
              +T+     + + T+V++V+D P PP ++ V +    +  + W+PP   G + +  Y VQ
Sbjct: 19765 ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ 19824

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
             K D +   W TV     +T   V  L  G  Y+FRVF++N  G  D   T
Sbjct: 19825 KRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGET 19874



 Score =  204 bits (519), Expect = 4e-52
 Identities = 155/574 (27%), Positives = 256/574 (44%), Gaps = 43/574 (7%)

Query: 632   MEVKIDFVPRQEPPKIHLDCPGRIPD---TIVVVAGNKL-----RLDVPISGDPAPTVIW 683
             +++  + V R E  K  L  P  + +   T  V A N+L      + V +   P+P    
Sbjct: 15446 LQITKEEVSRSEA-KTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPR-- 15502

Query: 684   QKAITQGNKAPARPAPDAPEDTGDSD--EWVFDKKLLCETEGR-VRVETTKDRSIFTVEG 740
               A+T           DAP D G S+   +V DK+     +     V  T     + +  
Sbjct: 15503 NLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWK 15562

Query: 741   AEKEDEGVYTVTVKNPVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPP 795
                  +  + V   N  G      + KV+      +P  P  PK+    + S  V W PP
Sbjct: 15563 LIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPP 15622

Query: 796   AYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS-----HEARRMIEGVVYEMRVYAVN 850
               +GG PI GY LE++++ S  W R++   I ++          R++EGV Y+ R  A+N
Sbjct: 15623 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 15682

Query: 851   AIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVE 907
             A G+  PS  S P +   PI PP  P+   V+D + +++SL W+PP + G   + GY VE
Sbjct: 15683 AAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVE 15742

Query: 908   YCPEGCSEW--VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
                EG ++W  V     L      +V +L    +  FRV+A N AG   P  TT  +   
Sbjct: 15743 MQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPAT 15802

Query: 966   EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP 1025
             +I + P + +    +  +  K G  + +    +G+P P+ +W  +G+     +  + + P
Sbjct: 15803 DIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIP 15862

Query: 1026  TD---------TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTD 1076
              D         +++ I   +R H+G Y +T + +  +  A   ++V+D P PP+DL+V+D
Sbjct: 15863 EDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSD 15922

Query: 1077  AWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYY 1136
                 +  L WK P D G   + GY ++K       W  V      T  VVP+L+    Y+
Sbjct: 15923 ITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYF 15982

Query: 1137  FRVFSQNMVGFSD-----RAATTKEPVFIPRPGI 1165
             FRV ++N  G        +  T ++P++ P P I
Sbjct: 15983 FRVRAENRFGIGPPVETIQRTTARDPIYPPDPPI 16016



 Score =  203 bits (516), Expect = 1e-51
 Identities = 156/577 (27%), Positives = 241/577 (41%), Gaps = 75/577 (12%)

Query: 659   IVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLL 718
             I+V+ G KL + VP    P PTV W K                     D  E        
Sbjct: 14396 IIVIEGEKLSIPVPFRAVPVPTVSWHK---------------------DGKE-------- 14426

Query: 719   CETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP 778
              +   R+ ++     +   V  + + D G+YT+T++N +G    ++ VKVI +P      
Sbjct: 14427 VKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDI 14486

Query: 779   KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIE 838
             K S++ + SC + WEPP +DGG PIL Y+LER++     ++ +      +LS   + +I 
Sbjct: 14487 KASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPV-MSGENKLSWTVKDLIP 14545

Query: 839   GVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPER 895
                Y  RV AVN +G         P +   P  PP  P  + V + +   +++ W+PP  
Sbjct: 14546 NGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLY 14605

Query: 896   VGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAP 955
              G   + GY +E   +G   W    + L    +   K L  G    FRVRA N AG   P
Sbjct: 14606 DGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEP 14665

Query: 956   VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
                T P    + +  P++ L    R +++ K G+ + L     G P P +TW K+   + 
Sbjct: 14666 SRATPPTKAVDPIDAPKVIL----RTSLEVKRGDEIALDASISGSPYPTITWIKDENVIV 14721

Query: 1016  GEEVSIRNSPT------------------------------DTILFIRAARRVHSGTYQV 1045
              EE+  R +P                               ++ L +R + R   G Y +
Sbjct: 14722 PEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMI 14781

Query: 1046  TVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKA 1105
              V  ++   KA   + V+D P PP +    D    +V  +W+PP D G +E+  YT++K 
Sbjct: 14782 KVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKK 14841

Query: 1106  D--KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG----FSDRAATTKEPVF 1159
             D  K   EW  V    R     V +LI G  Y FRV ++N  G       +    K+P F
Sbjct: 14842 DKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDP-F 14900

Query: 1160  IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGY 1196
              P P    +P        S    + +P  N S I GY
Sbjct: 14901 GP-PDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGY 14936



 Score =  202 bits (514), Expect = 2e-51
 Identities = 143/504 (28%), Positives = 223/504 (44%), Gaps = 23/504 (4%)

Query: 727   VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE----DQVNLTVKV-IDVPDAPAAPKIS 781
             V  T  R++  V      +E  + +  +N  G     D   +TVK+    P  P+ P ++
Sbjct: 26620 VSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVT 26679

Query: 782   NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
             NV  +S TV W  P  +GG  ++GY LE K + S  W + N  +I+    +   +  G++
Sbjct: 26680 NVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLI 26739

Query: 842   YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGL 901
             YE RVYA NA G+ +PS  S+P + I     P ++ + D+S  +VSL W+ P   G   +
Sbjct: 26740 YEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKI 26799

Query: 902   DGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGP-GAPVTTTE 960
              GY VE        W  A       T  ++  L   ++  FRV A N  G    P     
Sbjct: 26800 TGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVG 26859

Query: 961   PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEV 1019
             P+T  +    P + LP    + ++ + G  V L     GKP P + W K+ + L     V
Sbjct: 26860 PITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALV 26919

Query: 1020  SIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPP-QDLRVTDAW 1078
              + N+     + I+ A R++SG Y++ +R       AT+ +Q++DKP PP   +      
Sbjct: 26920 CVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVT 26979

Query: 1079  GLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFR 1138
                + L W+PP D G  ++  Y V+K +   + W  V EH         ++I GN Y FR
Sbjct: 26980 AEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFR 27039

Query: 1139  VFSQNMVGF-----SDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVN-RSV 1192
             V + N  G      SD        V    PGI   P   K    S    +++P+ +  S 
Sbjct: 27040 VRAVNKYGIGEPLESDSVVAKNAFVTPGPPGI---PEVTKITKNSMTVVWSRPIADGGSD 27096

Query: 1193  IAGYTAMLCCAVRGSPKPKISWFK 1216
             I+GY       +    K  + WFK
Sbjct: 27097 ISGY------FLEKRDKKSLGWFK 27114



 Score =  202 bits (513), Expect = 2e-51
 Identities = 144/471 (30%), Positives = 207/471 (43%), Gaps = 23/471 (4%)

Query: 683   WQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAE 742
             W+  +  G         +  + T    EW+     L   +  V         +F V    
Sbjct: 14822 WEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAEN 14881

Query: 743   KEDEGVYTVT----VKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD 798
             +   G   V+     K+P G             PDAP  P + +V  +S  V+W  P  D
Sbjct: 14882 RFGPGPPCVSKPLVAKDPFGP------------PDAPDKPIVEDVTSNSMLVKWNEPK-D 14928

Query: 799   GGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPS 858
              G PILGY LE+++  S  W R+N  L+  L      ++EG+ Y  RV A NA G  + S
Sbjct: 14929 NGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFS 14988

Query: 859   PASQP---FMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSE 915
             P S P     PI PP  P    V D S TT+ L+W PP   G G + GY V+    G +E
Sbjct: 14989 PPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNE 15047

Query: 916   WVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQL 975
             W    + + +     VK++  GA    RV A N AG G P   T+PVTV E  + P ++L
Sbjct: 15048 WSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPP-GETQPVTVAEPQEPPAVEL 15106

Query: 976   PRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAA 1035
                ++  IQ   G+ + +     G+P P   WTKE   L  + V I N  T + L I+ A
Sbjct: 15107 DVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDA 15166

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
              R   G Y +T         A   ++V D P P  DL+          L W  P+D G +
Sbjct: 15167 LRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGS 15226

Query: 1096  ELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
             E+ G+ +++ D K   W   +E   R+ C +  L+ G  Y FRV ++N  G
Sbjct: 15227 EITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEGQEYKFRVIAKNKFG 15276



 Score =  201 bits (512), Expect = 3e-51
 Identities = 169/574 (29%), Positives = 245/574 (42%), Gaps = 58/574 (10%)

Query: 642   QEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDA 701
             QEPP + LD    +   I ++AG  LR+   ++G P PT +W K                
Sbjct: 15099 QEPPAVELDVS--VKGGIQIMAGKTLRIPAVVTGRPVPTKVWTK---------------- 15140

Query: 702   PEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQ 761
                    +E   DK        RV ++    +S   ++ A ++D G Y +T  N  G   
Sbjct: 15141 -------EEGELDKD-------RVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKF 15186

Query: 762   VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                 V+V DVP      K        C + W  P  DGG  I G+I+ERK  K + W + 
Sbjct: 15187 AAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ- 15245

Query: 822   NFDLIQELSH-EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLA 877
                +  E S  +   ++EG  Y+ RV A N  G   P     P +   P+GPP+ P  L 
Sbjct: 15246 --PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIG-PILAVDPLGPPTSPERLT 15302

Query: 878   VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
               + + +T++L W+ P   G   + GY +E       ++    + L   TS LV++L   
Sbjct: 15303 YTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEH 15362

Query: 938   ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLR-QTIQKKVGEPVNLLIP 996
                 FRV+A N  G   P      V +Q+    P ++L   +R  TI+ K GEPV++   
Sbjct: 15363 QMYEFRVKAVNEIGESEPSLPLN-VVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPAD 15421

Query: 997   FQGKPRPQVTWTK---------EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
               G P P++ W+K         +   +  EEVS   S   T L I  A R   GTY VT 
Sbjct: 15422 VTGLPMPKIEWSKNETVIEKPTDALQITKEEVS--RSEAKTELSIPKAVREDKGTYTVTA 15479

Query: 1048  RIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD- 1106
                       + ++V D+PSPP++L VTD    +  L W  P D G +E+  Y + K D 
Sbjct: 15480 SNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDA 15539

Query: 1107  -KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP--RP 1163
              +K  EW  V          + +LI    Y FRV + N  G SD   + K  +  P   P
Sbjct: 15540 SRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLP 15599

Query: 1164  GITYEPPNYKALDFSEAPSFTQPLVN-RSVIAGY 1196
             G   +P        S   S+T PL N  S I GY
Sbjct: 15600 GPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGY 15633



 Score =  201 bits (511), Expect = 4e-51
 Identities = 166/600 (27%), Positives = 260/600 (43%), Gaps = 71/600 (11%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K GK++ P    +++       LTI   T  D  +Y+            K+  ++V +
Sbjct: 20413 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATN---PFGTKVEHVKVTV 20469

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                                             LDVP  G P P  I   +     KA   
Sbjct: 20470 --------------------------------LDVP--GPPGPVEI---SNVSAEKATLT 20492

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKD----RSIFT--VEGAEKEDEGVYT 750
               P   +       ++ +K+   ET   +    ++D    R + T  ++G    +E ++ 
Sbjct: 20493 WTPPLEDGGSPIKSYILEKR---ETSRLLWTVVSEDIQSCRHVATKLIQG----NEYIFR 20545

Query: 751   VTVKNPVGEDQV--NLTVKVID---VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILG 805
             V+  N  G+ +   +  VK++D    P  P  P++SNV +++ TV W+ P  DGG  I G
Sbjct: 20546 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 20605

Query: 806   YILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM 865
             Y +ER++KKS RW+R     + +L  +   + EG  YE RV A N  G+  PS AS   +
Sbjct: 20606 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 20665

Query: 866   ------PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA 919
                   P GPPS P    V D +  + SL W  P   G   + GY VE+   G   W+  
Sbjct: 20666 MKDAAYPPGPPSNP---HVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 20722

Query: 920   LQGLT-EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
               G     T  +V DL T  +  FR+ A N AG G P    + V + E    P  +L   
Sbjct: 20723 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPD-VEIVEREMAPDFELDAE 20781

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRV 1038
             LR+T+  + G  + + +P +G+P P+VTWTK+   L     +I N+ + T+L I    R 
Sbjct: 20782 LRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLK-NRANIENTESFTLLIIPECNRY 20840

Query: 1039  HSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
              +G + +T+     +    + ++V+D P P  +LR TD    +V L W  P   G + + 
Sbjct: 20841 DTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRIT 20900

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
              Y V+K +     + T      +    V  L  G  Y+FRV ++N  G  +   TT EPV
Sbjct: 20901 NYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETT-EPV 20959



 Score =  200 bits (508), Expect = 8e-51
 Identities = 169/607 (27%), Positives = 252/607 (41%), Gaps = 59/607 (9%)

Query: 574   RGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFME 633
             R  W K+G E+     ++++ +     L + D T      Y+   +  + +  A++   +
Sbjct: 27989 RVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEI---K 28045

Query: 634   VKIDFVPRQEPPKIHLDCPGRI--PDTIVVVAGNKLRL--DVPISGDPAPTV--IWQKAI 687
             VK+             D PG++  P     + G K+ L  D P++   AP    I +K  
Sbjct: 28046 VKVQ------------DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRE 28093

Query: 688   TQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEG 747
             T      +R A    ED  ++  +   K L+   E + RV                    
Sbjct: 28094 T------SRLAWALIEDKCEAQSYTAIK-LINGNEYQFRVSA------------------ 28128

Query: 748   VYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYI 807
             V    V  P+  D V   ++   VPDAP  P+ SN+  +S T+ W  P  DGG  I  YI
Sbjct: 28129 VNKFGVGRPLDSDPVVAQIQYT-VPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYI 28187

Query: 808   LERKKKKSYRWMR-LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM- 865
             LER++KKS RW++ ++   I E   +   + EG  YE  V A NA G+   S  S+    
Sbjct: 28188 LERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKC 28247

Query: 866   --PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGL 923
               P+ PP  PT + V D S TTVSL+W  P   G   + GY +E C     +W       
Sbjct: 28248 REPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEA 28307

Query: 924   TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
                T   V DL  G    FRV A N AG G     T  +   + L  P L +  + +QT 
Sbjct: 28308 CVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTH 28367

Query: 984   QKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTY 1043
               + G  + L I +QG+P P   W+K    L+     I  + + + L +    R  +G Y
Sbjct: 28368 VVRAGASIRLFIAYQGRPTPTAVWSKPDSNLS-LRADIHTTDSFSTLTVENCNRNDAGKY 28426

Query: 1044  QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
              +TV   +     T  ++V+D P PP  +   D    +  L W  P   G   +  Y V+
Sbjct: 28427 TLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVE 28486

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             K +     W  + E   R    V +L  G  YYFRV + N  G         EP  +P P
Sbjct: 28487 KREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVG-------EPYEMPEP 28539

Query: 1164  GITYEPP 1170
              +  E P
Sbjct: 28540 IVATEQP 28546



 Score =  199 bits (507), Expect = 1e-50
 Identities = 128/407 (31%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VP  P  P+++ V +DS T+ W  P  DGG PILGY +ERK++    W  ++  L+    
Sbjct: 21258 VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNI 21317

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
              ++  + +G+ YE RV A N  G S+PS  S+P +   PI PP +P  L   +++  TV+
Sbjct: 21318 FKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPL---NITRHTVT 21374

Query: 888   LKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAH 947
             LKW  PE  G   +  Y VE        W+ A           V  L   A   FRV A 
Sbjct: 21375 LKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAK 21434

Query: 948   NMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
             N AG    P   ++ +T ++ ++ P++++    + T+  K GE   L     G+P P + 
Sbjct: 21435 NAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTME 21494

Query: 1007  WTKEGQPLAG-EEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             W+K+G+ L G  ++ I+ +   T L  + + R  SG Y +T        K    ++V+D+
Sbjct: 21495 WSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDR 21554

Query: 1066  PSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             P PP+  L VT+       L W PP D G  ++  Y VQK +   + W  V    + T  
Sbjct: 21555 PGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKL 21614

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPN 1171
              V +L+ GN Y FRV + N  G  +      EPV    P   Y PP+
Sbjct: 21615 KVTKLLKGNEYIFRVMAVNKYGVGE--PLESEPVLAVNP---YGPPD 21656



 Score =  199 bits (506), Expect = 1e-50
 Identities = 156/565 (27%), Positives = 253/565 (44%), Gaps = 26/565 (4%)

Query: 702   PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
             P+D G S+   ++ +K+     +  V   +   ++ F V    +  E  + V+ +N  G 
Sbjct: 20100 PKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGV 20158

Query: 760   DQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
              +   +  ++     DVPDAP  P I +V  DS ++ W  P   GG PI GY LE K++ 
Sbjct: 20159 GEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERN 20218

Query: 815   SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPT 874
             S  W R N   I+    +   + EG+ YE RV A+N  G+ +PS  S+P + + P   P 
Sbjct: 20219 SLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPG 20278

Query: 875   HLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDL 934
                V +++  +V+L W  P+  G   L GY VE        W+ A        +  V DL
Sbjct: 20279 KPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDL 20338

Query: 935   PTGARLLFRVRAHNMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNL 993
               G +  FR+RA N AG   AP  +TE +  ++  + P + L   ++  +  K G+ + L
Sbjct: 20339 VEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVL 20398

Query: 994   -LIPFQGKPRPQVTWTKEGQPLAGEEVS-IRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
               I   GKP P+ +W+K G+ +   +++ I ++PT ++L I+ A R  +G Y +T     
Sbjct: 20399 NAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPF 20458

Query: 1052  MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTME 1111
                   + + V+D P PP  + +++       L W PP + G + +  Y ++K +   + 
Sbjct: 20459 GTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLL 20518

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV-----FIPRPGIT 1166
             W  V E  +    V  +LI GN Y FRV + N  G  +      EPV     F P PG  
Sbjct: 20519 WTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE--PVQSEPVKMVDRFGP-PGPP 20575

Query: 1167  YEPPNYKALDFSEAPSFTQPLVN-RSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA 1225
              +P        +   S+ +P+ +  S I GY       V    K  + W +       D 
Sbjct: 20576 EKPEVSNVTKNTATVSWKRPVDDGGSEITGY------HVERREKKSLRWVRAIKTPVSDL 20629

Query: 1226  RFRMFSKQGVLTLEIRKPCPFDGGI 1250
             R ++   Q   T E R       GI
Sbjct: 20630 RCKVTGLQEGSTYEFRVSAENRAGI 20654



 Score =  197 bits (500), Expect = 7e-50
 Identities = 147/509 (28%), Positives = 216/509 (42%), Gaps = 42/509 (8%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP++ LD   R  D I V  G  +R+   + G P P + W K                  
Sbjct: 17905 PPEVELDVTCR--DVITVRVGQTIRILARVKGRPEPDITWTK------------------ 17944

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
                       + K+L   E RV +     R    ++ A + D G Y ++ KN  G  Q +
Sbjct: 17945 ----------EGKVLVR-EKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGS 17993

Query: 764   LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF 823
               V V+D P      K++NV +++CT+ WE P  +GG  I  +I+E +K     W  +  
Sbjct: 17994 AIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVAS 18053

Query: 824   DLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGP---PSEPTHLAVED 880
             D+ + L      ++    Y  RV A N +G+        P + I P   P EP +L + D
Sbjct: 18054 DVTKRLIKA--NLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIAD 18111

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL 940
                T V LKWR P+  G      Y VE   +G  +W    +G  + T  +V         
Sbjct: 18112 KGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIY 18171

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FRV+  N  G    V T E V V+E LQ+P L L   L   +  K G+ + L    +GK
Sbjct: 18172 EFRVQTKNEGGESDWVKTEE-VVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGK 18228

Query: 1001  PRPQVTWTKEGQPL---AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             P P+V WTK+           V I      +   +  A+R   G Y VT         A 
Sbjct: 18229 PFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAY 18288

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
               + V+DKP P ++L++ D       + W PP+D G  E+  Y ++K + K M W T   
Sbjct: 18289 ATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSA 18348

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
                     V  LI GN Y FRV ++N +G
Sbjct: 18349 TVLTPGTTVTRLIEGNEYIFRVRAENKIG 18377



 Score =  196 bits (498), Expect = 1e-49
 Identities = 146/539 (27%), Positives = 227/539 (42%), Gaps = 73/539 (13%)

Query: 635   KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAP 694
             +I  V  QE P+I LD   ++   + V AG K+ L   ++G P P + W KA        
Sbjct: 13678 EIQAVDTQEAPEIFLDV--KLLAGLTVKAGTKIELPATVTGKPEPKITWTKA-------- 13727

Query: 695   ARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVK 754
                                   ++ + + R+ +E    +S  T+  +++ D G Y +   
Sbjct: 13728 ---------------------DMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV 13766

Query: 755   NPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
             N  G     + V V+D P  PAA  I++V  +SC + W PP  DGG  I  Y++ER+   
Sbjct: 13767 NVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATD 13826

Query: 815   SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRP---SPASQPFMPIGPPS 871
             S  W +L+   +++ + +A ++I    Y  RV A N  G+  P   SP +  +    PP 
Sbjct: 13827 SEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQ-FDPPG 13884

Query: 872   EPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILV 931
              PT L   D++   V+L W  P+  G   + GY VE       +WV   +   + T+  V
Sbjct: 13885 PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRV 13944

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
             K L    +  FRV A N+AGPG P  +TEP+ +++ +  P                  P 
Sbjct: 13945 KGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPP----------------WPPG 13988

Query: 992   NLLIPFQGKPRPQVTWTKEGQPLAG--EEVSIRNSPTDTILFIRAARRV----------- 1038
                +   GK   ++ WTK         E   I    T T  ++R A  V           
Sbjct: 13989 KPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLM 14048

Query: 1039  HSGTYQVTVRIENMEDKA--------TLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQ 1090
                 Y   VR  N   ++         L  + +  PSPP+ L V +       L+W  P+
Sbjct: 14049 EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPE 14108

Query: 1091  DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
               G + +  Y V+K D +   W TV    + T C V  L  G+ Y FRV ++N +G SD
Sbjct: 14109 KDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD 14167



 Score =  196 bits (498), Expect = 1e-49
 Identities = 162/633 (25%), Positives = 260/633 (41%), Gaps = 83/633 (13%)

Query: 642   QEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDA 701
             QE P++ +D   +  D +V  AG+++R+   I G P P   W+    +  KA      D 
Sbjct: 15805 QEEPEVFIDIGAQ--DCLVCKAGSQIRIPAVIKGRPTPKSSWEFD-GKAKKAMKDGVHDI 15861

Query: 702   PEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQ 761
             PED                     ++ET ++ S+  +   ++   G Y++T KN  G+  
Sbjct: 15862 PEDA--------------------QLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKT 15901

Query: 762   VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              N  VKV+DVP  P   K+S++   SC + W+ P  DGG  I GY++E++      W ++
Sbjct: 15902 ANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKV 15961

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAV 878
             N D     +     ++    Y  RV A N  G+  P    Q      PI PP  P  L +
Sbjct: 15962 NPDC-GSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKI 16020

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVE---YCPEGCSE--WVAALQGLTEHTSILVKD 933
               ++  TV L W+PP+  G   +  Y VE   + P G  +  W    +   E     V+D
Sbjct: 16021 GLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVED 16080

Query: 934   LPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNL 993
             L  G    FRV+A N AG   P  T  P   Q    RP +     L++ ++ + G  VN+
Sbjct: 16081 LVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQ----RPDMPPSIDLKEFMEVEEGTNVNI 16136

Query: 994   LIPFQGKPRPQVTWTK-------EGQPLAGEEVSIRNSPTDTI-LFIRAARRVHSGTYQV 1045
             +   +G P P +TW K         +P+  +    +    DT  L I  +RR  +G Y +
Sbjct: 16137 VAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTI 16196

Query: 1046  TVRIENMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK 1104
             T           + L V+ +P PP   ++        + L W PP+D G +++  Y ++K
Sbjct: 16197 TAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEK 16256

Query: 1105  ADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV--FIPR 1162
              +     W  V    +     +P+L+ G+ Y FR+ +QN  G  +   +  E        
Sbjct: 16257 REANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV 16316

Query: 1163  PG----------------ITYEPPNYKA--------LDFSEAPSFTQPLVNRSVIAGYTA 1198
             PG                + +E P Y          L+  +  S     VNR  I   T 
Sbjct: 16317 PGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTL 16376

Query: 1199  MLCCAVRGSPKPKISWFKNGLDLGEDARFRMFS 1231
                          +S+   GL  G D +FR+++
Sbjct: 16377 ------------GVSYKVTGLIEGSDYQFRVYA 16397



 Score =  195 bits (495), Expect = 3e-49
 Identities = 127/403 (31%), Positives = 185/403 (45%), Gaps = 20/403 (4%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P+ P++S + +DS  V W  P  DGG  I GYILE++ K+  RW + N   + +L  
Sbjct: 24902 PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRL 24961

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSP------ASQPFMPIGPPSEPTHLAVEDVSDTT 885
                 + EG  YE RV A NA G+  PS       A     P GPPS P    V D S ++
Sbjct: 24962 RVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP---KVTDTSRSS 25018

Query: 886   VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWV-----AALQGLTEHTSILVKDLPTGARL 940
             VSL W  P   G   + GY VE       EW        LQG        V  L      
Sbjct: 25019 VSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQG----KQFTVTKLKENTEY 25074

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FR+ A N  G G P T    V  QE ++ P ++L   LR+ +  +    + L +  +G+
Sbjct: 25075 NFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGR 25134

Query: 1001  PRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVL 1060
             P P+V W K  + +  +   I  + + T+L I    R  SG Y +T+   +    A + +
Sbjct: 25135 PEPEVKWEK-AEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNV 25193

Query: 1061  QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             +V+D PS P +L + +    +V L W+PP   G  ++  Y V+K +     + T+  +  
Sbjct: 25194 RVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCT 25253

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             +T   +  L  G  YYFRV + N  G    A TT EPV +  P
Sbjct: 25254 KTTFRIENLQEGCSYYFRVLASNEYGIGLPAETT-EPVKVSEP 25295



 Score =  191 bits (485), Expect = 4e-48
 Identities = 129/467 (27%), Positives = 213/467 (45%), Gaps = 18/467 (3%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P  P  + + +DS  +QW  P  +GG P++GY LERK++ S  W ++N  +I +   
Sbjct: 23423 PGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQF 23482

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSL 888
             +A+ + EG+ YE RVYA N +G+ + S  S+ ++   P  PP  P  + V+      ++L
Sbjct: 23483 KAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVK---RNEITL 23539

Query: 889   KWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
             +W  P   G   + GY VE        W+ A       T   V  L    R  FRV A N
Sbjct: 23540 QWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKN 23599

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTW 1007
              AG    P  +T P+T ++ ++ PR+ +    R TI    GE   L     GKP P + W
Sbjct: 23600 AAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEW 23659

Query: 1008  TKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT--LVLQVVD 1064
              +  + +       I+N+    +L ++ A R+  G Y   +R  N+    +  + ++V+D
Sbjct: 23660 LRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQY--ILRASNVAGSKSFPVNVKVLD 23717

Query: 1065  KPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTH 1123
             +P PP+  ++VT       +L W PP   G +++  Y V+K +   + W  V        
Sbjct: 23718 RPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS 23777

Query: 1124  CVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSF 1183
               V +L+ GN Y FR+ + N  G  +   +   PV +  P +   PP  K+L+ +     
Sbjct: 23778 LKVTKLLEGNEYVFRIMAVNKYGVGEPLESA--PVLMKNPFVLPGPP--KSLEVTNIAKD 23833

Query: 1184  TQPLV-NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRM 1229
             +  +  NR    G + ++   V    +  I W K       D R R+
Sbjct: 23834 SMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 23880



 Score =  189 bits (480), Expect = 1e-47
 Identities = 125/408 (30%), Positives = 194/408 (47%), Gaps = 15/408 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VP  P  P ++    DS  VQW  P  DGG  ++GY LERK++ S  W++LN   I +  
Sbjct: 22340 VPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTK 22399

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
              +   + EGV YE RV A N +G+ +PS  S+ ++   P  PP  P  +    V+  +V+
Sbjct: 22400 FKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAII---VTRNSVT 22456

Query: 888   LKWRPPERVGAGGLDGYSVE--YCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVR 945
             L+W+ P   G   + GY VE    PEG   W+ A       T   V  L    R  FRV 
Sbjct: 22457 LQWKKPTYDGGSKITGYIVEKKELPEG--RWMKASFTNIIDTHFEVTGLVEDHRYEFRVI 22514

Query: 946   AHNMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
             A N AG    P  +T  +T ++ +  PR+ +    + TI    GE   +     GKP P 
Sbjct: 22515 ARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPT 22574

Query: 1005  VTWTKEGQPLAG-EEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVV 1063
             + W K  Q L+    + I+++   T L ++ A RV SG Y +  +    E   T+ ++V+
Sbjct: 22575 IQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVL 22634

Query: 1064  DKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRT 1122
             D+P PP+  + ++        L WKPP   G +++  Y V++ +   + W  V  + +  
Sbjct: 22635 DRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTL 22694

Query: 1123  HCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPP 1170
              C V +L+ GN Y FR+ + N  G  +      EPV    P +  + P
Sbjct: 22695 SCKVTKLLEGNEYTFRIMAVNKYGVGE--PLESEPVVAKNPFVVPDAP 22740



 Score =  189 bits (479), Expect = 2e-47
 Identities = 129/478 (26%), Positives = 224/478 (46%), Gaps = 24/478 (5%)

Query: 743   KEDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAY 797
             K +E ++ V   N  G     E +  +      +P  P  P+    G++   +QW  P  
Sbjct: 29206 KNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPES 29265

Query: 798   DGGQPILGYILERKKKKSYRWMRLNFD-LIQELSHEARRMIEGVVYEMRVYAVNAIGMSR 856
             DGG  I  Y++++++KKS RW R+N D ++ +   +   ++EG  Y+ RV AVNA G S 
Sbjct: 29266 DGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSE 29325

Query: 857   PSPAS------QPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
             PS AS      +P    GPPS P    V D +  ++SL W  P   G   + GY +E   
Sbjct: 29326 PSEASNFISCREPSYTPGPPSAPR---VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQE 29382

Query: 911   EGCSEWVAALQGLT-EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQ 969
             +   +W       T  +T   V DL  G +  FRV A N+ G      +   +   E ++
Sbjct: 29383 KDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIE 29442

Query: 970   RPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTI 1029
              P L+L   L++T+  + G  + L++   G+P P +TW+K+G  LA   + I  + + ++
Sbjct: 29443 IPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSL 29501

Query: 1030  LFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
             L +    R  +G Y +    ++ +  AT++++V D P P   ++V +    +V + W+ P
Sbjct: 29502 LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 29561

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
                G   +  Y V+K +     + TV     +T   +  L+ G  YYFRV  +N+ G  +
Sbjct: 29562 TIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE 29621

Query: 1150  RAATTKEPVFIPRPGITYEPPNYKALDFSEAP---SFTQPLVN-RSVIAGYTAMLCCA 1203
                T+   +    P +   P   + +D +++    ++ +PL +  S + GY    C A
Sbjct: 29622 PCETSDAVLVSEVPLV---PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKA 29676



 Score =  188 bits (477), Expect = 3e-47
 Identities = 139/490 (28%), Positives = 224/490 (45%), Gaps = 24/490 (4%)

Query: 700   DAPEDTGDSDEWVF--DKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPV 757
             D PED G  +   +  +K+   +T  ++ V ++  R+ F V    K+ E  + V  +N  
Sbjct: 27679 DVPEDNGGGEITCYSIEKRETSQTNWKM-VCSSVARTTFKVPNLVKDAEYQFRVRAENRY 27737

Query: 758   GEDQVNLTVKVID-----VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             G  Q  ++  ++      +P  P  P I NV  D  ++ W+ P YDGG  + G+ +E+K+
Sbjct: 27738 GVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKE 27797

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ---PFMPIGP 869
             + S  W ++N   I    + A  ++EG+ Y+ RVYA N+ G+S PS  S+      P+ P
Sbjct: 27798 RNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDP 27857

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P ++   DV+  T++LKW PP R G   + GYS+E   +G   WV            
Sbjct: 27858 PGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEK-RQGNERWVRCNFTDVSECQY 27913

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTV-QEILQRPRLQLPRHLRQTIQKKVG 988
              V  L  G R  FR+ A N  G  +P + +  + + ++    P ++        +  K G
Sbjct: 27914 TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSG 27973

Query: 989   EPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
             E + +    QG+P P+VTW K+G  +     + I +    T LF+R A R H G Y V  
Sbjct: 27974 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEA 28033

Query: 1048  RIENMEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD 1106
             +  +   KA + ++V D P      +R T+  G  + L W  P + G   +  Y ++K +
Sbjct: 28034 KNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRE 28093

Query: 1107  KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF-----SDRAATTKEPVFIP 1161
                + W  + +          +LI GN Y FRV + N  G      SD      +     
Sbjct: 28094 TSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPD 28153

Query: 1162  RPGITYEPPN 1171
              PGI  EP N
Sbjct: 28154 APGIP-EPSN 28162



 Score =  185 bits (469), Expect = 3e-46
 Identities = 224/932 (24%), Positives = 347/932 (37%), Gaps = 158/932 (16%)

Query: 374   QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
             +V +  ++    E+    A+ KW +N + I    SKYI        TL I    L D A 
Sbjct: 12650 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAI-FDSSKYIILQKDLVYTLRIRDAHLDDQAN 12708

Query: 434   YQCVVGGE-----KCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLK 488
             Y   +        K +  L V+E  + I  PL+D   M  + V F C+V+     +KW K
Sbjct: 12709 YNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTK 12768

Query: 489   DGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVY 548
             +G E+  +    YR  K   +H L I +    D G Y +     +++AEL++ E   E  
Sbjct: 12769 NGEEVPFDNRVSYRVDK--YKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFV 12826

Query: 549   QSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTP 608
             + + D  V   D AVF C++S E     W +NG+E+    + K    G +H+L I D   
Sbjct: 12827 EHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRL 12886

Query: 609   ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLR 668
              DE +Y+   E       A+L   E+ ++ +    PP+  L+ PG   D + +   NK +
Sbjct: 12887 DDECEYACGVEDRKSR--ARLFVEEIPVEII---RPPQDILEAPGA--DVVFLAELNKDK 12939

Query: 669   LDVPISGDPAPTVIWQK---AITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRV 725
             ++V           W +    + QG+K                 E    +  +C+ + R 
Sbjct: 12940 VEVQ----------WLRNNMVVVQGDKHQMM------------SEGKIHRLQICDIKPR- 12976

Query: 726   RVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGE 785
                                D+G Y    K+     ++ L           AAPKI    +
Sbjct: 12977 -------------------DQGEYRFIAKDKEARAKLELA----------AAPKIKTADQ 13007

Query: 786   DSCTVQWEPPAYDGGQPILGYI-LERKKKKSYRWMRLNFDLIQEL-----SHEARRMIEG 839
             D           D G+P+   +  +   K    W + N  L  +         + R++E 
Sbjct: 13008 DLVV--------DVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEA 13059

Query: 840   VVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAG 899
                +   Y +        +        I  P    +L V +  D  VSL W  P   G  
Sbjct: 13060 KKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGS 13119

Query: 900   GLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA-RLLFRVRAHNMAGPGAPVTT 958
              + GY VE        WV A     E     V  L  G    LFRV A N  G G PV T
Sbjct: 13120 KIIGYVVERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVET 13178

Query: 959   TEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPL 1014
               PV       R +  +P           G P+N+ I    +    +TW       G  +
Sbjct: 13179 DNPVEA-----RSKYDVP-----------GPPLNVTITDVNRFGVSLTWEPPEYDGGAEI 13222

Query: 1015  AGEEVSIRNSPT---DTILFIRAARR-------VHSGTYQVTVRIENM-----EDKATLV 1059
                 + +R+  +   DT + +RA          V    Y   VR +N         AT  
Sbjct: 13223 TNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPF 13282

Query: 1060  LQVVD---KPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
             ++V D   +PSPP +L  +D    +V L+W+PP   G + + GY +++ ++    W    
Sbjct: 13283 VKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI--- 13339

Query: 1117  EHYRRTHCVVPELII-------GNGYYFRVFSQNMVGFSDRAAT----TKEPVFIPRPGI 1165
                R    +VPEL         GN Y +RV ++N  G SD +      T +  F+     
Sbjct: 13340 ---RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFV----- 13391

Query: 1166  TYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA 1225
               EP     +D S   +F   L    VI      +     G P+P  +W      L    
Sbjct: 13392 --EP----TMDLS---AFKDGL---EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGD 13439

Query: 1226  RFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
             R +M +      L I      D GIY  +  N
Sbjct: 13440 RVKMKTLSAYAELVISPSERSDKGIYTLKLEN 13471



 Score =  184 bits (467), Expect = 5e-46
 Identities = 128/483 (26%), Positives = 224/483 (46%), Gaps = 20/483 (4%)

Query: 702   PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG- 758
             PE  G S    ++ +K+ +   +G   V+TT   +  TV    +    V+ V  +N +G 
Sbjct: 14107 PEKDGGSPITNYIVEKRDV-RRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQ 14165

Query: 759   ------EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
                   ED V L       P  P A  + +V +    ++WEPP  DGG+PI  Y++E+K+
Sbjct: 14166 SDYTEIEDSV-LAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKE 14224

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGP 869
             +   RW++       + +     +IEG   + +V A N  G+  PS  ++      P  P
Sbjct: 14225 RLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP 14284

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             PS P  L V D     +++ W+PPE+ G   + GY VE CP G  +W+       +    
Sbjct: 14285 PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKF 14344

Query: 930   LVKD-LPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVG 988
              V++ +      + RVRA N  G   P   +E V  ++   +P + L  H    I+   G
Sbjct: 14345 KVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIE---G 14401

Query: 989   EPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
             E +++ +PF+  P P V+W K+G+ + A + ++++N      L +  + R  +G Y +T+
Sbjct: 14402 EKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITL 14461

Query: 1048  RIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADK 1107
               +     A++ ++V+  P P +D++ +D    +  L W+PP+  G T +  Y +++ + 
Sbjct: 14462 ENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA 14521

Query: 1108  KTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITY 1167
                 +  V+    +    V +LI    Y+FRV + N VG        K PV    P    
Sbjct: 14522 GRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVG-GGEYIELKNPVIAQDPKQPP 14580

Query: 1168  EPP 1170
             +PP
Sbjct: 14581 DPP 14583



 Score =  183 bits (465), Expect = 8e-46
 Identities = 119/406 (29%), Positives = 184/406 (45%), Gaps = 15/406 (3%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P  P ++++ +D   VQW  P  DGG  I+GY LE+K+K S  W++LN   IQ+   
Sbjct: 24505 PGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKF 24564

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSL 888
             +   + EG+ YE +V A N +G+ +PS  S+ F+   P  PP  P  +    ++   V+L
Sbjct: 24565 KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIV---ITRNNVTL 24621

Query: 889   KWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
             KW+ P   G   + GY VE        W+ A       T   V  L    R  FRV A N
Sbjct: 24622 KWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARN 24681

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTW 1007
              AG    P  ++  +T ++ +  P   L    +  I    GE   L    +GKP P V W
Sbjct: 24682 AAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVW 24741

Query: 1008  TKEGQPL--AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             +K+G+ L      + I+++   T L ++   R   G Y + +          + ++V+D+
Sbjct: 24742 SKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDR 24801

Query: 1066  PSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             P PP+  L+VT        L W PP   G   +  Y ++K +   + W  V    +  + 
Sbjct: 24802 PGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNY 24861

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPP 1170
              V +L+ GN Y FRV + N  G  +       PV    P   Y+PP
Sbjct: 24862 KVTKLLPGNEYIFRVMAVNKYGIGE--PLESGPVTACNP---YKPP 24902



 Score =  183 bits (465), Expect = 8e-46
 Identities = 149/599 (24%), Positives = 245/599 (40%), Gaps = 43/599 (7%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K+G+ L   +R+ VS    V  L+I + +  D   Y       A +++     + + I
Sbjct: 25428 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSIT-----VPITI 25482

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
               + R  PP                     +R+D  +S D   T+ W      G    + 
Sbjct: 25483 IVLDRPGPP-------------------GPIRID-EVSCDSI-TISWNPPEYDGGCQISN 25521

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNP 756
                +  E T  S  W    + +  T  ++   TT     F V    +  +  Y+      
Sbjct: 25522 YIVEKKETT--STTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYS------ 25573

Query: 757   VGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSY 816
               E    +       P  P  PK+ +  + +  V W+ P  DGG  ++GY LE K++ S 
Sbjct: 25574 --ESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSI 25631

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHL 876
              W + N  LI +   +   + EG++YE RVYA N  G+ + S + +P     P   P   
Sbjct: 25632 LWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQP 25691

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V +++  +VSLKW  P   G   + GY VE        W+       + T   V +L  
Sbjct: 25692 EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTE 25751

Query: 937   GARLLFRVRAHNMA-GPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI 995
               R  FRV A N A     P  +T P+ V++ ++ PR+ +    R  I  K GE + +  
Sbjct: 25752 DQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINA 25811

Query: 996   PFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMED 1054
                G+P P ++W K+G  +       I ++   T+L ++   R  +G Y +T++      
Sbjct: 25812 DIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTR 25871

Query: 1055  KATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWF 1113
                +  +V+DKP PP   L +        +L W  PQ+ G  ++  Y V+K +   + W 
Sbjct: 25872 SVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT 25931

Query: 1114  TVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR----AATTKEPVFIPRPGITYE 1168
                   + T C V +L+ GN Y FRV   N  G  +     A    +P  +P P  + E
Sbjct: 25932 ICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLE 25990



 Score =  182 bits (462), Expect = 2e-45
 Identities = 114/380 (30%), Positives = 178/380 (46%), Gaps = 5/380 (1%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             +P  P + +++N+ +DS TV W  P  DGG  I+GYI+E++ +   RW++ N   I +L 
Sbjct: 23818 LPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLR 23877

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
                  + E   YE RV A NA G+  PSPA+  +    P+  P  PT+  + D +  +++
Sbjct: 23878 LRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSIT 23937

Query: 888   LKWRPPERVGAGGLDGYSVEYCPEGCSEW-VAALQGLTEHTSILVKDLPTGARLLFRVRA 946
             L W  P   G   + GY VE C     EW +   Q     T   +  L        RV A
Sbjct: 23938 LAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCA 23997

Query: 947   HNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
              N  G G   +    V  ++ L+ P L L   LR+ I  + G    + IPF+G+P P++T
Sbjct: 23998 LNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEIT 24057

Query: 1007  WTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKP 1066
             W++E      ++V I      T L I    R  +G Y + +   +    A + ++V+D P
Sbjct: 24058 WSREEGEFT-DKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTP 24116

Query: 1067  SPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVV 1126
              PPQ+L V +    +  L W+PP   G  ++  Y + K +     +  V     +T   V
Sbjct: 24117 GPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKV 24176

Query: 1127  PELIIGNGYYFRVFSQNMVG 1146
               L  G  YYFRV ++N  G
Sbjct: 24177 ENLTEGAIYYFRVMAENEFG 24196



 Score =  180 bits (456), Expect = 9e-45
 Identities = 116/381 (30%), Positives = 183/381 (48%), Gaps = 6/381 (1%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P AP  P++ +V  ++ +++WE P +DGG  I+GY +E+K++ +  W++ N     E ++
Sbjct: 28841 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 28900

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWR 891
             +   ++EG+ Y+ R YA+NA G+S+ S AS+P M   P   P    V DV+ +TVSL W 
Sbjct: 28901 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 28960

Query: 892   PPERVGAGGLDGYSVEYCP---EGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
              P   G   + GY +E  P    G   W+     +       V  L  G    FRV A N
Sbjct: 28961 APAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKN 29020

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLR-QTIQKKVGEPVNLLIPFQGKPRPQVT 1006
              AG       +T PVT ++    P+ +L   L    +  + G  + L     GKP P++ 
Sbjct: 29021 AAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKII 29080

Query: 1007  WTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             WTK  + L   E+VS++ +       I+   R  SG Y +TV+  +     +++++V+D 
Sbjct: 29081 WTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDS 29140

Query: 1066  PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCV 1125
             P P   L V+        L W  PQ+ G  E+  Y V++ +   + W  V         V
Sbjct: 29141 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYV 29200

Query: 1126  VPELIIGNGYYFRVFSQNMVG 1146
             V  LI  N Y FRV + N  G
Sbjct: 29201 VTRLIKNNEYIFRVRAVNKYG 29221



 Score =  173 bits (438), Expect = 1e-42
 Identities = 193/761 (25%), Positives = 301/761 (39%), Gaps = 153/761 (20%)

Query: 3    EPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAG-VKVRWQRGGSDISASNKYGLATEG 61
            EP K PV  F +    V V+ G         + +  ++++W + G +I  S++   +   
Sbjct: 8341 EPKKPPV--FDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFAS 8398

Query: 62   TRHTLTVREVGPADQGSYAV----IAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAP 117
                L +R+V  AD G Y      +AGS   K  + +    K +P +APA          
Sbjct: 8399 GTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTI----KDKPAVAPA---------- 8444

Query: 118  GEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSAR 177
                               +  AA++G            FV  PQ   V    + TF A+
Sbjct: 8445 -------------------TKKAAVDGRL---------FFVSEPQSIRVVEKTTATFIAK 8476

Query: 178  VAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSY 237
            V G  +   P VKW KGKW  L+   G  + +H   D A      +L I D     +G Y
Sbjct: 8477 VGGDPI---PNVKWTKGKWRQLNQ--GGRVFIHQKGDEA------KLEIRDTTKTDSGLY 8525

Query: 238  RCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSS 297
            RC    +     SN NL V E             ++  + G               D  +
Sbjct: 8526 RCVAFNEHGEIESNVNLQVDERK-----------KQEKIEG---------------DLRA 8559

Query: 298  LLKKRDSFRTPRDSKLEAPAEE-DVWEILRQAPPSEYERIAFQYGVTDLRGML------- 349
            +LKK     TP   K     EE D+ E+L+   P EYE+ A  YG+TD RG+L       
Sbjct: 8560 MLKK-----TPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLK 8614

Query: 350  ------------KRLKGMRRDEKK----STAFQKKLEPAYQVSKGHKIRLTVELADHDA- 392
                        + ++   RDEK+     +  Q++L     V+    I     L D+DA 
Sbjct: 8615 QSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAV 8674

Query: 393  ------------EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGG 440
                        ++ W K  ++++ S  K+     G + TL +  C L D   Y+ V G 
Sbjct: 8675 FEIDIKINYPEIKLSWYKGTEKLEPS-DKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGP 8733

Query: 441  EKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFK 500
               S +L V EP     R L+D  +  GQ     C+ S    + +W ++G  L  +   +
Sbjct: 8734 HIASAKLTVIEP--AWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQG--R 8789

Query: 501  YRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKD 560
            ++ + + + H L I +   ED G Y       +  AEL ++ + ++  + I +++V    
Sbjct: 8790 HKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQ 8849

Query: 561  QAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV--- 617
             A F+CEVS ++    W K   EL    +    + GR H +TI +VTP DE  YS +   
Sbjct: 8850 SATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARL 8909

Query: 618  -PEGFACNLSAKLHF--MEVKIDFVPRQEPPK--------IHLDCPGRIPDTIVVVAGNK 666
             P G A   +A+L+    E+K++  P   P          I    P  IP   VV     
Sbjct: 8910 EPRGEA-RSTAELYLTTKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPP--VVAPPIP 8966

Query: 667  LRLDVPISGDPAP--TVIWQKAITQ-GNKAPARPAPDAPED 704
            L L  P    P P    + +KA+ +   K  A+P    P +
Sbjct: 8967 LLLPTPEEKKPPPKRIEVTKKAVKKDAKKVVAKPKEMTPRE 9007



 Score =  171 bits (432), Expect = 5e-42
 Identities = 157/594 (26%), Positives = 238/594 (40%), Gaps = 72/594 (12%)

Query: 707   DSDEWVFDKKL-LCETEGRVRVETTKDRSIFTV-----EGAEKEDEGVYTVTVKNPVGED 760
             D+D+WV   K+ + +T  RV+  T K +  F V      G  K  +    + +K+P    
Sbjct: 13925 DTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDP---- 13980

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMR 820
                     ID P  P  P + +VG+ S  + W  P +DGG  I  Y++E  K  +  W+R
Sbjct: 13981 --------IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVR 14032

Query: 821   LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLA 877
             +  + +    H    ++EG  Y  RV AVN  G S PS  S P +    + PPS P  L 
Sbjct: 14033 VA-EGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLE 14091

Query: 878   VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
             V +++  T  LKW  PE+ G   +  Y VE        W   +    + T   V  L  G
Sbjct: 14092 VINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW-QTVDTTVKDTKCTVTPLTEG 14150

Query: 938   ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV---------- 987
             +  +FRV A N  G        + V  ++    P       +    ++ V          
Sbjct: 14151 SLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKND 14210

Query: 988   -GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP----TDTILFIRAARRVHSGT 1042
              G P+   +  + K R    W K G+  AG + + R +     T+    +RA      G 
Sbjct: 14211 GGRPIQRYV-IEKKERLGTRWVKAGKT-AGPDCNFRVTDVIEGTEVQFQVRAENEAGVGH 14268

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
                   I ++ED  +        PSPP DL VTDA   ++A+ WKPP+  G + + GY V
Sbjct: 14269 PSEPTEILSIEDPTS-------PPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHV 14321

Query: 1103  QKADKKTMEWFTVLEH------YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKE 1156
             +     T +W  V         ++    VVP+      Y  RV + N +G S       E
Sbjct: 14322 EMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPD----KEYVLRVRAVNAIGVS-------E 14370

Query: 1157  PVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216
             P  I    +  +P     +D       T  ++   VI G    +    R  P P +SW K
Sbjct: 14371 PSEISENVVAKDPDCKPTIDLE-----THDII---VIEGEKLSIPVPFRAVPVPTVSWHK 14422

Query: 1217  NGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             +G ++    R  M +      LE+ K    D GIY     N  G A     ++V
Sbjct: 14423 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score =  164 bits (414), Expect = 7e-40
 Identities = 217/917 (23%), Positives = 362/917 (39%), Gaps = 124/917 (13%)

Query: 395  KWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPV 454
            KWLKNG EI+ S  K    +     +L I      D A Y  V G    +  L+V+   +
Sbjct: 3000 KWLKNGVEIK-STDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHI 3058

Query: 455  LITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLII 514
               + ++D  V+  +R  FECEVSE    V+W+KD  EL  + T + + +K+   H L+I
Sbjct: 3059 EFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRIKIQKEKYVHRLLI 3116

Query: 515  NEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVR 574
                + DAG Y +   G  + A+L V+ + + +     ++ V  K +AV + EV++++V 
Sbjct: 3117 PSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVD 3176

Query: 575  GVWLKNGKEL--VPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFM 632
              W K+G E+      R K     R+H++ I +   +D  +Y+FV      +++      
Sbjct: 3177 AHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL----- 3231

Query: 633  EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNK 692
                 +V   EPP++  +        + V +G   R    ISG P P + W K       
Sbjct: 3232 -----YVNAPEPPQVLQEL-----QPVTVQSGKPARFCAVISGRPQPKISWYK------- 3274

Query: 693  APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                            +E +      C+      +   ++ ++  +E A  ED  VYT  
Sbjct: 3275 ----------------EEQLLSTGFKCKF-----LHDGQEYTLLLIE-AFPEDAAVYTCE 3312

Query: 753  VKNPVG--EDQVNLTVKVIDV--PDAPA---APKISNVGEDSCTVQWEPPAY----DGGQ 801
             KN  G      +L+V+V +V  PD       P I    +D+ T + +P  +     G  
Sbjct: 3313 AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3372

Query: 802  PILGYILERKKKKSYRWMRLN--FDLIQELSHEARRMIEGVVYEMRVYAVNAI----GMS 855
              + +  + KK K  R+ R+    D  Q    EA    EG    +   AV  +     +S
Sbjct: 3373 LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLS 3432

Query: 856  RPSPAS----------QPFMPIGP----PSEPTHLAVEDVSDTTVSLKWRPPERVG--AG 899
              +P S          +  M   P      EP  +A+  ++  T  ++  P  R      
Sbjct: 3433 LEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKA 3492

Query: 900  GLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTT 959
            G + Y  + C    S+++++L+ L       V D        +  +A N  G    V+ T
Sbjct: 3493 GREIYESDKCSIRSSKYISSLEILRTQ----VVDCGE-----YTCKASNEYG---SVSCT 3540

Query: 960  EPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEE 1018
              +TV E      L  P+ L       VG+    +    G P  +  W K+G  L+    
Sbjct: 3541 ATLTVTEAYPPTFLSRPKSLTTF----VGKAAKFICTVTGTPVIETIWQKDGAALSPSPN 3596

Query: 1019 VSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLR-VTDA 1077
              I ++    IL +        G Y      +   D     L ++DKP   ++L  V  A
Sbjct: 3597 WRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSA 3656

Query: 1078 WGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYF 1137
                V LE +  +D   T  W    QK      + + +    +     +P   + +   +
Sbjct: 3657 INKKVHLECQVDEDRKVTVTWSKDGQKLPPG--KDYKICFEDKIATLEIPLAKLKDSGTY 3714

Query: 1138 RVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNY-KALDFSEAPSFTQPLVNRSVIAGY 1196
               + N  G S  +AT              EPP++ K +D    PS+        ++ G 
Sbjct: 3715 VCTASNEAGSSSCSATV----------TVREPPSFVKKVD----PSYL-------MLPGE 3753

Query: 1197 TAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRAT 1256
            +A L C ++GSP  +++WFKN  +L E    RM+       L+I      D G Y C A 
Sbjct: 3754 SARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAV 3813

Query: 1257 NLQGEARCECRLEVRVP 1273
            N  G   C   + ++ P
Sbjct: 3814 NDVGSDSCSTEIVIKEP 3830



 Score =  151 bits (381), Expect = 4e-36
 Identities = 127/445 (28%), Positives = 198/445 (44%), Gaps = 36/445 (8%)

Query: 750   TVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILE 809
             T  + +P+    V +     + P AP  P I+ V +DSC V W+PPA DGG  I  Y LE
Sbjct: 30803 TFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLE 30862

Query: 810   RKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPF----- 864
             +++KK  +W+ +  + I+E     + +IEG+ YE RV   N  G S  S  S+P      
Sbjct: 30863 KREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSD 30922

Query: 865   MPIGPP---SEPTHLAVEDVSDTTVSLK-WRPPERVGAGGLDGYSVEYCPEGCSEWVAAL 920
             +PI  P    E  +L V   S+ T+  K    P+ +      G   E   +G    +   
Sbjct: 30923 VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQG--KEIIADGLKYRIQEF 30980

Query: 921   QGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLR 980
             +G   +  +++  +      +++VRA N  G      +       E+    ++ LP+ L 
Sbjct: 30981 KG--GYHQLIIASVTDDDATVYQVRATNQGG------SVSGTASLEVEVPAKIHLPKTLE 31032

Query: 981   --QTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE----EVSIRNSPTDTILFIRA 1034
                 +    GE V++ IPF GKP P +TW K GQ L       +V +  S T +++F   
Sbjct: 31033 GMGAVHALRGEVVSIKIPFSGKPDPVITWQK-GQDLIDNNGHYQVIVTRSFT-SLVFPNG 31090

Query: 1035  ARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGN 1094
               R  +G Y V  +     D+ T+ L V D P PP+ ++V+D    +V L W  P   G 
Sbjct: 31091 VERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGG 31150

Query: 1095  TELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATT 1154
             +++  Y V+K       W  V    R T   V  L     Y FRV ++N  G S      
Sbjct: 31151 SKITNYIVEKCATTAERWLRV-GQARETRYTVINLFGKTSYQFRVIAENKFGLS------ 31203

Query: 1155  KEPVFIPRPGITYEPPNYKALDFSE 1179
              +P     P IT E    +A+++ E
Sbjct: 31204 -KPSEPSEPTITKEDKT-RAMNYDE 31226



 Score =  144 bits (364), Expect = 4e-34
 Identities = 106/366 (28%), Positives = 162/366 (44%), Gaps = 48/366 (13%)

Query: 640   PRQEPPKI--------HLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGN 691
             PR+  P I         LD  G     ++  AG+ +++++P+ G P PTV W+K      
Sbjct: 21048 PRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKK------ 21101

Query: 692   KAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTV 751
                           GD        ++L +T+ RV  ETT   +I  +    + D G Y +
Sbjct: 21102 --------------GD--------QILKQTQ-RVNFETTATSTILNINECVRSDSGPYPL 21138

Query: 752   TVKNPVGEDQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
             T +N VGE    +T++V D+P  P  P K   V  D  T  W+PP  DGG PI  Y++E 
Sbjct: 21139 TARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEM 21198

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFM 865
             ++  S  W+ L   +I+  +++A R+  G+ Y+ RV A N  G+     S    A+ PF 
Sbjct: 21199 RQTDSTTWVELATTVIRT-TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFK 21257

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
               GPP  P    V  V+  ++++ W  P   G   + GY VE        W    + L  
Sbjct: 21258 VPGPPGTPQ---VTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVP 21314

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHL-RQTIQ 984
                     L  G    FRV A NMAG   P   +EP+   + +  P   +P ++ R T+ 
Sbjct: 21315 GNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVT 21374

Query: 985   KKVGEP 990
              K  +P
Sbjct: 21375 LKWAKP 21380



 Score =  142 bits (357), Expect = 3e-33
 Identities = 105/345 (30%), Positives = 153/345 (44%), Gaps = 43/345 (12%)

Query: 635   KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNK-LRLDVPISGDPAPTVIWQKAITQGNKA 693
             +I  V R +     LD  G +PD   +   N   RL +PI G PAP+V W+K        
Sbjct: 19968 EITVVARDDVVAPDLDLKG-LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG------- 20019

Query: 694   PARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
                      ED                T+ RV VE++   +   V   +K D G YT+T+
Sbjct: 20020 ---------EDP-------------LATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITL 20057

Query: 754   KNPVGEDQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             KN  G  +  +++KV+  P  P  P K   V  ++ T++W PP  DGG  I  YILE++ 
Sbjct: 20058 KNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRD 20117

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPF-MP 866
               + +W+      +Q+ +    R+ EG+ Y  RV A N  G+     S P  A  PF +P
Sbjct: 20118 SVNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 20176

Query: 867   IGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH 926
               PP  P ++   DV   +VSL W  P++ G   + GY +E+       W  A +     
Sbjct: 20177 DAPP--PPNIV--DVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRM 20232

Query: 927   TSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
                 V  L  G    FRV A N+AG G P   +EPV   + +  P
Sbjct: 20233 RDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 20277



 Score =  140 bits (352), Expect = 1e-32
 Identities = 120/428 (28%), Positives = 177/428 (41%), Gaps = 58/428 (13%)

Query: 375   VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY 434
             V+ G       EL+  D  V+W   G++++ S  K +  S G   TLT+    L D    
Sbjct: 12207 VTAGETATFDCELSYEDIPVEWYLKGKKLEPS-DKVVPRSEGKVHTLTLRDVKLEDAGEV 12265

Query: 435   QCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELT 494
             Q      K    LFVKEPPV  T+PLEDQ V  G     ECEVS E A+VKW K+G E+ 
Sbjct: 12266 QLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEIL 12325

Query: 495   REETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADL 554
             + +  KY    DG+   L+I++   ED   Y       +    L V    +E  + + DL
Sbjct: 12326 KSK--KYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDL 12383

Query: 555   MVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
              V  K+ A F+CE+S EN +  W K+G E+    +  +   G V  L I+     DEA+Y
Sbjct: 12384 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 12443

Query: 615   SFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPIS 674
             S   E      S  L  +E +  F                    I V   + ++L   +S
Sbjct: 12444 SC--EVRTARTSGMLTVLEEEAVFTKNLA--------------NIEVSETDTIKLVCEVS 12487

Query: 675   GDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRS 734
               P   VIW K                    GD +        + ET GR  + T   + 
Sbjct: 12488 -KPGAEVIWYK--------------------GDEE--------IIET-GRYEILTEGRKR 12517

Query: 735   IFTVEGAEKEDEGVYTVTVKNPVGEDQV---NLTVKVIDVP------DAPAAPKISNVGE 785
             I  ++ A  ED G Y   + +   + +V    L  + I  P      +   A  + ++ +
Sbjct: 12518 ILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISK 12577

Query: 786   DSCTVQWE 793
             +S  VQW+
Sbjct: 12578 ESFPVQWK 12585



 Score =  137 bits (345), Expect = 7e-32
 Identities = 127/511 (24%), Positives = 201/511 (39%), Gaps = 87/511 (17%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             + P   LD   +  D IVV AG    L+  I G P P V+W K                 
Sbjct: 24703 DAPNASLD--PKYKDVIVVHAGETFVLEADIRGKPIPDVVWSK----------------- 24743

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D K L ET  R+ +++T  ++   V+   + D G Y + + N  G   +
Sbjct: 24744 -----------DGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSI 24792

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              +TVKV+D P  P  P K++ V  + C + W PP  DGG  I  YI+E+++     W ++
Sbjct: 24793 PITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQV 24852

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFMPIGPPSEPTHL 876
             + + +Q L+++  +++ G  Y  RV AVN  G+     S P  A  P+ P GPPS P   
Sbjct: 24853 STE-VQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTP--- 24908

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V  ++  ++ + W  P   G   ++GY +E   +    W    +       + V  L  
Sbjct: 24909 EVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTE 24968

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G    FRV A N AG G P   +      + L  P                G P N  + 
Sbjct: 24969 GHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP----------------GPPSNPKVT 25012

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM 1052
                +    + W+K     G P+ G  V ++ +  D          +    + VT   EN 
Sbjct: 25013 DTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENT 25072

Query: 1053  E--------------DKATLVLQVV--DKPSPPQ-----------DLRVTDAWGLNVALE 1085
             E              + ATL   VV  ++  PP+            LR +    L V ++
Sbjct: 25073 EYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIK 25132

Query: 1086  WKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
              +P  +V   +  G    +A  +    FT+L
Sbjct: 25133 GRPEPEVKWEKAEGILTDRAQIEVTSSFTML 25163



 Score =  135 bits (340), Expect = 2e-31
 Identities = 215/933 (23%), Positives = 349/933 (37%), Gaps = 118/933 (12%)

Query: 378   GHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV 437
             G  +    EL     EV+WL+N   + + G K+   S G    L I      D   Y+ +
Sbjct: 12926 GADVVFLAELNKDKVEVQWLRNNMVV-VQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI 12984

Query: 438   VGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSE-EGAQVKWLKDGVELTRE 496
                ++   +L +   P + T   +D +V VG+ +           A+ +W K+   L+ +
Sbjct: 12985 AKDKEARAKLELAAAPKIKTAD-QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK 13043

Query: 497   ETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMV 556
                        ++    I EA   D G Y +        AE  +  K ++V   + +L V
Sbjct: 13044 T-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEV 13098

Query: 557   GAKDQAVFKCEVSDENVRGVW---LKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
                       E  D  V   W   L +G   +    ++   I R   +   D   + E  
Sbjct: 13099 ---------TETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFT 13149

Query: 614   YSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPI 673
              + + +G       +  F     + V   EP  +  D P        V A +K   DVP 
Sbjct: 13150 VTGLQKG-----GVEYLFRVSARNRVGTGEP--VETDNP--------VEARSKY--DVP- 13191

Query: 674   SGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSD--EWVFDKK----LLCETEGRVRV 727
              G P    I     T  N+       + PE  G ++   +V + +    +  +T   VR 
Sbjct: 13192 -GPPLNVTI-----TDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRA 13245

Query: 728   ETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLT---VKVIDVPDAPAAP---KIS 781
             E         VEG E      + V  +N +G  + +     VKV D  + P+ P     S
Sbjct: 13246 EDLSATVTDVVEGQEYS----FRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSS 13301

Query: 782   NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
             +  + S  ++WEPP  DGG PILGYI+ER ++    W+R N  L+ EL+++   + +G  
Sbjct: 13302 DQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNK 13361

Query: 842   YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGA-GG 900
             Y  RV A N  G+S PS    P        EPT     D+S     L+   P  +     
Sbjct: 13362 YLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM----DLSAFKDGLEVIVPNPITILVP 13417

Query: 901   LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960
               GY     P   + W    + L     + +K L   A L+      +  G         
Sbjct: 13418 STGY-----PRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENR 13472

Query: 961   PVTVQ-----EILQRPRLQLPRHLR-------------QTIQKKVGEPVNLLIPFQGKPR 1002
               T+       ++ RP    P+ L+             +      G P+   +  + +  
Sbjct: 13473 VKTISGEIDVNVIARP--SAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYV-VEKREV 13529

Query: 1003  PQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE--NMEDKATLVL 1060
              + TWTK    +   E ++ +         +   R   G  +     E  NM   AT+  
Sbjct: 13530 SRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATV-- 13587

Query: 1061  QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
                  P PP++++  D    ++ L W PP++ G + + GY V++  + + +W    E   
Sbjct: 13588 -----PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVA 13642

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
              T   V  L  G  Y +RV + N  G S  +  T+E                +A+D  EA
Sbjct: 13643 ETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE---------------IQAVDTQEA 13687

Query: 1181  PSF---TQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             P      + L   +V AG    L   V G P+PKI+W K  + L +D R  + +     T
Sbjct: 13688 PEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST 13747

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             + I      D G Y+  A N+ G A     + V
Sbjct: 13748 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score =  134 bits (338), Expect = 4e-31
 Identities = 121/458 (26%), Positives = 200/458 (43%), Gaps = 38/458 (8%)

Query: 708   SDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVK 767
             +D+WV   K         ++ TT    ++TV G   + E  + +  +N VG  + +   +
Sbjct: 30373 TDKWVRHNK--------TQITTT----MYTVTGLVPDAEYQFRIIAQNDVGLSETSPASE 30420

Query: 768   VI------DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              +      D P  P   +I ++ +DS T+QWE P  DGG+ ILGY +E ++     W + 
Sbjct: 30421 PVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKS 30480

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
             N + I++       ++E   YE RV+A N  G+SRP   +          E   +  E +
Sbjct: 30481 NKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKE-M 30539

Query: 882   SDTTVSLKWRPPERVGAGGLDGYSVEYCPEG-----CSEWVAALQGLTEHTSILVKDLPT 936
              D T  L           G     +++   G       ++  +  G T   +++ ++   
Sbjct: 30540 KDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQED 30599

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
                 ++   A N  G    V T+  + +Q     P+      L++     VG  + L + 
Sbjct: 30600 EG--VYTCIATNEVGE---VETSSKLLLQAT---PQFHPGYPLKEKYYGAVGSTLRLHVM 30651

Query: 997   FQGKPRPQVTWTKEGQPLA--GEEVSIRNSPTDTILFIR-AARRVHSGTYQVTVRIENME 1053
             + G+P P +TW   GQ L    E ++I N+   T L ++   R+ H+G Y+V +      
Sbjct: 30652 YIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGT 30710

Query: 1054  DKATLVLQVVDKPSPPQDLRVTDAWGLNVA-LEWKPPQDVGNTELWGYTVQKAD-KKTME 1111
               A L +++ DKP  P    V +A   N A + WKPP D G + +  Y V+K + K+  E
Sbjct: 30711 VDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAE 30770

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             W  V      T C +  L    GYYFRV +QN  G SD
Sbjct: 30771 WQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD 30808



 Score =  134 bits (337), Expect = 6e-31
 Identities = 115/412 (27%), Positives = 167/412 (40%), Gaps = 57/412 (13%)

Query: 654   RIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVF 713
             ++   + V AG+ +RL+  + G P P V W K              DA + T        
Sbjct: 18206 KLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKD------------KDATDLTRSP----- 18248

Query: 714   DKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPD 773
                       RV+++T  D S F++  A++ D G Y VT  N  G      TV V+D P 
Sbjct: 18249 ----------RVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPG 18298

Query: 774   APAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEA 833
                  KI +V  D CTV W+PP  DGG  I  YILE+ + K   W   +  ++       
Sbjct: 18299 PVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTP-GTTV 18357

Query: 834   RRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKW 890
              R+IEG  Y  RV A N IG   P+  S+P +       P  P    V  VS   +++ W
Sbjct: 18358 TRLIEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVW 18416

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
              PPE  G   + GY +E   +  + WV   +       + V++L       FRV+A N  
Sbjct: 18417 NPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEI 18476

Query: 951   GPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE 1010
             G G P   + PV  ++ ++ P                G P N  +    K    + W K 
Sbjct: 18477 GIGEPSLPSRPVVAKDPIEPP----------------GPPTNFRVVDTTKHSITLGWGKP 18520

Query: 1011  ----GQPLAGEEVSIR-----NSPTDTILFIRAARRVHSGTYQVTVRIENME 1053
                 G P+ G  V +R      SP +      AA ++    + VT   EN E
Sbjct: 18521 VYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQE 18572



 Score =  132 bits (333), Expect = 2e-30
 Identities = 101/340 (29%), Positives = 154/340 (45%), Gaps = 19/340 (5%)

Query: 649   LDCPGRIPDT-IVVVAGNKLRLDVPISGDPAPTVIWQKA--ITQGNKAPARPAPDAPEDT 705
             +D P  I  T + V  G+++ LD  ISG P PT+ W K   +    +   R AP      
Sbjct: 14678 IDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRK 14737

Query: 706   GDSDEWVFDKKLLCETEGRVRVETTKD-RSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNL 764
             G+  E   ++  +     R+ ++ +K   S   V  + + D G+Y + V+N  G  +   
Sbjct: 14738 GEVQE---EEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPC 14794

Query: 765   TVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER--KKKKSYRWMRLN 822
             TV V+D P  P      ++ + S   +WEPP  DGG  I+ Y LE+  K K    W+ + 
Sbjct: 14795 TVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT 14854

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIG-----MSRPSPASQPFMPIGPPSEPTHLA 877
                ++   +   ++IEG  Y  RV A N  G     +S+P  A  PF   GPP  P    
Sbjct: 14855 -STLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPF---GPPDAPDKPI 14910

Query: 878   VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
             VEDV+  ++ +KW  P+  G+  L GY +E      + W    + L       V  L  G
Sbjct: 14911 VEDVTSNSMLVKWNEPKDNGSPIL-GYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEG 14969

Query: 938   ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPR 977
                +FRV A N AGPG     ++P T  + +  P   +PR
Sbjct: 14970 LTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPR 15009



 Score =  132 bits (331), Expect = 3e-30
 Identities = 116/487 (23%), Positives = 193/487 (39%), Gaps = 56/487 (11%)

Query: 547   VYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDD 605
             + + + D+     + A   C++    +  + W + GKEL+   + K+S  GR H LT+  
Sbjct: 30535 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 30594

Query: 606   VTPADEADYSFVP--EGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVA 663
                 DE  Y+ +   E      S+KL            Q  P+ H   P  + +      
Sbjct: 30595 EEQEDEGVYTCIATNEVGEVETSSKLLL----------QATPQFHPGYP--LKEKYYGAV 30642

Query: 664   GNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEG 723
             G+ LRL V   G P P + W                             F  + L +   
Sbjct: 30643 GSTLRLHVMYIGRPVPAMTW-----------------------------FHGQKLLQNSE 30673

Query: 724   RVRVETTKDRSIFTVEGAEKEDE-GVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP-KIS 781
              + +E T+  +   ++  +++   G Y V + N  G     L V++ D PD P  P  I 
Sbjct: 30674 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIE 30733

Query: 782   NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
              + ++S  + W+PPA DGG  I  Y++E+ + K     +L    I   +     + E   
Sbjct: 30734 ALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAG 30793

Query: 842   YEMRVYAVNAIGMSRPSPAS------QPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPER 895
             Y  RV A N  G+S P   S       PF   G P +PT  AV    D+ V + W+PP  
Sbjct: 30794 YYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAV--TKDSCV-VAWKPPAS 30850

Query: 896   VGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAP 955
              G   +  Y +E   +  ++W++        T   VK+L  G    FRV+  N+ G    
Sbjct: 30851 DGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEW 30910

Query: 956   VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
                +EP+T +  +          LR  +  +      L+    G P+P V W ++G+ + 
Sbjct: 30911 SEISEPITPKSDVPIQAPHFKEELR-NLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII 30969

Query: 1016  GEEVSIR 1022
              + +  R
Sbjct: 30970 ADGLKYR 30976



 Score =  131 bits (329), Expect = 5e-30
 Identities = 95/310 (30%), Positives = 133/310 (42%), Gaps = 39/310 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             +T  V+AG  L++DVP  G P P V W K                            D  
Sbjct: 22155 NTFTVLAGEDLKVDVPFIGRPTPAVTWHK----------------------------DNV 22186

Query: 717   LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPA 776
              L +T  RV  E+T++ S+ T++ A +ED G Y V + N  GE    L V V+D P  P 
Sbjct: 22187 PLKQTT-RVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPT 22245

Query: 777   AP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
              P K+  V  DS T+ W PP YDGG  I  YI+E++   +  W  ++   +   + +A R
Sbjct: 22246 GPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSAT-VARTTIKACR 22304

Query: 836   MIEGVVYEMRVYAVNAIGMS-----RPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKW 890
             +  G  Y+ R+ A N  G S      P+ A  PF   GPP  P    V   S  ++ ++W
Sbjct: 22305 LKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPV---VTLSSRDSMEVQW 22361

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
               P   G   + GY +E        WV   +     T      L  G    FRV A N+ 
Sbjct: 22362 NEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIV 22421

Query: 951   GPGAPVTTTE 960
             G G P   +E
Sbjct: 22422 GIGKPSKVSE 22431



 Score =  130 bits (328), Expect = 6e-30
 Identities = 94/317 (29%), Positives = 141/317 (44%), Gaps = 37/317 (11%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             +PP+I +D   +  DTIVV AG   ++D  I G P PT+ W K                 
Sbjct: 22539 DPPRISMD--PKYKDTIVVHAGESFKVDADIYGKPIPTIQWIK----------------- 22579

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                GD +              R+ +++T   +  +V+ A + D G Y +  KN  GE  V
Sbjct: 22580 ---GDQE---------LSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSV 22627

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              + VKV+D P  P  P  IS V  + CT+ W+PP  DGG  I+ YI+ER++     W  +
Sbjct: 22628 TVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV 22687

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGP---PSEPTHLAV 878
             + + +Q LS +  +++EG  Y  R+ AVN  G+  P   S+P +   P   P  P    V
Sbjct: 22688 DAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPL-ESEPVVAKNPFVVPDAPKAPEV 22745

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
               V+  ++ + W  P   G   + GY +E   +    W    + L     + V  L    
Sbjct: 22746 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 22805

Query: 939   RLLFRVRAHNMAGPGAP 955
                FRV A N AG   P
Sbjct: 22806 DYEFRVSAENAAGLSEP 22822



 Score =  128 bits (321), Expect = 4e-29
 Identities = 99/421 (23%), Positives = 172/421 (40%), Gaps = 64/421 (15%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP+I L     +   + V AG  + LD  + G P PTV W+K                  
Sbjct: 19292 PPRIDLSVA--MKSLLTVKAGTNVCLDATVFGKPMPTVSWKK------------------ 19331

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE--GAEKEDEGVYTVTVKNPVGEDQ 761
                       D  LL   EG   ++    R++ T+E     ++D G YT+T +N  G   
Sbjct: 19332 ----------DGTLLKPAEG---IKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKS 19378

Query: 762   VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
               + +KV+D P  PA+ KI+ +  D   + WEPP  DGG  I  YI+++++     W ++
Sbjct: 19379 ATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQV 19438

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFMPIGPPSEPTHL 876
             +   +   S    ++IEG  Y+ R+ A N  G+     + P+ A  P+ P G    P   
Sbjct: 19439 S-ATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPP--- 19494

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              + +++   +++ W+PP   G   + GY +E        W    +      ++    L  
Sbjct: 19495 VISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQE 19554

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G    FRV A N AGPG P   ++    ++    P                G P    + 
Sbjct: 19555 GTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP----------------GPPAFPKVY 19598

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM 1052
                +    ++W K     G P+ G  V ++ + +D  +     + +    ++VT  +E+ 
Sbjct: 19599 DTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDT 19658

Query: 1053  E 1053
             +
Sbjct: 19659 Q 19659



 Score =  127 bits (320), Expect = 5e-29
 Identities = 107/389 (27%), Positives = 163/389 (41%), Gaps = 50/389 (12%)

Query: 365   FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
             F K LE    V +G    L  E++  +A+VKW KNG EI +   KY   + G  R L I 
Sbjct: 12287 FTKPLEDQ-TVEEGATAVLECEVSRENAKVKWFKNGTEI-LKSKKYEIVADGRVRKLVIH 12344

Query: 425   QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
              C+  D   Y C     K S  L V  P V   RPL D  V   +   FECE+S E A+V
Sbjct: 12345 DCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKV 12404

Query: 485   KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
             KW KDG E+ + +  KY     G    L+IN+ +L+D   Y+      +    L V E++
Sbjct: 12405 KWFKDGAEIKKGK--KYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEE 12462

Query: 545   LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
                 +++A++ V   D     CEVS      +W K  +E++   R ++   GR   L I 
Sbjct: 12463 AVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQ 12522

Query: 605   DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAG 664
             +    D  +Y+        +   K+H  E+  +F+ +              P  + ++ G
Sbjct: 12523 NAHLEDAGNYNCRLPSSRTDGKVKVH--ELAAEFISK--------------PQNLEILEG 12566

Query: 665   NKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGR 724
              K      IS +  P V W++              D   ++GD  + + D        G+
Sbjct: 12567 EKAEFVCSISKESFP-VQWKR-------------DDKTLESGDKYDVIAD--------GK 12604

Query: 725   VRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
              RV   KD ++        +D G Y V V
Sbjct: 12605 KRVLVVKDATL--------QDMGTYVVMV 12625



 Score =  127 bits (318), Expect = 9e-29
 Identities = 91/356 (25%), Positives = 152/356 (42%), Gaps = 39/356 (10%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P+I +D   R  DTIVV AG   RL+  + G P PT+ W +                 
Sbjct: 23621 ELPRISMDPKFR--DTIVVNAGETFRLEADVHGKPLPTIEWLRG---------------- 23662

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        DK++  E   R  ++ T  +++  V+ A + D G Y +   N  G    
Sbjct: 23663 -----------DKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSF 23709

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              + VKV+D P  P  P +++ V  + C++ W PP  DGG  I  Y++E+++     W  +
Sbjct: 23710 PVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVV 23769

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM--PIGPPSEPTHLAVE 879
               +++   S +  +++EG  Y  R+ AVN  G+  P  ++   M  P   P  P  L V 
Sbjct: 23770 ASEVVTN-SLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVT 23828

Query: 880   DVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
             +++  ++++ W  P+  G   + GY VE        W+   +       + V  L     
Sbjct: 23829 NIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHE 23888

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV----GEPV 991
               FRV A N AG G P   T      + + +P      H+  T +  +    G+P+
Sbjct: 23889 YEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPI 23944



 Score =  127 bits (318), Expect = 9e-29
 Identities = 97/336 (28%), Positives = 144/336 (42%), Gaps = 38/336 (11%)

Query: 640   PRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAP 699
             P+ EP     D  G     I   AG+   +DVPISG PAP V W+               
Sbjct: 28641 PQIEPTA---DLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK--------------- 28682

Query: 700   DAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
                           ++  L ET+ RV + TTKDR+  TV+ + + D G Y +T++N  G 
Sbjct: 28683 -------------LEEMRLKETD-RVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGV 28728

Query: 760   DQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRW 818
                ++TV VI  P     P ++S+V  +SC + W  P   GG  I  YI+E+++  +  W
Sbjct: 28729 KTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAW 28788

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTH 875
               +N   ++    +   + + + Y  RV + N  G+S+P   S P +   P  PPS PT 
Sbjct: 28789 QLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPFVPPSAPTR 28846

Query: 876   LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLP 935
               V  VS   +S++W  P   G   + GY VE        WV   +      +  V  L 
Sbjct: 28847 PEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLV 28906

Query: 936   TGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
              G    FR  A N AG       + P+  Q  +  P
Sbjct: 28907 EGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAP 28942



 Score =  124 bits (312), Expect = 4e-28
 Identities = 103/421 (24%), Positives = 167/421 (39%), Gaps = 57/421 (13%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E PKI +D   +  DT+++ AG   RL+  +SG P PT+ W K                 
Sbjct: 21457 EAPKIKVDV--KFKDTVILKAGEAFRLEADVSGRPPPTMEWSK----------------- 21497

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D K L E   ++ ++     +    + + + D G YT+T  NP G  + 
Sbjct: 21498 -----------DGKEL-EGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKH 21545

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                VKV+D P  P  P  ++ V  + C + W PP  DGG  I  YI+++++     W  +
Sbjct: 21546 IFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV 21605

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAV 878
               + +Q    +  ++++G  Y  RV AVN  G+  P   S+P +   P GPP  P +  V
Sbjct: 21606 ASE-VQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPL-ESEPVLAVNPYGPPDPPKNPEV 21663

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
               ++  ++ + W  P+  G   +  Y VE   +    W+   +         V  L  G 
Sbjct: 21664 TTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGH 21723

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
                FR+ A N AG  AP  T+      + + +P                G P N  +   
Sbjct: 21724 EYEFRIMAENAAGISAPSPTSPFYKACDTVFKP----------------GPPGNPRVLDT 21767

Query: 999   GKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMED 1054
              +    + W K     G  + G  V I     D    +     + + +Y +T   EN E 
Sbjct: 21768 SRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEY 21827

Query: 1055  K 1055
             K
Sbjct: 21828 K 21828



 Score =  123 bits (309), Expect = 1e-27
 Identities = 133/548 (24%), Positives = 211/548 (38%), Gaps = 60/548 (10%)

Query: 739   EGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID------VPDAPAAPKISNVGEDSCTVQW 792
             EG E E    Y V  +N  G    + T  +I       +P  P+ PKI + G+ + T+ W
Sbjct: 26049 EGCEYE----YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAW 26104

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
               P +DGG PI GY +E KK     W + +   ++   +    +  G  Y  RV +VN +
Sbjct: 26105 VKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKV 26163

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDT-----------TVSLKWRPPERV--GAG 899
             G S PS +S P +      EP      ++  T           TV  + RP   V     
Sbjct: 26164 GASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKP 26223

Query: 900   GLDGYSVEYCPEGCSEWVAALQGLTEHTS----ILVKDLPTGARLLFRVRAHNMAGPGAP 955
               D  +  Y     S     ++    + S    + ++++ + A L   V+  +  GP   
Sbjct: 26224 DTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTN 26283

Query: 956   VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
             +T  +      +L      +P       +   G PV      + +   +  W        
Sbjct: 26284 ITVQDVTKESAVLS---WDVP-------ENDGGAPVKNY-HIEKREASKKAWVSVTNNCN 26332

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVT 1075
                  + N     I + R +     G   V +  E  E      +++ +KPSPP+ L VT
Sbjct: 26333 RLSYKVTNLQEGAIYYFRVSGENEFG---VGIPAETKEG-----VKITEKPSPPEKLGVT 26384

Query: 1076  DAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGY 1135
                  +V+L W  P+  G + +  Y V+  +K    W       + TH VV  L   + Y
Sbjct: 26385 SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVA-KSTHHVVSGLRENSEY 26443

Query: 1136  YFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAG 1195
             +FRVF++N  G SD       PV I       EPP    +D    PS T       V AG
Sbjct: 26444 FFRVFAENQAGLSDPRELLL-PVLIKEQ---LEPPE---IDMKNFPSHTV-----YVRAG 26491

Query: 1196  YTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRA 1255
                 +   + G P PK++  ++G+ L    RF        LT+ +++    D G Y   A
Sbjct: 26492 SNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITA 26551

Query: 1256  TNLQGEAR 1263
              N  G  +
Sbjct: 26552 ANSSGTTK 26559



 Score =  121 bits (304), Expect = 4e-27
 Identities = 84/310 (27%), Positives = 131/310 (42%), Gaps = 39/310 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             +T  + AG  L++++P+ G P P + W K                            D +
Sbjct: 24319 NTYSIQAGEDLKIEIPVIGRPRPNISWVK----------------------------DGE 24350

Query: 717   LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPA 776
              L +T  RV VE T   ++  ++   K+D G YTVT  N  G    NL+V V++ P  P 
Sbjct: 24351 PLKQTT-RVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPV 24409

Query: 777   AP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
              P +   V  D   + WEPPAY GG  I  YI+E++   +  W  ++   +   + +  +
Sbjct: 24410 GPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSAT-VARTTIKITK 24468

Query: 836   MIEGVVYEMRVYAVNAIGMSRPSPASQ-----PFMPIGPPSEPTHLAVEDVSDTTVSLKW 890
             +  G  Y+ R++A N  G S P  +       PF   GPP  P    V  +S   + ++W
Sbjct: 24469 LKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPF---VTSISKDQMLVQW 24525

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
               P   G   + GY +E   +    WV   +   + T      L  G    F+V A N+ 
Sbjct: 24526 HEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIV 24585

Query: 951   GPGAPVTTTE 960
             G G P   +E
Sbjct: 24586 GIGKPSKVSE 24595



 Score =  121 bits (304), Expect = 4e-27
 Identities = 89/349 (25%), Positives = 156/349 (44%), Gaps = 15/349 (4%)

Query: 738   VEGAEKEDEGVYTVTVKNPVG-----EDQVNLTVKV-IDVPDAPA-APKISNVGEDSCTV 790
             V+G ++  E  + V+ +N  G     + +  +T K  ++ P+ P+  P++ +V + S ++
Sbjct: 30289 VKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSL 30348

Query: 791   QWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVN 850
              W  P  DGG  + GY +ERK+  + +W+R N   I    +    ++    Y+ R+ A N
Sbjct: 30349 SWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQN 30408

Query: 851   AIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVE 907
              +G+S  SPAS+P +   P   PS+P  L +  +S  +V+L+W  PE  G   + GY VE
Sbjct: 30409 DVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVE 30468

Query: 908   YCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEI 967
             Y   G S W  + +   +     +  L       FRV A N  G   P  T   ++++  
Sbjct: 30469 YRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTA--MSIKTK 30526

Query: 968   LQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPT 1026
             L        R   + +  K+GE   L     G+P P + W + G+ L    +  + +   
Sbjct: 30527 LTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGR 30586

Query: 1027  DTILFIRAARRVHSGTYQ--VTVRIENMEDKATLVLQVVDKPSPPQDLR 1073
                L +    +   G Y    T  +  +E  + L+LQ   +  P   L+
Sbjct: 30587 THTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLK 30635



 Score =  121 bits (303), Expect = 5e-27
 Identities = 99/388 (25%), Positives = 160/388 (41%), Gaps = 45/388 (11%)

Query: 480   EGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELI 539
             E  Q KW+    E  RE  F  +   +G  +   +    L     ++  +      +++ 
Sbjct: 30865 EKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVP 30924

Query: 540   VQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDS-RIKVSHI-G 596
             +Q    +  + + +L V  +  A   C+V+      V W + GKE++ D  + ++    G
Sbjct: 30925 IQAPHFK--EELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKG 30982

Query: 597   RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIP 656
               H+L I  VT  D   Y         ++S     +EV++       P KIHL       
Sbjct: 30983 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTAS-LEVEV-------PAKIHLPKTLEGM 31034

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
               +  + G  + + +P SG P P + WQK                              +
Sbjct: 31035 GAVHALRGEVVSIKIPFSGKPDPVITWQKG-----------------------------Q 31065

Query: 717   LLCETEGRVRVETTKD-RSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAP 775
              L +  G  +V  T+   S+    G E++D G Y V  KN  G DQ  + + V DVPD P
Sbjct: 31066 DLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 31125

Query: 776   AAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
                K+S+V  DS  + W  PA DGG  I  YI+E+    + RW+R+     +E  +    
Sbjct: 31126 RGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVG--QARETRYTVIN 31183

Query: 836   MIEGVVYEMRVYAVNAIGMSRPSPASQP 863
             +     Y+ RV A N  G+S+PS  S+P
Sbjct: 31184 LFGKTSYQFRVIAENKFGLSKPSEPSEP 31211



 Score =  120 bits (301), Expect = 8e-27
 Identities = 94/330 (28%), Positives = 139/330 (42%), Gaps = 42/330 (12%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PPK  LD      D + + AG+ L LD  + G P P +IW K                  
Sbjct: 29043 PPKAELDARLH-GDLVTIRAGSDLVLDAAVGGKPEPKIIWTKG----------------- 29084

Query: 704   DTGDSDEWVFDKKL-LCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                       DK+L LCE   +V ++ T  R+   ++  ++ D G YT+TVKN  G   V
Sbjct: 29085 ----------DKELDLCE---KVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAV 29131

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
             ++ VKV+D P       +S V ++ CT+ W  P  DGG  I  YI+ER++     W+ + 
Sbjct: 29132 SVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVE 29191

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIG-----MSRPSPASQPFMPIGPPSEPTHLA 877
              +    LS+   R+I+   Y  RV AVN  G      S P  A   F    PP  P  + 
Sbjct: 29192 GE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVG 29250

Query: 878   VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH-TSILVKDLPT 936
                     + ++W  PE  G   +  Y V+   +    W    +    + T + V  L  
Sbjct: 29251 ---TGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 29307

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             G    FRV A N AG   P   +  ++ +E
Sbjct: 29308 GCDYQFRVTAVNAAGNSEPSEASNFISCRE 29337



 Score =  120 bits (300), Expect = 1e-26
 Identities = 207/954 (21%), Positives = 349/954 (36%), Gaps = 149/954 (15%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAK 418
            ++  +F KK++P+Y +  G   RL  +L      +V W KN +E+  S +  ++  + ++
Sbjct: 3734 REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMY-FVNSE 3792

Query: 419  RTLTISQCSLADDAAYQCV----VGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFE 474
              L I+   + D  +Y C     VG + CSTE+ +KEPP  I + LE   ++ G     +
Sbjct: 3793 AILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFI-KTLEPADIVRGTNALLQ 3851

Query: 475  CEVSEEGA-QVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQ 533
            CEVS  G  ++ W KD  ++   +  KYR         L I      D G Y  C    +
Sbjct: 3852 CEVSGTGPFEISWFKDKKQIRSSK--KYRLFSQKSLVCLEIFSFNSADVGEYE-CVVANE 3908

Query: 534  -----ALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDS 588
                  +A  +++E    V +    + +G +   +       E +   W+K  + +  D 
Sbjct: 3909 VGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDG 3968

Query: 589  RIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIH 648
            +IK+S    V  L I DV  +    Y+ + E  A +        +  +  +  +EP KI 
Sbjct: 3969 KIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGS--------QTSVGELIVKEPAKII 4020

Query: 649  LDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDS 708
                    + I V AG+   L+  ++G P     W K                     D 
Sbjct: 4021 -----ERAELIQVTAGDPATLEYTVAGTPELKPKWYK---------------------DG 4054

Query: 709  DEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
               V  KK         R+    + +      AE  D G YT  + N VG      T  V
Sbjct: 4055 RPLVASKK--------YRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTV 4106

Query: 769  IDVPDAPAAPK----ISNVGEDSCTVQWEPPAYDGGQPI-LGYILERKKKKSYRWMRLNF 823
            +D   AP   K    + +V   +C +  +     G  P+ + +  + K+  +    R+ F
Sbjct: 4107 LDRDIAPFFTKPLRNVDSVVNGTCRLDCK---IAGSLPMRVSWFKDGKEIAASDRYRIAF 4163

Query: 824  DLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV-- 881
             +    S E  R+           A N++G    S A    +   PPS  T    +DV  
Sbjct: 4164 -VEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGA---LIVQEPPSFVTKPGSKDVLP 4219

Query: 882  -----------SDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSIL 930
                         T ++++W    +    G   Y  +   E   E              L
Sbjct: 4220 GSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLE------------LYL 4267

Query: 931  VKDLPTGARLLFRVRAHNMAGP---GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
            VK   +G    +  +  N+AG     A +   EP T  E L+  +L            K 
Sbjct: 4268 VKTSDSGT---YTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQL-----------LKK 4313

Query: 988  GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNS--PTDTILFIRAARRVHSGTYQV 1045
            G+   L     G P  ++TW    + +  E    R S   +  +L +       SG Y  
Sbjct: 4314 GDATQLACKVTGTPPIKITWFANDREIK-ESSKHRMSFVESTAVLRLTDVGIEDSGEYMC 4372

Query: 1046 TVRIENMEDKATLVLQVVDKP------SPPQDLRVTDAWGLNVALEWKPPQDVGNTELWG 1099
              + E   D  + ++ V + P       P + L+  D   L   +   PP ++  T    
Sbjct: 4373 EAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVM-LLAEVAGTPPFEI--TWFKD 4429

Query: 1100 YTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVF 1159
             T+ ++ +K   +  + +H      +         Y  RV ++          T +EP  
Sbjct: 4430 NTILRSGRKYKTF--IQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREP-- 4485

Query: 1160 IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGL 1219
                                 PSF + + + S + G TA     ++GS    ++W K+  
Sbjct: 4486 ---------------------PSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSD 4524

Query: 1220 DLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
            ++ ED   RM  +  V +L +        G YVC+A N  G  RC   L V+ P
Sbjct: 4525 EITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEP 4578



 Score =  119 bits (298), Expect = 2e-26
 Identities = 80/274 (29%), Positives = 134/274 (48%), Gaps = 6/274 (2%)

Query: 365   FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
             F  KL+    V K   I L  E++  DA VKW K+G+EI+ S +  I ++ G KR L + 
Sbjct: 12020 FTGKLQDYTGVEKDEVI-LQCEISKADAPVKWFKDGKEIKPSKNAVI-KADGKKRMLILK 12077

Query: 425   QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
             +   +D   Y C  G +K S +L +++  + + RPL    VM  +   FE E+SE+    
Sbjct: 12078 KALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHA 12137

Query: 485   KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
              W   G  L   +T     K++G+ H L+++   L+  G      +  ++ A L V+ + 
Sbjct: 12138 NWKLKGEALL--QTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRV 12195

Query: 545   LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
             + + + + D+ V A + A F CE+S E++   W   GK+L P  ++     G+VH LT+ 
Sbjct: 12196 IGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLR 12255

Query: 605   DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDF 638
             DV   D  +     + F  +  A L   E  ++F
Sbjct: 12256 DVKLEDAGEVQLTAKDFKTH--ANLFVKEPPVEF 12287



 Score =  119 bits (297), Expect = 2e-26
 Identities = 81/306 (26%), Positives = 131/306 (42%), Gaps = 39/306 (12%)

Query: 661   VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE 720
             V  G  L+++VPISG P PT+ W K                            D   L +
Sbjct: 23241 VQVGQDLKIEVPISGRPKPTITWTK----------------------------DGLPLKQ 23272

Query: 721   TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP-K 779
             T  R+ V  + D +  +++   K+D G Y +TV N VG+   ++ +  +D PD P  P K
Sbjct: 23273 TT-RINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVK 23331

Query: 780   ISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEG 839
               +V  +S T+ W PP Y GG  I  YI++++   +  W  ++   +   + +  ++  G
Sbjct: 23332 FDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLKTG 23390

Query: 840   VVYEMRVYAVNAIGMS-----RPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPE 894
               Y+ R++A N  G S      P  A  P+   GPP  P   A+   S  ++ ++W  P 
Sbjct: 23391 TEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAI---SKDSMVIQWHEPV 23447

Query: 895   RVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGA 954
               G   + GY +E        W    + +   T    ++L  G    FRV A N+ G G 
Sbjct: 23448 NNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGK 23507

Query: 955   PVTTTE 960
                 +E
Sbjct: 23508 ASKNSE 23513



 Score =  118 bits (295), Expect = 4e-26
 Identities = 86/275 (31%), Positives = 130/275 (47%), Gaps = 7/275 (2%)

Query: 365   FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
             F  KL     V K  +I L  E++  D  VKW K+G+EI  S  KY  ++ G +R L I 
Sbjct: 11665 FTVKLHDKTAVEKD-EITLKCEVSK-DVPVKWFKDGEEIVPS-PKYSIKADGLRRILKIK 11721

Query: 425   QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
             +  L D   Y C  G +K    + V+   + + +PL    V VG+   FE E+SE     
Sbjct: 11722 KADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHG 11781

Query: 485   KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
             +W   G  LT     +    +DG++H LI++   L   G  +   +  ++ A L V+E  
Sbjct: 11782 QWKLKGQPLTASPDCE--IIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELP 11839

Query: 545   LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
             L     ++D+ V  KD+A F+CEVS E     WLK  +E+  D R ++   G  H + I 
Sbjct: 11840 LIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIK 11899

Query: 605   DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFV 639
                  DEA Y F  E    + S KL    +++ F+
Sbjct: 11900 SAAFEDEAKYMFEAED--KHTSGKLIIEGIRLKFL 11932



 Score =  117 bits (294), Expect = 5e-26
 Identities = 82/248 (33%), Positives = 119/248 (47%), Gaps = 8/248 (3%)

Query: 386  ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCST 445
            E++  +    WLKNG EI+MS  K+     G    L I   S  D A Y  V G ++ S 
Sbjct: 2904 EVSHFNVPSMWLKNGVEIEMS-EKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSA 2962

Query: 446  ELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKK 505
             L V   P++IT  L+D        + FE  V+ EG   KWLK+GVE+   +  + R KK
Sbjct: 2963 TLTVT--PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK 3020

Query: 506  DGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFK 565
                H L I      DA  Y        + A L V+ + +E  + I D+ V  K +A+F+
Sbjct: 3021 --LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFE 3078

Query: 566  CEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNL 625
            CEVS+ ++   W+K+ +EL    RIK+     VH+L I     +D   Y+ V  G   N+
Sbjct: 3079 CEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG---NV 3135

Query: 626  SAKLHFME 633
            S    F+E
Sbjct: 3136 STAKLFVE 3143



 Score =  117 bits (294), Expect = 5e-26
 Identities = 76/266 (28%), Positives = 117/266 (43%), Gaps = 7/266 (2%)

Query: 370   EPAY--QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCS 427
             +P Y  +V  G      +EL++ D   +W   GQ +  S    I E  G K  L +  C 
Sbjct: 11755 KPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIED-GKKHILILHNCQ 11813

Query: 428   LADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWL 487
             L             K +  L VKE P++   PL D  V      +FECEVS E    +WL
Sbjct: 11814 LGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWL 11873

Query: 488   KDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEV 547
             K   E+T ++ F+    KDG +H ++I  A  ED   Y           +LI++  +L+ 
Sbjct: 11874 KGTQEITGDDRFE--LIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKF 11931

Query: 548   YQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVT 607
                + D+    K+ AVF  E+S +N+R  W KN + L     + +   G+ H +T  D++
Sbjct: 11932 LTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLS 11991

Query: 608   PADEADYSFVPEGFACNLSAKLHFME 633
               D +      E    +  AKL  +E
Sbjct: 11992 IDDTSQIRV--EAMGMSSEAKLTVLE 12015



 Score =  116 bits (291), Expect = 1e-25
 Identities = 216/935 (23%), Positives = 344/935 (36%), Gaps = 128/935 (13%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADH-DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTI 423
            F KKLEP+  V +    R   ++    + +V W K+  EIQ S SK+    + +   L +
Sbjct: 7307 FIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQES-SKFRMSFVDSVAVLEM 7365

Query: 424  SQCSLADDAAYQC----VVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSE 479
               S+ D   Y C      G    ST L VKEPP+   +P   +  + G  V  ECE+  
Sbjct: 7366 HNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIE-TLKGADVHLECELQG 7424

Query: 480  EGA-QVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHY---ALCTSGGQAL 535
                 V W KD  EL   + +K   +      H++  +A   D G Y   A    G    
Sbjct: 7425 TPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAA--DIGEYQCKATNDVGSDTC 7482

Query: 536  AELIVQEKKLEVYQSIADL--MVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDS-RIKV 592
               I  +      + ++D+  +VG + Q     E + E +  VW K+  E+V +S  I +
Sbjct: 7483 VGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGA-EPISVVWFKDKGEIVRESDNIWI 7541

Query: 593  SHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCP 652
            S+   +  L    V PA+   Y+       C +       E     +   EP  I     
Sbjct: 7542 SYSENIATLQFSRVEPANAGKYT-------CQIKNDAGMQEC-FATLSVLEPATIV---- 7589

Query: 653  GRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWV 712
               P++I V  G+   L+  ++G P  +  W K              D  E T D+    
Sbjct: 7590 -EKPESIKVTTGDTCTLECTVAGTPELSTKWFK--------------DGKELTSDN---- 7630

Query: 713  FDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID-- 770
                       + ++      S   +      D GVY+  V+NPVG+D    +++V D  
Sbjct: 7631 -----------KYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRT 7679

Query: 771  VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI-LGYILERKKKKSYRWMRLNFDLIQEL 829
            VP +         G    +V  E   Y G  PI + +  E  +  S R  +    L    
Sbjct: 7680 VPPSFTRKLKETNGLSGSSVVMECKVY-GSPPISVSWFHEGNEISSGR--KYQTTLTDNT 7736

Query: 830  SHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPS---EPTHLAVEDVSDTTV 886
                  M+E    +   Y   A  M+     S P     PPS   +P  + V   ++ T 
Sbjct: 7737 CALTVNMLEES--DSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTF 7794

Query: 887  S--LKWRPPERVG--AGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
            +  +K  PP  V    G  +    + C     + VA L+         + D+ T     +
Sbjct: 7795 TSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELE---------LFDVDTSQSGEY 7845

Query: 943  RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
                 N AG  +        T    ++ P   + R    +I+K  G+P+ L   F G P 
Sbjct: 7846 TCIVSNEAGKAS-------CTTHLYIKAPAKFVKRLNDYSIEK--GKPLILEGTFTGTPP 7896

Query: 1003 PQVTWTKEGQPLA-GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQ 1061
              VTW K G  +   +  +I  +    IL I ++    +G Y   +   + +D  +  + 
Sbjct: 7897 ISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQIL 7956

Query: 1062 VVDKPS-----PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
            +++ P       P  + V D+  L   L        G  E+ G +  K D K     T  
Sbjct: 7957 ILEPPYFVKQLEPVKVSVGDSASLQCQL-------AGTPEI-GVSWYKGDTKLRPTTTYK 8008

Query: 1117 EHYRRTHC--VVPELIIGNGYYFRVFSQNMVG-FSDRAATTKEPVFIPRPGITYEPPNYK 1173
             H+R      V  ++ I +   +   ++N VG  S     T +   +P            
Sbjct: 8009 MHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLP------------ 8056

Query: 1174 ALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQ 1233
                   PSF++ L +     G   +  CA+ GS    +SW+K+G  L +    +     
Sbjct: 8057 -------PSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLD 8109

Query: 1234 GVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRL 1268
               TL I K      G Y C ATN  G A    RL
Sbjct: 8110 NTATLNIFKTDRSLAGQYSCTATNPIGSASSSARL 8144



 Score =  115 bits (289), Expect = 2e-25
 Identities = 84/310 (27%), Positives = 138/310 (44%), Gaps = 12/310 (3%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKR 419
            K+   F ++L+      K        E ++   +VKW K+G E+   G KY   S     
Sbjct: 2171 KQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVH-EGDKYRMHSDRKVH 2229

Query: 420  TLTISQCSLADDAAYQCVVGGE---KCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECE 476
             L+I     +D   Y CV+  +   K + +L V+   V   + L+D  V      E EC 
Sbjct: 2230 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2289

Query: 477  VSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALA 536
            VS E  + KW  + VEL  +   KY       R +L + +   ED G Y+    G +   
Sbjct: 2290 VSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTC 2347

Query: 537  ELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIG 596
            +L ++ + + + Q ++D  V   D    + +VS E+V GVW+K+G+E+ P  R+ +    
Sbjct: 2348 KLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDK 2407

Query: 597  RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQ-----EPPKIHLDC 651
            + H L I+D+T  D  +YSF       + S ++    V +   P +     E  K  L+C
Sbjct: 2408 QSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV-ITPLKDVNVIEGTKAVLEC 2466

Query: 652  PGRIPDTIVV 661
               +PD   V
Sbjct: 2467 KVSVPDVTSV 2476



 Score =  114 bits (285), Expect = 6e-25
 Identities = 99/408 (24%), Positives = 161/408 (39%), Gaps = 59/408 (14%)

Query: 649   LDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDS 708
             +D P    + +   AG  ++L   ISG PAPT+ W K                       
Sbjct: 26872 IDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKD---------------------- 26909

Query: 709   DEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
                  DK+L  +T   V VE T D +   ++ A++ + G Y + ++N +G     + V++
Sbjct: 26910 -----DKEL--QTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQI 26962

Query: 769   IDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQ 827
             +D P  P  P +   V  +  T+ W PPA DGG  I  YI+E+++     W  ++ + ++
Sbjct: 26963 LDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVS-EHLE 27021

Query: 828   ELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP-----ASQPFMPIGPPSEPTHLAVEDVS 882
             E      ++I+G  Y  RV AVN  G+  P       A   F+  GPP  P    V  ++
Sbjct: 27022 ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIP---EVTKIT 27078

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
               ++++ W  P   G   + GY +E   +    W   L+     T   V  L   +   +
Sbjct: 27079 KNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQY 27138

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV A N AG G     +E     + +  P                G P  + I    K  
Sbjct: 27139 RVCAVNAAGQGPFSEPSEFYKAADPIDPP----------------GPPAKIRIADSTKSS 27182

Query: 1003  PQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT 1046
               + W+K     G  + G  V IR    +    +     V +  Y V+
Sbjct: 27183 ITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVS 27230



 Score =  113 bits (283), Expect = 1e-24
 Identities = 256/1163 (22%), Positives = 416/1163 (35%), Gaps = 177/1163 (15%)

Query: 157  FVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRA 216
            FV  P+  EV  G ++TF++ + G    K   V WF+G    +    G    ++   D  
Sbjct: 5895 FVKEPEPLEVLPGKNVTFTSVIRGTPPFK---VNWFRGARELVK---GDRCNIYFE-DTV 5947

Query: 217  SKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSL 276
            +++ LF + I+ +     G Y C VS           L V E         L      S+
Sbjct: 5948 AELELFNIDISQS-----GEYTCVVSNNAGQASCTTRLFVKEPAA-----FLKRLSDHSV 5997

Query: 277  AGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEED--VWEILRQAPPSEYE 334
              G   I +S   TG L  S   KK D F      K      E   + EIL        +
Sbjct: 5998 EPGKSIILESTY-TGTLPISVTWKK-DGFNITTSEKCNIVTTEKTCILEILNST-----K 6050

Query: 335  RIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADH-DAE 393
            R A QY         + + G      +   F  +LEP  + + G  + L  ++A   +  
Sbjct: 6051 RDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPL-EAAVGDSVSLQCQVAGTPEIT 6109

Query: 394  VKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELFV 449
            V W K   +++ +  +Y         TL  ++ ++ D   Y C     +G     T   +
Sbjct: 6110 VSWYKGDTKLRPT-PEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRI 6168

Query: 450  KEP--PVLITRPLEDQLVMVGQRVEFECEVSEEGA-QVKWLKDGVELTREETFKYRFKKD 506
            +E   P    R L+D    VG  V   C ++     QV W +DGV L  +E  +  F  +
Sbjct: 6169 QERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDN 6228

Query: 507  GQRHHLIINEAMLEDAGHYALCTSG----GQALAELIVQEKKLEVYQSIADLMVG--AKD 560
                 L I +  L  +G Y+   S       + A L  +E K   +  I  + +   A +
Sbjct: 6229 VAT--LKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGE 6286

Query: 561  QAVFKCEVSD-ENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPE 619
             A F+C V+  + +R  W K+ KE+ P     ++ +G    L I  V   D   Y+    
Sbjct: 6287 SADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQAT 6346

Query: 620  GFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAP 679
                ++   +   ++ +     +EPPK       ++  + V   G  ++L+  ISG P  
Sbjct: 6347 N---DVGKDMCSAQLSV-----KEPPKF----VKKLEASKVAKQGESIQLECKISGSPEI 6394

Query: 680  TVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE 739
             V W +                  D+   + W ++   +               ++ T+ 
Sbjct: 6395 KVSWFR-----------------NDSELHESWKYNMSFI------------NSVALLTIN 6425

Query: 740  GAEKEDEGVYTVTVKNPVGEDQVN--LTVKVIDVPDAPAAPKISNVGED---SCTVQWEP 794
             A  ED G Y     N VG+   +  LTVK   V     +P  +  G D    C +   P
Sbjct: 6426 EASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTP 6485

Query: 795  PAYDGGQPILGYILERKK---KKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYAVN 850
            P        + ++ +RK+    K ++    +FD  +  L+ EA       V E    A N
Sbjct: 6486 PFE------VVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEA-----SDVGEYHCKATN 6534

Query: 851  AIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
             +G S     S  F       EP    V+ +SDT+  +      R    G    SV +  
Sbjct: 6535 EVG-SDTCSCSVKF------KEPPRF-VKKLSDTSTLIGDAVELRAIVEGFQPISVVWLK 6586

Query: 911  ---EGCSEWVAALQGLTEHTSILVKDLPTGARL-LFRVRAHNMAGP---GAPVTTTEPVT 963
               E   E         ++ + L    P  +    +  +  N AG     A +T  EP  
Sbjct: 6587 DRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPA- 6645

Query: 964  VQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE---EVS 1020
               I+++P         + +    G P  L     G P     W K+G+ L+ +    ++
Sbjct: 6646 --RIIEKP---------EPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHIT 6694

Query: 1021 IRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLR----VTD 1076
              N      L I  A     G Y   V+    +   T+ + V D+  PP  +R    V  
Sbjct: 6695 FINKVAS--LKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNA 6752

Query: 1077 AWGLNVALEWKPPQDVGNTELW---GYTVQKADKKTMEWFTVLEHYRRTHCVVPELII-- 1131
              G +V LE +       +  W   G  +    K           +    C +   ++  
Sbjct: 6753 ILGASVVLECRVSGSAPISVGWFQDGNEIVSGPK-------CQSSFSENVCTLNLSLLEP 6805

Query: 1132 -GNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNR 1190
               G Y  V + N+ G  + +A                      L   E PSF Q   + 
Sbjct: 6806 SDTGIYTCV-AANVAGSDECSA---------------------VLTVQEPPSFEQTPDSV 6843

Query: 1191 SVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGI 1250
             V+ G +      +RG+P  K+ WFK   +L       +  +  V  LE+ +  P + G 
Sbjct: 6844 EVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGD 6903

Query: 1251 YVCRATNLQGEARCECRLEVRVP 1273
            Y C  TN  G A C   L V+ P
Sbjct: 6904 YSCLVTNDAGSASCTTHLFVKEP 6926



 Score =  112 bits (281), Expect = 2e-24
 Identities = 106/428 (24%), Positives = 172/428 (40%), Gaps = 58/428 (13%)

Query: 867   IGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
             IG P+ P   L  +D+   +V + WRPP   G   + GY +E      + W   +     
Sbjct: 30225 IGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYT-IDSRVR 30283

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
              TS++VK L       FRV A N  G   P+ + EPVT +  L  P  + P +  + +  
Sbjct: 30284 GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPP--EPPSNPPEVLDV 30341

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAAR-RVHS 1040
                           K    ++W++     G  + G  +  + + TD   ++R  + ++ +
Sbjct: 30342 T-------------KSSVSLSWSRPKDDGGSRVTGYYIERKETSTDK--WVRHNKTQITT 30386

Query: 1041  GTYQVTVRIENMEDKATLVLQ-------------------VVDKPSPPQDLRVTDAWGLN 1081
               Y VT  + + E +  ++ Q                     DKPS P +L +      +
Sbjct: 30387 TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDS 30446

Query: 1082  VALEWKPPQDVGNTELWGYTVQKADKKTMEWF-TVLEHYRRTHCVVPELIIGNGYYFRVF 1140
             V L+W+ P+  G  E+ GY V+        W  +  E  +     +  L+    Y FRVF
Sbjct: 30447 VTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVF 30506

Query: 1141  SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200
             ++N  G S             RP  T      K L   EAP   + + + +   G  A L
Sbjct: 30507 AENETGLS-------------RPRRTAMSIKTK-LTSGEAPGIRKEMKDVTTKLGEAAQL 30552

Query: 1201  CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
              C + G P P I W++ G +L +  +++M S     TL +      D G+Y C ATN  G
Sbjct: 30553 SCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVG 30612

Query: 1261  EARCECRL 1268
             E     +L
Sbjct: 30613 EVETSSKL 30620



 Score =  112 bits (280), Expect = 2e-24
 Identities = 127/527 (24%), Positives = 203/527 (38%), Gaps = 79/527 (14%)

Query: 769   IDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFD-LIQ 827
             I  P  P  PK+ +   ++  + W  P  DGG PILGY++E +K  + +W R+N D LI+
Sbjct: 17801 IKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIR 17860

Query: 828   ELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPPSEPTHLAVEDVSDT 884
             + +     +IEG  Y  R+ A N +G   P   ++  +    + PP     +   DV   
Sbjct: 17861 QCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITV 17920

Query: 885   TVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI-LVKDLPTGARLLFR 943
              V    R   RV             PE    W    + L     + L++DLP   R+  +
Sbjct: 17921 RVGQTIRILARVKGR----------PEPDITWTKEGKVLVREKRVDLIQDLP---RVELQ 17967

Query: 944   VRAHNMAGPGAPVTTTEPVT-------VQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             ++    A  G  + + +  +       +  +L RP                G   NL + 
Sbjct: 17968 IKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRP----------------GPCQNLKVT 18011

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNS--------PTDTILFIRAARRVHSGTYQ 1044
                K    ++W       G  +    V  R           +D    +  A  + +  Y 
Sbjct: 18012 NVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYY 18071

Query: 1045  VTVRIEN-------MEDKAT-LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               V  EN       +E K   L +  +D+P  P++L + D     V L+W+ P   G + 
Sbjct: 18072 FRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSP 18131

Query: 1097  LWGYTVQKADKKTMEWFTVLE-HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK 1155
                Y V++  K + +W  V +   + TH +V   +    Y FRV ++N  G SD   T +
Sbjct: 18132 NLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEE 18191

Query: 1156  EPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWF 1215
                      +  E      LD   +   T       V AG T  L   VRG P P+++W 
Sbjct: 18192 V--------VVKEDLQKPVLDLKLSGVLT-------VKAGDTIRLEAGVRGKPFPEVAWT 18236

Query: 1216  --KNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
               K+  DL    R ++ ++       + K    DGG YV  ATN  G
Sbjct: 18237 KDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG 18283



 Score =  110 bits (274), Expect = 1e-23
 Identities = 148/625 (23%), Positives = 238/625 (38%), Gaps = 79/625 (12%)

Query: 684   QKAITQGNKAPARPAPDAPEDTGDS-DEWVFDKKLLCETEGRVRVETTKD--------RS 734
             Q  +T+  K  A    + P D G     ++ +K+   ET  +     TKD        R 
Sbjct: 17017 QPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR---ETMSKRWARVTKDPIHPYTKFRV 17073

Query: 735   IFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDV------PDAPAAPKISNVGEDSC 788
                +EG + E    + V+ +N +G    +   K +        P  P  P+  +   +S 
Sbjct: 17074 PDLLEGCQYE----FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 17129

Query: 789   TVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF--DLIQELSHEARRMIEGVVYEMRV 846
              + W+PP +DGG  ILGYI+E +K     W R N   +   E  ++   + +G  Y+ RV
Sbjct: 17130 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRV 17189

Query: 847   YAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSV 906
              AVNA G S P+   +P + +    EP  L ++        +K     R+ A       +
Sbjct: 17190 LAVNAAGESDPAHVPEPVL-VKDRLEPPELILDANMAREQHIKVGDTLRLSA------II 17242

Query: 907   EYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             +  P     W    +     T   +   P G++L  R  AH   G  + +T   P   + 
Sbjct: 17243 KGVPFPKVTW--KKEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYS-LTVENPAGSKT 17299

Query: 967   ILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIR 1022
             +           ++  +  K G P +L +    K    +TW +     G  +    V  R
Sbjct: 17300 V----------SVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERR 17349

Query: 1023  N------SPTDTILFIRA--ARRVHSGT-YQVTVRIENMEDKATLV--------LQVVDK 1065
             +      SP       ++  A+ ++ G  Y   V  EN   +   V        L  +  
Sbjct: 17350 DVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 17409

Query: 1066  PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCV 1125
             P PP+DL   D     V+L W  P   G + + GY V+  ++ T +W    +      CV
Sbjct: 17410 PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-FKTVTNLECV 17468

Query: 1126  VPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQ 1185
             V  L  G  Y FRV ++N+VG       T  P+      +   PP+ + LD        +
Sbjct: 17469 VTGLQQGKTYRFRVKAENIVGLG--LPDTTIPIECQEKLV---PPSVE-LDV----KLIE 17518

Query: 1186  PLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCP 1245
              LV   V AG T      +RG P P   W  +G ++  D  + + +      L I+    
Sbjct: 17519 GLV---VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 17575

Query: 1246  FDGGIYVCRATNLQGEARCECRLEV 1270
              D G Y    +N  G       L V
Sbjct: 17576 RDTGEYQITVSNAAGSKTVAVHLTV 17600



 Score =  109 bits (272), Expect = 2e-23
 Identities = 185/803 (23%), Positives = 284/803 (35%), Gaps = 153/803 (19%)

Query: 542   EKKLEVYQSIADLMVGAKDQAVFK-CEVSDENVRGVWLKN--GKELVPDSRIKVSHIGRV 598
             +K+L++ + ++    G +  AV K C+ SD     + +KN  G + V      +   G  
Sbjct: 29085 DKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC 29144

Query: 599   HKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIH-LDCPGRIPD 657
              KLT+  VT              A +L  +    E+    V R+E  +++ +   G  P 
Sbjct: 29145 GKLTVSRVTQEKCT--------LAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPT 29196

Query: 658   TIVVV--------------AGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
                VV              A NK    VP+  +P         I   N       P  PE
Sbjct: 29197 LSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEP---------IVARNSFTIPSPPGIPE 29247

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVET----------------TKDRSIFT--------VE 739
             + G   E +  +    E++G   +                   KD  ++         +E
Sbjct: 29248 EVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 29307

Query: 740   GAEKEDEGVYTVTVKNPVGEDQVNLTVKVID------VPDAPAAPKISNVGEDSCTVQWE 793
             G + +    + VT  N  G  + +     I        P  P+AP++ +  + S ++ W 
Sbjct: 29308 GCDYQ----FRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWT 29363

Query: 794   PPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYAVNAI 852
              P YDGG  I+GY+LE ++K + +W R++ +  I+        +  G  Y  RV AVN  
Sbjct: 29364 KPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVK 29423

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT-----------VSLKWRPPERVGAGGL 901
             GMS  S +     P+     P     +D+  T            VS+  RPP        
Sbjct: 29424 GMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPP------- 29476

Query: 902   DGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL-LFRVRAHNMAGPGAPVTTTE 960
                 + +  +G      A+   TE  S+L+ D         + + A N +G  +     +
Sbjct: 29477 ---VITWSKQGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 29533

Query: 961   PVTVQEILQRPRLQLPRHLRQTIQKKV-----GEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
                        +++       TI  ++     G PVN  I  +          +E    A
Sbjct: 29534 VYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEK----------REAAMRA 29583

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM--------EDKATLVLQVVDKPS 1067
              + V+ + S T      R +  V    Y   V  EN+           A LV +V   P 
Sbjct: 29584 FKTVTTKCSKT----LYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEV---PL 29636

Query: 1068  PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWF-------TVLEHYR 1120
              P  L V D     V L W+ P   G + L GY ++     T  W        TVLEH  
Sbjct: 29637 VPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEH-- 29694

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
                  V  L  G  Y FR+ +QN  G S+           PR  +T         D    
Sbjct: 29695 ----TVTSLNEGEQYLFRIRAQNEKGVSE-----------PRETVTA----VTVQDLRVL 29735

Query: 1181  PSF---TQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             P+    T P     V AG    L   + G P P  SWF  G  L E  R  + +   V  
Sbjct: 29736 PTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAK 29795

Query: 1238  LEIRKPCPFDGGIYVCRATNLQG 1260
             L IR+    D G Y     N+ G
Sbjct: 29796 LTIRETTIRDTGEYTLELKNVTG 29818



 Score =  108 bits (270), Expect = 3e-23
 Identities = 83/275 (30%), Positives = 134/275 (48%), Gaps = 11/275 (4%)

Query: 374   QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
             ++ +G K      ++     V+W ++ + ++ SG KY   + G KR L +   +L D   
Sbjct: 12562 EILEGEKAEFVCSISKESFPVQWKRDDKTLE-SGDKYDVIADGKKRVLVVKDATLQDMGT 12620

Query: 434   YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
             Y  +VG  + +  L V E  + I  PL+D  V   Q V F CEV+ EGA+ KW ++  E 
Sbjct: 12621 YVVMVGAARAAAHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRN--EE 12677

Query: 494   TREETFKYRFKKDGQRHHLIINEAMLEDAGHY--ALCTSGGQ---ALAELIVQEKKLEVY 548
                ++ KY   +    + L I +A L+D  +Y  +L    G+   + A LIV+E+ L + 
Sbjct: 12678 AIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIV 12737

Query: 549   QSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTP 608
             + + D+    K    F C+V+  NV   W KNG+E+  D+R+        H LTI D   
Sbjct: 12738 EPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGF 12797

Query: 609   ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE 643
              DE +Y  V  G   ++ A+L  +E   +FV   E
Sbjct: 12798 PDEGEY-IVTAGQDKSV-AELLIIEAPTEFVEHLE 12830



 Score =  107 bits (268), Expect = 6e-23
 Identities = 72/235 (30%), Positives = 117/235 (49%), Gaps = 8/235 (3%)

Query: 384  TVELADHDAE-VKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEK 442
            TVEL   + + V+W+KNG  ++ S  KY     G   +L I  C++ D++ Y   +G   
Sbjct: 2727 TVELTHPNVKGVQWIKNGVVLE-SNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2785

Query: 443  CSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYR 502
             S  L V+   V I +  +D   +    V FE  VS +   VKW    VE+   +  K+R
Sbjct: 2786 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSD--KHR 2841

Query: 503  FKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQA 562
               + + H L++      DAG Y       +  A+L V+   L + +++ ++ V     A
Sbjct: 2842 LVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVET--LHITKTMKNIEVPETKTA 2899

Query: 563  VFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV 617
             F+CEVS  NV  +WLKNG E+    + K+   G++H+L I + +  D A+Y+FV
Sbjct: 2900 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV 2954



 Score =  107 bits (268), Expect = 6e-23
 Identities = 98/412 (23%), Positives = 161/412 (39%), Gaps = 41/412 (9%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P ++   DV+   +++ W+PP+  G   +  Y VE        W     G ++ T
Sbjct: 17605 GPPTGPINIL--DVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSK-T 17661

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
              + +  L  G   +FRVRA N  G G P+ +T  V       + +   P    + +   +
Sbjct: 17662 KLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVA------KHKFSPPSPPGKPVVTDI 17715

Query: 988   GE---PVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
              E    V+  +P      P   +  E + + G+ V +  +P   + F R        TY+
Sbjct: 17716 TENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKF-RVTGLYEGNTYE 17774

Query: 1045  VTVRIENM--------EDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               V  EN+                + +  P PP + ++ D       L W  P   G + 
Sbjct: 17775 FRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSP 17834

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCV--VPELIIGNGYYFRVFSQNMVGFSDRAATT 1154
             + GY V+     T +W  + +      C   VP LI GN Y FR+ + N+VG  +     
Sbjct: 17835 ILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELA 17894

Query: 1155  KEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIA---GYTAMLCCAVRGSPKPK 1211
             +  +               A D    P     +  R VI    G T  +   V+G P+P 
Sbjct: 17895 ESVI---------------AKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPD 17939

Query: 1212  ISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             I+W K G  L  + R  +      + L+I++    D G Y+  A N  G A+
Sbjct: 17940 ITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 17991



 Score =  106 bits (265), Expect = 1e-22
 Identities = 124/571 (21%), Positives = 216/571 (37%), Gaps = 99/571 (17%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLT---VKVIDV---PDAPAAPKISNVGEDSCT 789
             + V G  +  E  + +  +N  G    + T    K  D    P  P  P++ +    S +
Sbjct: 21714 YKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSIS 21773

Query: 790   VQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYA 848
             + W  P YDGG  I GY++E    +   W  +     ++  S+    + E   Y++R+YA
Sbjct: 21774 IAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYA 21833

Query: 849   VNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT----------------VSLKWRP 892
             +N+ G+  P+      +P  P +E   L  E   D                  V +K RP
Sbjct: 21834 MNSEGLGEPA-----LVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRP 21888

Query: 893   PERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGP 952
                V      G S++          A+++  + +T ++V ++       + +   N +G 
Sbjct: 21889 APEVKWARDHGESLDK---------ASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGS 21939

Query: 953   GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQ 1012
              +            +L  P                G P +L +    K    +TW     
Sbjct: 21940 KSAFVNVR------VLDTP----------------GPPQDLKVKEVTKTSVTLTWDP--- 21974

Query: 1013  PLAGEEVSIRNSPTDTILFIRAA-RRVHSGTYQVTVRIENMEDKATLVLQVV-------- 1063
             PL      I+N   +     R A   V +  ++ + +++ +++  +   +V+        
Sbjct: 21975 PLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIG 22034

Query: 1064  ------------DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTME 1111
                         ++P PP  + + D    +V+L W+ P+  G + + GY V+   K + +
Sbjct: 22035 LPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDK 22094

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPN 1171
             W T     + T   +  LI G  Y FRV +QN  G SD       P  +  P I      
Sbjct: 22095 WATCAT-VKVTEATITGLIQGEEYSFRVSAQNEKGISD-------PRQLSVPVI------ 22140

Query: 1172  YKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFS 1231
               A D    P+F       +V+AG    +     G P P ++W K+ + L +  R    S
Sbjct: 22141 --AKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAES 22198

Query: 1232  KQGVLTLEIRKPCPFDGGIYVCRATNLQGEA 1262
              +    L I+  C  D G YV + TN  GEA
Sbjct: 22199 TENNSLLTIKDACREDVGHYVVKLTNSAGEA 22229



 Score =  105 bits (263), Expect = 2e-22
 Identities = 87/330 (26%), Positives = 141/330 (42%), Gaps = 40/330 (12%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP I L    R  DTI V AG  + +   ++G P P + W K     N+       DA +
Sbjct: 15394 PPTIKLRLSVR-GDTIKVKAGEPVHIPADVTGLPMPKIEWSK-----NETVIEKPTDALQ 15447

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
              T +                   V  ++ ++  ++  A +ED+G YTVT  N +G    N
Sbjct: 15448 ITKEE------------------VSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRN 15489

Query: 764   LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERK--KKKSYRWMRL 821
             + V+V D P  P    ++++  +SC + W+ P  +GG  I  Y+++++   +K   W  +
Sbjct: 15490 VHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEV 15549

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ-----PFMPIGPPSEPTHL 876
                 + E  +   ++I    YE RV AVN  G+S    + +     P+   GPP +P  L
Sbjct: 15550 TNTAV-EKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVL 15608

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSIL-----V 931
             A    +  ++ + W PP   G   + GY +E   EG   W    +       +      V
Sbjct: 15609 A---RTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNV 15665

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEP 961
               L  G +  FR  A N AG G P   ++P
Sbjct: 15666 PRLLEGVKYQFRAMAINAAGIGPPSEPSDP 15695



 Score =  105 bits (263), Expect = 2e-22
 Identities = 85/322 (26%), Positives = 132/322 (40%), Gaps = 40/322 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             D +++ +G  LR+   + G P P V W K    G                          
Sbjct: 27966 DGLIIKSGESLRIKALVQGRPVPRVTWFK---DG-------------------------- 27996

Query: 717   LLCETEGRVRVETTK---DRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPD 773
                E E R+ +E T      S+F V  A ++  GVYTV  KN  G  +  + VKV D P 
Sbjct: 27997 --VEIEKRMNMEITDVLGSTSLF-VRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPG 28053

Query: 774   APAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHE 832
                 P + +N+  +  T+ W+ P  DG  PI  YI+E+++     W  +  D  +  S+ 
Sbjct: 28054 KVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYT 28112

Query: 833   ARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPI--GPPSEPTHLAVEDVSDTTVSLKW 890
             A ++I G  Y+ RV AVN  G+ RP  +      I    P  P      +++  +++L W
Sbjct: 28113 AIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTW 28172

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAAL-QGLTEHTSILVKDLPTGARLLFRVRAHNM 949
               PE  G   +  Y +E   +  + WV  + +     T   V  L  G    F V A N 
Sbjct: 28173 ARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENA 28232

Query: 950   AGPGAPVTTTEPVTVQEILQRP 971
             AG G     +  +  +E +  P
Sbjct: 28233 AGVGPASGISRLIKCREPVNPP 28254



 Score =  105 bits (262), Expect = 3e-22
 Identities = 207/979 (21%), Positives = 352/979 (35%), Gaps = 183/979 (18%)

Query: 354  GMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVK--------WLKNGQEIQM 405
            G      + TA + K  P + +       +  E AD +  V         W K+ +EI+ 
Sbjct: 6254 GTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRP 6313

Query: 406  SGSKYIFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELFVKEPPVLITRPLE 461
             G+ Y    +G    L I +    D   Y C     VG + CS +L VKEPP  + +   
Sbjct: 6314 GGN-YTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEA 6372

Query: 462  DQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLE 520
             ++   G+ ++ EC++S     +V W ++  EL   E++KY          L INEA  E
Sbjct: 6373 SKVAKQGESIQLECKISGSPEIKVSWFRNDSEL--HESWKYNMSFINSVALLTINEASAE 6430

Query: 521  DAGHYALCTSG---GQALAELIVQEKKLEVYQSIADLMVGAK-DQAVFKCEVS-DENVRG 575
            D+G Y +C +    G A     +  K   V+      +   K    + +CE+S       
Sbjct: 6431 DSGDY-ICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEV 6489

Query: 576  VWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPE----GFACNLSAKLHF 631
            VW+K+ K++    + K++       L I ++  +D  +Y            C+ S K   
Sbjct: 6490 VWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKF-- 6547

Query: 632  MEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGN 691
                      +EPP+       ++ DT  ++ G+ + L   + G    +V+W K      
Sbjct: 6548 ----------KEPPRF----VKKLSDTSTLI-GDAVELRAIVEGFQPISVVWLK------ 6586

Query: 692  KAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTV 751
                        D G+         ++ E+E   R+    + +   +   E  + G Y  
Sbjct: 6587 ------------DRGE---------VIRESE-NTRISFIDNIATLQLGSPEASNSGKYIC 6624

Query: 752  TVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI-LGYILER 810
             +KN  G  + +  + V++       P              EP     G P  L  ++  
Sbjct: 6625 QIKNDAGMRECSAVLTVLEPARIIEKP--------------EPMTVTTGNPFALECVVTG 6670

Query: 811  KKKKSYRWMRLNFDLIQELSHE-------------ARRMIEGVVYEMRVYAVNAIGMSRP 857
              + S +W +   +L  +  H                 M +  +Y   V   N++G S  
Sbjct: 6671 TPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEV--KNSVGKSNC 6728

Query: 858  SPASQPFMPIGPPSEPTHLA-VEDVSDTTVSLKWR----PPERVG--AGGLDGYSVEYCP 910
            + +      I PPS    L  V  +   +V L+ R     P  VG    G +  S   C 
Sbjct: 6729 TVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQ 6788

Query: 911  EGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGP---GAPVTTTEPVTVQEI 967
               SE V  L         L++   TG   ++   A N+AG     A +T  EP + +  
Sbjct: 6789 SSFSENVCTL------NLSLLEPSDTG---IYTCVAANVAGSDECSAVLTVQEPPSFE-- 6837

Query: 968  LQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPT 1026
             Q P          +++   G  +      +G P  +V W K  + L  GE  +I     
Sbjct: 6838 -QTP---------DSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDF 6887

Query: 1027 DTILFIRAARRVHSGTYQVTVRIEN----------MEDKATLVLQVVD---KPSPPQDLR 1073
             T L +   + + SG Y   V  +           +++ AT V ++ D   +   P  L 
Sbjct: 6888 VTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLE 6947

Query: 1074 VTDAWGLNVALEW-KPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIG 1132
             T      +++ W K    +  +E    T+ +         + +E Y +  C++      
Sbjct: 6948 ATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLI------ 7001

Query: 1133 NGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSV 1192
                     +N  G     A                      +   E P F +PL +   
Sbjct: 7002 ---------ENEAGQDICEA---------------------LVSVLEPPYFIEPLEHVEA 7031

Query: 1193 IAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYV 1252
            + G  A L C V G+P+ +ISW+K    L     ++M  K  V +L I K    D G Y 
Sbjct: 7032 VIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYS 7091

Query: 1253 CRATNLQGEARCECRLEVR 1271
            C+A N  G       L ++
Sbjct: 7092 CKADNSVGAVASSAVLVIK 7110



 Score =  105 bits (261), Expect = 4e-22
 Identities = 130/548 (23%), Positives = 207/548 (37%), Gaps = 57/548 (10%)

Query: 738   VEGAEKEDEGVYTVTVKNPVGEDQ---VNLTVKVIDV---PDAPAAPKISNVGEDSCTVQ 791
             V G  ++ E  + V+ +N  G  +     +  K  D    P  P    I +  ++S T+ 
Sbjct: 23880 VTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLA 23939

Query: 792   WEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYAVN 850
             W  P YDGG  ILGY++E  K     W  +     ++    E  ++ E   Y++RV A+N
Sbjct: 23940 WGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALN 23999

Query: 851   AIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
              +G+   +       P      P         +  +  + R    V AGG     + +  
Sbjct: 24000 KVGLGEATSVPGTVKPEDKLEAP---------ELDLDSELRKGIVVRAGGSARIHIPFKG 24050

Query: 911   EGCSE--WVAALQGLTE---------HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTT 959
                 E  W       T+         +T + + +        + ++  N +G  +   T 
Sbjct: 24051 RPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVT- 24109

Query: 960   EPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEV 1019
               V V +    P+    + +R+     V EP   +I    K +  V   +E    A   V
Sbjct: 24110 --VKVLDTPGPPQNLAVKEVRKDSAFLVWEPP--IIDGGAKVKNYVIDKRESTRKAYANV 24165

Query: 1020  SIRNSPTDTILFIRAARRVHSGTYQVTVRIEN-----MEDKATLVLQVVDKPSPPQDLRV 1074
             S + S T      +         Y   V  EN     +  +    ++  + PSPP  + +
Sbjct: 24166 SSKCSKTS----FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTL 24221

Query: 1075  TDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNG 1134
             TD    + +L W+ P+  G + + GY V+   K T +W  V E  +  + VV  L  G  
Sbjct: 24222 TDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAVVTGLSSGQE 24280

Query: 1135  YYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIA 1194
             Y FRV + N  G SD       P  +  P I        A D +  PS   P    S+ A
Sbjct: 24281 YQFRVKAYNEKGKSD-------PRVLGVPVI--------AKDLTIQPSLKLPFNTYSIQA 24325

Query: 1195  GYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCR 1254
             G    +   V G P+P ISW K+G  L +  R  +        L I++    D G Y   
Sbjct: 24326 GEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVT 24385

Query: 1255  ATNLQGEA 1262
             ATN  G A
Sbjct: 24386 ATNSAGTA 24393



 Score =  104 bits (260), Expect = 5e-22
 Identities = 129/579 (22%), Positives = 235/579 (40%), Gaps = 81/579 (13%)

Query: 725   VRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVG 784
             + V   K++S+       K ++G+       P+   ++ +T +V D+ D P A     +G
Sbjct: 27520 IEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEV-DLSDIPGAQVTVRIG 27578

Query: 785   EDSCTVQWEPPAYDGGQPILGYI---LERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
              +   V  E P     +P + ++   L  K+ +  R+ +    +   + + A++   G  
Sbjct: 27579 HN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKN-AKKEHGGKY 27634

Query: 842   YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGG 900
               +   AV  I +    P +   + +GPPS+P   +  +++   +V L W  PE  G G 
Sbjct: 27635 TVILDNAVCRIAV----PIT--VITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGE 27688

Query: 901   LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960
             +  YS+E      + W      +   T+  V +L   A   FRVRA N  G       ++
Sbjct: 27689 ITCYSIEKRETSQTNWKMVCSSVAR-TTFKVPNLVKDAEYQFRVRAENRYG------VSQ 27741

Query: 961   PVTVQEILQRPRLQLPRHL-RQTIQKKVGEPVNLL--------------IPFQGKPRPQV 1005
             P+    I+ + + ++P    +  I     + ++L                  + K R  +
Sbjct: 27742 PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSI 27801

Query: 1006  TWTKEG-QPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENME--------DKA 1056
              W K    P++G E              RA   V    YQ  V  EN           K 
Sbjct: 27802 LWQKVNTSPISGREY-------------RATGLVEGLDYQFRVYAENSAGLSSPSDPSKF 27848

Query: 1057  TLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEW---- 1112
             TL +  VD P  P  + VT      + L+W PP   G +++ GY+++K       W    
Sbjct: 27849 TLAVSPVDPPGTPDYIDVTRE---TITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCN 27904

Query: 1113  FTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNY 1172
             FT +   + T   V  L  G+ Y FR+ ++N VG     + +   +      +   PP  
Sbjct: 27905 FTDVSECQYT---VTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENV---PP-- 27956

Query: 1173  KALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSK 1232
               ++F   P +   L+ +S   G +  +   V+G P P+++WFK+G+++ +     +   
Sbjct: 27957 -IVEFG--PEYFDGLIIKS---GESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDV 28010

Query: 1233  QGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
              G  +L +R       G+Y   A N  G A+ E +++V+
Sbjct: 28011 LGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049



 Score =  104 bits (259), Expect = 6e-22
 Identities = 210/960 (21%), Positives = 349/960 (36%), Gaps = 158/960 (16%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKR 419
            K+  +F KK+E    V K      +         + WLK+ Q +    + YI   + +  
Sbjct: 5045 KEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYI-SFVDSVA 5103

Query: 420  TLTISQCSLADDAAYQCVV----GGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFEC 475
            TL I          Y C      G E+C   L V+EP  ++ +      V     +  EC
Sbjct: 5104 TLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVD-VTEKDPMTLEC 5162

Query: 476  EVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALC------ 528
             V+     +VKWLKDG ++     F   F+ +       I   M +D+G Y         
Sbjct: 5163 VVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFR--IQSVMKQDSGQYTFKVENDFG 5220

Query: 529  TSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDE-NVRGVWLKNGKELVPD 587
            +S   A   ++ Q       + +  +          +C+VS    +   W K+GKE+   
Sbjct: 5221 SSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTS 5280

Query: 588  SRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKI 647
            ++ ++    R   L ++++   D A+Y+      A +  A    + VK       EPP  
Sbjct: 5281 AKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGD-DACSGILTVK-------EPPSF 5332

Query: 648  HLDCPGR---IPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPED 704
             L  PGR   IPD+ V            + G P   + W K                   
Sbjct: 5333 -LVKPGRQQAIPDSTV-------EFKAILKGTPPFKIKWFK------------------- 5365

Query: 705  TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNL 764
              D  E V   K     EG     +T   ++++V+ ++    G YT  V N VG D    
Sbjct: 5366 --DDVELVSGPKCFIGLEG-----STSFLNLYSVDASK---TGQYTCHVTNDVGSDSCTT 5415

Query: 765  TVKVIDVP---DAPAAPKISNVGEDS---CTVQWEPPAYDGGQPILGYILERKKKK---- 814
             + V + P       A KI   G+ S   C +         G P +  +  R + +    
Sbjct: 5416 MLLVTEPPKFVKKLEASKIVKAGDSSRLECKI--------AGSPEIRVVWFRNEHELPAS 5467

Query: 815  -SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEP 873
              YR   ++   + ++++ +       + E +  A +    ++      P     PP   
Sbjct: 5468 DKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPP--- 5524

Query: 874  THLAVEDVSDTTVSLKWR----PPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
                VE + +  VSL+      PP  V       Y  +       ++  A +    HTSI
Sbjct: 5525 ---IVETLKNAEVSLECELSGTPPFEV-----VWYKDKRQLRSSKKYKIASKNF--HTSI 5574

Query: 930  LVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQ--TIQKKV 987
             + ++ T     +  +A N  G    V T +       L+ P    PR + +  ++    
Sbjct: 5575 HILNVDTSDIGEYHCKAQNEVGSDTCVCTVK-------LKEP----PRFVSKLNSLTVVA 5623

Query: 988  GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
            GEP  L    +G     V W KE + +  E  +IR +  + +  ++ A+   +   +   
Sbjct: 5624 GEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYIC 5683

Query: 1048 RIEN----MEDKATLVL----QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTEL-- 1097
            +I+N     E+ ATL++     +V+K  P     +T   G    LE K     G  EL  
Sbjct: 5684 QIKNDGGMRENMATLMVLEPAVIVEKAGP-----MTVTVGETCTLECKV---AGTPELSV 5735

Query: 1098 -W---GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
             W   G  +  + K    ++  +   R    +  E      Y F+V  QN VG S   A 
Sbjct: 5736 EWYKDGKLLTSSQKHKFSFYNKISSLR---ILSVERQDAGTYTFQV--QNNVGKSSCTAV 5790

Query: 1154 TKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKIS 1213
                                  D +  PSFT+ L N   + G + +L C V GS    ++
Sbjct: 5791 V------------------DVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVA 5832

Query: 1214 WFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
            WF     +   A+++      V TL++      D G Y C A N+ G   C   L V+ P
Sbjct: 5833 WFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEP 5892



 Score =  103 bits (257), Expect = 1e-21
 Identities = 124/529 (23%), Positives = 187/529 (35%), Gaps = 95/529 (17%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  PA PK+ +    S ++ W  PAYDGG PI+GY++E K+  S  W+R N    +Q+  
Sbjct: 19589 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 19648

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT----- 885
              E   ++E   Y+ RVYAVN IG S PS       P      P      D+  T      
Sbjct: 19649 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 19708

Query: 886   ------VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
                   V +K RPP ++                   W      L +   + +K   T   
Sbjct: 19709 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKS--TDFD 19748

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV----GEPVNLLI 995
                R    N    G  + T E    ++               TI  KV    G PVN+ +
Sbjct: 19749 TFLRCENVNKYDAGKYILTLENSCGKK-------------EYTIVVKVLDTPGPPVNVTV 19795

Query: 996   PFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
                 K    VTW       G P+    V  R++        ++   V +   + + R+ N
Sbjct: 19796 KEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER------KSWSTVTTECSKTSFRVAN 19849

Query: 1052  MEDKATLVLQVVDK--------------------PSPPQDLRVTDAWGLNVALEWKPPQD 1091
             +E+  +   +V  +                    P P  DL+V      + ++ WK P  
Sbjct: 19850 LEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHS 19909

Query: 1092  VGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRA 1151
              G + + GY V    ++  +W  V++     +    +L  G  Y FRV ++N  G     
Sbjct: 19910 DGGSRIIGYVVDFLTEEN-KWQRVMKSLSLQYSA-KDLTEGKEYTFRVSAENENG----E 19963

Query: 1152  ATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPK 1211
              T  E   + R  +         LD    P         S        L   ++G P P 
Sbjct: 19964 GTPSEITVVARDDVVAPD-----LDLKGLPDLCYLAKENS-----NFRLKIPIKGKPAPS 20013

Query: 1212  ISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             +SW K    L  D R  + S     TL +      D G Y     N+ G
Sbjct: 20014 VSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 20062



 Score =  102 bits (255), Expect = 2e-21
 Identities = 196/928 (21%), Positives = 335/928 (36%), Gaps = 153/928 (16%)

Query: 391  DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTE 446
            +  + W K   +++ S   Y  +      +L I++   +D   Y C     VG    S  
Sbjct: 7048 EIRISWYKEHTKLR-SAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAV 7106

Query: 447  LFVK--EPPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRF 503
            L +K  + P    R L+D    +G  V FEC ++  E  QV W KDGV L  +   +  F
Sbjct: 7107 LVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSF 7166

Query: 504  KKDGQRHHLIINEAMLEDAGHYAL--CTSGG-----QALAELIVQEKKLEVYQSI----A 552
                  H++   + +  D  H     C++        + A+LI+ E ++  +  +     
Sbjct: 7167 V-----HNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSV 7221

Query: 553  DLMVGAKDQAVFKCEVSDEN-VRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADE 611
            DL +G  +   FKC V+    ++  W K+ +E+ P    K++ +     LT+  V   D 
Sbjct: 7222 DLALG--ESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDA 7279

Query: 612  ADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDV 671
              Y+     +A N++ K    +     +  QEPP+       ++  + +V      R + 
Sbjct: 7280 GQYTC----YASNIAGK----DSCSAQLGVQEPPRF----IKKLEPSRIVKQDEFTRYEC 7327

Query: 672  PISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTK 731
             I G P   V+W K  T+                              +   + R+    
Sbjct: 7328 KIGGSPEIKVLWYKDETE-----------------------------IQESSKFRMSFVD 7358

Query: 732  DRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNV--GED--- 786
              ++  +     ED G YT    N  G    + ++KV + P     P       G D   
Sbjct: 7359 SVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHL 7418

Query: 787  SCTVQWEPPAYDGGQPILGYILERKKK--KSYRWMRLNF-DLIQELSHEARRMIEGVVYE 843
             C +Q  PP +     +  Y  +R+ +  K Y+ M  NF   I  L+ +A       + E
Sbjct: 7419 ECELQGTPPFH-----VSWYKDKRELRSGKKYKIMSENFLTSIHILNVDA-----ADIGE 7468

Query: 844  MRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDG 903
             +  A N +G    S      + +  P       V+ +SD +  +      +    G + 
Sbjct: 7469 YQCKATNDVG----SDTCVGSIALKAPPR----FVKKLSDISTVVGKEVQLQTTIEGAEP 7520

Query: 904  YSV-------EYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPV 956
             SV       E   E  + W++  + +       V+    G    +  +  N AG     
Sbjct: 7521 ISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGK---YTCQIKNDAGMQECF 7577

Query: 957  TTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAG 1016
             T   +    I+++P         ++I+   G+   L     G P     W K+G+ L  
Sbjct: 7578 ATLSVLEPATIVEKP---------ESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTS 7628

Query: 1017 E---EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPP---Q 1070
            +   ++S  N  +   L I       SG Y   V+    +D  T  LQV D+  PP   +
Sbjct: 7629 DNKYKISFFNKVSG--LKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTR 7686

Query: 1071 DLRVTDAW-GLNVALEWK----PPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCV 1125
             L+ T+   G +V +E K    PP  V     W +   +         T+ ++       
Sbjct: 7687 KLKETNGLSGSSVVMECKVYGSPPISVS----WFHEGNEISSGRKYQTTLTDN--TCALT 7740

Query: 1126 VPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQ 1185
            V  L   +   +   + NM G  + +A                      L   E PSF Q
Sbjct: 7741 VNMLEESDSGDYTCIATNMAGSDECSA---------------------PLTVREPPSFVQ 7779

Query: 1186 PLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCP 1245
                  V+ G        V+G+P   +SWFK   +L    R  +  +  V  LE+     
Sbjct: 7780 KPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDT 7839

Query: 1246 FDGGIYVCRATNLQGEARCECRLEVRVP 1273
               G Y C  +N  G+A C   L ++ P
Sbjct: 7840 SQSGEYTCIVSNEAGKASCTTHLYIKAP 7867



 Score =  102 bits (255), Expect = 2e-21
 Identities = 114/505 (22%), Positives = 205/505 (40%), Gaps = 45/505 (8%)

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
             D G   E    + L   T+  VRV      +   + G  +  E  + V   N  GE + +
Sbjct: 14010 DGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPS 14069

Query: 764   ------LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYR 817
                   L  + +  P  P   ++ N+ +++  ++W  P  DGG PI  YI+E++  +   
Sbjct: 14070 EPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKG 14129

Query: 818   WMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPPSEPT 874
             W  ++   +++       + EG +Y  RV A NAIG S  +      +       P  P 
Sbjct: 14130 WQTVD-TTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPY 14188

Query: 875   HLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDL 934
              LAV DV+   V LKW PP+  G   +  Y +E      + WV A +      +  V D+
Sbjct: 14189 ALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDV 14248

Query: 935   PTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLL 994
               G  + F+VRA N AG G P   TE +++++    P   L  H+    +K +   +   
Sbjct: 14249 IEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIA--IAWK 14306

Query: 995   IPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN-- 1051
              P +    P + +  E  P+  E+ + + + P   + F      V    Y + VR  N  
Sbjct: 14307 PPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAI 14366

Query: 1052  -MEDKATLVLQVVDKPS--------PPQDLRVTDAWGLNVALEWKP-PQDVGNTELWGYT 1101
              + + + +   VV K             D+ V +   L++ + ++  P    +    G  
Sbjct: 14367 GVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKE 14426

Query: 1102  VQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP 1161
             V+ +D+ TM+       +   H  VP+ +  +   + +  +N +G S  A+   + + +P
Sbjct: 14427 VKASDRLTMK-----NDHISAHLEVPKSVRADAGIYTITLENKLG-SATASINVKVIGLP 14480

Query: 1162  RP--------------GITYEPPNY 1172
              P               +T+EPP +
Sbjct: 14481 GPCKDIKASDITKSSCKLTWEPPEF 14505



 Score =  102 bits (255), Expect = 2e-21
 Identities = 86/332 (25%), Positives = 131/332 (39%), Gaps = 39/332 (11%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP +HLD      D + +  G    L    SG P P V W K                  
Sbjct: 16817 PPTLHLD----FRDKLTIRVGEAFALTGRYSGKPKPKVSWFK------------------ 16854

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
             D  D  E           + R  ++TT          A++ D G Y V V+N  G  +  
Sbjct: 16855 DEADVLE-----------DDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGF 16903

Query: 764   LTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
               V V+D P  P  P     V +D   + W+PP  DGG  I  YI+E+K+     WM + 
Sbjct: 16904 CQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVT 16963

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRP--SPASQPFMPIGPPSEPTHLAVED 880
                  + + +  +++EG  Y  R++A N  G+S P  S + +       P  P    V +
Sbjct: 16964 -SASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTE 17022

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQG-LTEHTSILVKDLPTGAR 939
             V+  +  + W  P   G   +  Y +E        W    +  +  +T   V DL  G +
Sbjct: 17023 VTKDSALVTWNKPHD-GGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQ 17081

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
               FRV A N  G G P   ++PV  ++ + +P
Sbjct: 17082 YEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 17113



 Score =  102 bits (254), Expect = 2e-21
 Identities = 203/958 (21%), Positives = 349/958 (36%), Gaps = 162/958 (16%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADH-DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTI 423
            F KKLE +  V  G   RL  ++A   +  V W +N  E+  S  KY    I +   + +
Sbjct: 5425 FVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPAS-DKYRMTFIDSVAVIQM 5483

Query: 424  SQCSLADDAAYQCVV----GGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSE 479
            +  S  D   + C      G   CST++ VKEPPV  + P   +  +    V  ECE+S 
Sbjct: 5484 NNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVE-TLKNAEVSLECELSG 5542

Query: 480  EGA-QVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAEL 538
                +V W KD  +L   + +K   K      H++  +    D G Y  C +  +  ++ 
Sbjct: 5543 TPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDT--SDIGEYH-CKAQNEVGSDT 5599

Query: 539  IVQEKKLE----VYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSR-IKV 592
             V   KL+        +  L V A + A  +  +       V WLK  +E++ +S  I++
Sbjct: 5600 CVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRI 5659

Query: 593  SHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCP 652
            + +  V  L      PA+   Y                  ++K D   R+    + +  P
Sbjct: 5660 TFVENVATLQFAKAEPANAGKY----------------ICQIKNDGGMRENMATLMVLEP 5703

Query: 653  GRIPDT---IVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSD 709
              I +    + V  G    L+  ++G P  +V                            
Sbjct: 5704 AVIVEKAGPMTVTVGETCTLECKVAGTPELSV---------------------------- 5735

Query: 710  EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVI 769
            EW  D KLL  ++ + +       S   +   E++D G YT  V+N VG+      V V 
Sbjct: 5736 EWYKDGKLLTSSQ-KHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVS 5794

Query: 770  DVPDAPA-APKISNVG---EDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL 825
            D    P+   ++ N G     SC ++ +     G  PI           S  W       
Sbjct: 5795 DRAVPPSFTRRLKNTGGVLGASCILECK---VAGSSPI-----------SVAWF------ 5834

Query: 826  IQELSHEARRMIEGVVY-------------------EMRVYAVNAIGMSRPSPASQPFMP 866
                 HE  +++ G  Y                   +M  Y   A  ++           
Sbjct: 5835 -----HEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 5889

Query: 867  IGPPS---EPTHLAV---EDVSDTTVSLKWRPPERVG--AGGLDGYSVEYCPEGCSEWVA 918
              PPS   EP  L V   ++V+ T+V ++  PP +V    G  +    + C     + VA
Sbjct: 5890 QEPPSFVKEPEPLEVLPGKNVTFTSV-IRGTPPFKVNWFRGARELVKGDRCNIYFEDTVA 5948

Query: 919  ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
             L+       +   D+       +     N AG  +        T +  ++ P   L R 
Sbjct: 5949 ELE-------LFNIDISQSGE--YTCVVSNNAGQAS-------CTTRLFVKEPAAFLKRL 5992

Query: 979  LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARR 1037
               +++   G+ + L   + G     VTW K+G  +   E+ +I  +    IL I  + +
Sbjct: 5993 SDHSVEP--GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTK 6050

Query: 1038 VHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTD-AWGLNVALEWKPPQDVGNTE 1096
              +G Y   +  E   D    ++  ++ P    +L   + A G +V+L+ +       T 
Sbjct: 6051 RDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITV 6110

Query: 1097 LWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKE 1156
             W Y      + T E+ T   +   T  V  ++ I +   +   ++N +G +        
Sbjct: 6111 SW-YKGDTKLRPTPEYRTYFTNNVAT-LVFNKVNINDSGEYTCKAENSIGTASSKTV--- 6165

Query: 1157 PVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216
                           ++  +    PSF + L +     G    L C + GS   ++ W++
Sbjct: 6166 ---------------FRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYR 6210

Query: 1217 NGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
            +G+ L +D   +      V TL+I +      G Y C A+N  G A    RL  R P+
Sbjct: 6211 DGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPK 6268



 Score =  102 bits (253), Expect = 3e-21
 Identities = 150/635 (23%), Positives = 235/635 (37%), Gaps = 110/635 (17%)

Query: 680   TVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE 739
             TV+W           +RP  D   D         DKK L     +V  ET +D     V 
Sbjct: 27083 TVVW-----------SRPIADGGSDISGYFLEKRDKKSLGWF--KVLKETIRDTRQ-KVT 27128

Query: 740   GAEKEDEGVYTVTVKNPVGE------DQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWE 793
             G  +  +  Y V   N  G+       +       ID P  PA  +I++  + S T+ W 
Sbjct: 27129 GLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWS 27188

Query: 794   PPAYDGGQPILGYILERKKKKSYRWMRLNFD-LIQELSHEARRMIEGVVYEMRVYAVNAI 852
              P YDGG  + GY++E ++ +   W  ++    ++   +    +  GV Y  RV AVN  
Sbjct: 27189 KPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCA 27248

Query: 853   GMSRPSPASQPFMP---IGPPSEPTHLAV---------EDVSDTTVSLKWRPPERV---- 896
             G   P   ++P      +  P     +A+         EDV    +  K RPP  V    
Sbjct: 27249 GQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQ-VLIPFKGRPPPTVTWRK 27307

Query: 897   ---GAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSIL----VKDLPTGARLLFRVRAHNM 949
                  G    YS+E                T+ +S+L    V    TG  +L        
Sbjct: 27308 DEKNLGSDARYSIEN---------------TDSSSLLTIPQVTRNDTGKYILTIEN---- 27348

Query: 950   AGPGAPVTTTEPVTVQEILQRP----RLQLPRHLRQTIQKKVGEP--------VNLLIPF 997
              G G P ++T  V   ++L  P    +LQ+    R T+      P        +N +I  
Sbjct: 27349 -GVGEPKSSTVSV---KVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI-- 27402

Query: 998   QGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             + +   + TW+      +     + +    T  F R       G  +          + T
Sbjct: 27403 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPC--------ETT 27454

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
               ++  + P+P +DL + D+   +V L W  P   G + +  Y V++  K    W +   
Sbjct: 27455 EPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW-SHAG 27513

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDF 1177
               +     V +L   +   FRVF++N  G SD    T  P+ +    IT E      +D 
Sbjct: 27514 ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSD--PVTIGPITVKELIITPE------VDL 27565

Query: 1178  SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             S+ P         +V  G+   L    +G PKP ISW K+GL L E    R    +  +T
Sbjct: 27566 SDIPG-----AQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT 27620

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272
             L I+      GG Y     N        CR+ V +
Sbjct: 27621 LSIKNAKKEHGGKYTVILDN------AVCRIAVPI 27649



 Score =  101 bits (252), Expect = 4e-21
 Identities = 134/560 (23%), Positives = 208/560 (37%), Gaps = 74/560 (13%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPP 795
             +TV+G ++ D   Y V+  N VG+ + +   K I   D  A P +     D  T++    
Sbjct: 16776 YTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRV--- 16832

Query: 796   AYDGGQPILGYILERKKKKSYRWMRLNFDLIQE-LSH-------------EARRMIEG-- 839
                G    L      K K    W +   D++++  +H             +A+R   G  
Sbjct: 16833 ---GEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKY 16889

Query: 840   -VVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGA 898
              VV E    +    G  + +   +P  P+GP S       ++V+   + + W+PP   G 
Sbjct: 16890 CVVVENSTGSRK--GFCQVNVVDRPGPPVGPVS------FDEVTKDYMVISWKPPLDDGG 16941

Query: 899   GGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTT 958
               +  Y +E    G   W+       + T+  V  L  G   +FR+ A N+ G       
Sbjct: 16942 SKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGKDYIFRIHAENLYG------I 16994

Query: 959   TEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI---PFQG-KPRPQVTWTKEGQPL 1014
             ++P+    +  + R ++P    Q I  +V +   L+    P  G KP       K  + +
Sbjct: 16995 SDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR-ETM 17053

Query: 1015  AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM--------EDKATLVLQVVDKP 1066
             +     +   P       R    +    Y+  V  EN           K       + KP
Sbjct: 17054 SKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 17113

Query: 1067  SPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL---EHYRRTH 1123
             SPP +    D    +V L W+PP+  G +++ GY V+       EW       E    T 
Sbjct: 17114 SPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETK 17173

Query: 1124  CVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGIT---YEPPNYKALDFSEA 1180
               V  L  G  Y FRV + N  G SD       P  +P P +     EPP    LD + A
Sbjct: 17174 YKVTGLRDGQTYKFRVLAVNAAGESD-------PAHVPEPVLVKDRLEPPEL-ILDANMA 17225

Query: 1181  PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
                      + +  G T  L   ++G P PK++W K   D    AR  +        LEI
Sbjct: 17226 RE-------QHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEI 17276

Query: 1241  RKPCPFDGGIYVCRATNLQG 1260
             R     DGGIY     N  G
Sbjct: 17277 RNAAHEDGGIYSLTVENPAG 17296



 Score =  101 bits (251), Expect = 5e-21
 Identities = 79/286 (27%), Positives = 133/286 (46%), Gaps = 11/286 (3%)

Query: 359   EKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAK 418
             E+    F K LE    V KG  + L+ EL + + +V W K+G+ +     + +   IG  
Sbjct: 11208 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 11266

Query: 419   RTLTISQCSLADDAAYQCVVGGE---KCSTELFVKEPPVL---ITRPLEDQLVMVGQRVE 472
             R LTI+     D   Y   V      +CS+   VK   V+   + +P+ DQ V       
Sbjct: 11267 RALTINDADDTDAGTYTVTVENANNLECSS--CVKVVEVIRDWLVKPIRDQHVKPKGTAI 11324

Query: 473   FECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGG 532
             F C+++++   +KW K   E+  E   K    +DG   +L I  AM ED   YA+   G 
Sbjct: 11325 FACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGK 11384

Query: 533   QALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKV 592
             +  A+L + E+++E+ + I D+ +  K+ A F  E+S+ ++ G W   G+ L P    ++
Sbjct: 11385 RYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEI 11444

Query: 593   SHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDF 638
                G    LT+  V   D+A    + +      +A L   E+++DF
Sbjct: 11445 KAEGGKRFLTLHKV-KLDQAG-EVLYQALNAITTAILTVKEIELDF 11488



 Score =  101 bits (251), Expect = 5e-21
 Identities = 142/653 (21%), Positives = 242/653 (37%), Gaps = 78/653 (11%)

Query: 661   VVAGNKLRLDVPISGDP-----------APTVIWQKAITQGNKAPARPAPDAPEDTGDSD 709
             ++A NK  +  P+  +P           AP      ++T+ +       P+    +  + 
Sbjct: 16291 IMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG 16350

Query: 710   EWVFDKKLLCETEGRVRVETTKDRSI---FTVEGAEKEDEGVYTVTVKNPVGEDQVNL-- 764
              W+  K    +   RV  +  K  ++   + V G  +  +  + V   N  G    +L  
Sbjct: 16351 YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPS 16410

Query: 765   ---TVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                T +    P  P  PK+++  + S  ++W PP  DGG  + GYI+E K++    W + 
Sbjct: 16411 DPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKG 16470

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
                 ++        + EG  Y+ RV AVN  G+  P   +           P       V
Sbjct: 16471 KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASV 16530

Query: 882   SDTTVSLKWRPPERVGAGGLDGYS--VEYCPEGCSEW---------VAALQGLTEHTSIL 930
              D  V         V AGG+      V   P     W          A ++     +S++
Sbjct: 16531 RDRIV---------VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMV 16581

Query: 931   VKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV--- 987
             +K+     + ++ + A N AG        + + V   +  P L    +L     K     
Sbjct: 16582 IKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLA--HNLTNESCKLTWFS 16639

Query: 988   -----GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
                  G P+   +  + +   +  WT     +  +  +++        F R A     G 
Sbjct: 16640 PEDDGGSPITNYV-IEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGM 16698

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
                   +E  E  A ++ + +  P  P+DL V +     V L W PP+  G +E+  Y +
Sbjct: 16699 GPF---VETSE--ALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVL 16753

Query: 1103  QKADKKTMEWFTVL-EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP 1161
             +     T ++  V  ++       V  L  G+ Y +RV + N+VG         +P F  
Sbjct: 16754 ESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQG-------KPSFCT 16806

Query: 1162  RPGITYE----PPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKN 1217
             +P IT +    PP    LDF +           ++  G    L     G PKPK+SWFK+
Sbjct: 16807 KP-ITCKDELAPPTLH-LDFRD---------KLTIRVGEAFALTGRYSGKPKPKVSWFKD 16855

Query: 1218  GLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
               D+ ED R  + +    L LE  K    D G Y     N  G  +  C++ V
Sbjct: 16856 EADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 16908



 Score =  100 bits (250), Expect = 7e-21
 Identities = 118/495 (23%), Positives = 197/495 (39%), Gaps = 46/495 (9%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVG---EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQW 792
             F   G E+  E  + V+ +N VG     +V+      D  D P  P+   V  +S T+QW
Sbjct: 22400 FKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQW 22459

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
             + P YDGG  I GYI+E+K+    RWM+ +F  I +   E   ++E   YE RV A NA 
Sbjct: 22460 KKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAA 22519

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG 912
             G+      S   +      +P  ++++     T+ +      +V A   D Y     P  
Sbjct: 22520 GVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDA---DIYGK---PIP 22573

Query: 913   CSEWVAALQGLTEHTSILVKDLPTGARL----LFRVRAHNMAGPGAPVTTTEPVTVQ-EI 967
               +W+   Q L+    + +K       L      RV + N       V     VTV  ++
Sbjct: 22574 TIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 22633

Query: 968   LQRPRLQLPRHLRQTIQKKVGEPVNLL--IPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP 1025
             L RP    P      I     E   L    P Q      + +  E +  +    ++ ++ 
Sbjct: 22634 LDRPG---PPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN 22690

Query: 1026  TDTILFIRAARRVHSGTYQVTVRIEN-------MEDKATLVLQVVDKPSPPQDLRVTDAW 1078
               T L  +  + +    Y   +   N       +E +  +       P  P+   VT   
Sbjct: 22691 VQT-LSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVT 22749

Query: 1079  GLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR---RTHCVVPELIIGNGY 1135
               ++ + W+ P   G +E+ GY ++K DK+ + W     H R        V  LI  + Y
Sbjct: 22750 KDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRC--HKRLIGELRLRVTGLIENHDY 22807

Query: 1136  YFRVFSQNMVGFSDRAATTK-----EPVFIPRPGITYEPPNYKALDFSEAP---SFTQPL 1187
              FRV ++N  G S+ +  +      +P++ P P     P N K +D + +    S+++P+
Sbjct: 22808 EFRVSAENAAGLSEPSPPSAYQKACDPIYKPGP-----PNNPKVIDITRSSVFLSWSKPI 22862

Query: 1188  VNRSV-IAGYTAMLC 1201
              +    I GY    C
Sbjct: 22863 YDGGCEIQGYIVEKC 22877



 Score =  100 bits (248), Expect = 1e-20
 Identities = 107/487 (21%), Positives = 186/487 (38%), Gaps = 42/487 (8%)

Query: 800   GQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP 859
             G+P+    L R        MR N ++  E  +    + E V  +   Y + A   S  + 
Sbjct: 26502 GKPLPKVTLSRDGVPLKATMRFNTEITAE--NLTINLKESVTADAGRYEITAANSSGTTK 26559

Query: 860   ASQPFMPIGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVA 918
             A    + +  P  PT  + + D+++ +V+LKW PP+  G   +  Y +       + W  
Sbjct: 26560 AFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 26619

Query: 919   ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG-----PGAPVTTTEPVTVQEILQRPRL 973
              +      T + V  L TG    FR++A N  G       A VT   P T       P  
Sbjct: 26620 -VSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTP-- 26676

Query: 974   QLPRHLRQTIQKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTD 1027
              +    R++I     EPV+      +    + K R  + W K        ++ IR +   
Sbjct: 26677 WVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK------ANKLVIRTTHFK 26730

Query: 1028  TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWK 1087
              +  I A        Y             +  +  +D   PP+++R+TD    +V+L W+
Sbjct: 26731 -VTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQ 26789

Query: 1088  PPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
              P   G +++ GY V++ D     W      +   T  ++  L   + Y FRVF++N VG
Sbjct: 26790 QPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVG 26849

Query: 1147  FSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCA 1203
                  +    P+                +D    P    PL    V+   AG +  L   
Sbjct: 26850 SISNPSEVVGPI--------------TCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAG 26895

Query: 1204  VRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             + G P P I W+K+  +L  +A   + +   + ++ I+     + G Y  +  N  G A 
Sbjct: 26896 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 26955

Query: 1264  CECRLEV 1270
                R+++
Sbjct: 26956 ATIRVQI 26962



 Score = 99.4 bits (246), Expect = 2e-20
 Identities = 77/249 (30%), Positives = 111/249 (44%), Gaps = 13/249 (5%)

Query: 391  DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV---VGGEKCSTEL 447
            D E +W KNG +I+ S   Y +        L I   +  D A+       + GE  S   
Sbjct: 2106 DPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAF 2165

Query: 448  FVKEPPVLITRPLEDQLVMVGQR---VEFECEVSEEGAQVKWLKDGVELTREETFKYRFK 504
             + +   LIT   E Q V+  ++     FECE SE   +VKW KDG+E+   E  KYR  
Sbjct: 2166 LLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEV--HEGDKYRMH 2223

Query: 505  KDGQRHHLIINEAMLEDAGHYALC---TSGGQALAELIVQEKKLEVYQSIADLMVGAKDQ 561
             D + H L I      DA  Y+         +  A+LIV+   +E  + + D+ V     
Sbjct: 2224 SDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYS 2283

Query: 562  AVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEG- 620
               +C VS EN+ G W  N  EL  + +  ++       LT+ DVT  D+ +YSFV +G 
Sbjct: 2284 GELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK 2343

Query: 621  -FACNLSAK 628
               C L  K
Sbjct: 2344 KTTCKLKMK 2352



 Score = 99.0 bits (245), Expect = 3e-20
 Identities = 116/522 (22%), Positives = 200/522 (38%), Gaps = 83/522 (15%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  P+ PK+++    S ++ W  P YDGG P+ GY++E K+  +  W        +Q   
Sbjct: 25003 PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQ 25062

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPP-----SEPTHLAVEDVS 882
                 ++ E   Y  R+ A+N+ G+  P+      +    I PP     ++   + V   S
Sbjct: 25063 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 25122

Query: 883   DTT---VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
              T    V++K RP   V     +G   +          A ++  +  T +++ ++     
Sbjct: 25123 ATLRLFVTIKGRPEPEVKWEKAEGILTDR---------AQIEVTSSFTMLVIDNVTRFDS 25173

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
               + +   N +G     + T  V V+ +L  P                  PVNL I    
Sbjct: 25174 GRYNLTLENNSG-----SKTAFVNVR-VLDSP----------------SAPVNLTIREVK 25211

Query: 1000  KPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAA-RRVHSGTYQVTVRIENMED---- 1054
             K    ++W     PL      I N   +     R A   + +   + T RIEN+++    
Sbjct: 25212 KDSVTLSWEP---PLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSY 25268

Query: 1055  ----------------KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
                             + T  ++V + P PP  + + D       ++W+ P+  G +++ 
Sbjct: 25269 YFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKIT 25328

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
             GY V+   K + +W T  +  +     +  L  G  Y FRV + N  G SD       P 
Sbjct: 25329 GYVVEMQTKGSEKWSTCTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSD-------PR 25380

Query: 1159  FIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNG 1218
              +  P I        A D    PS   P    +V A     +    +G P+  ++W K+G
Sbjct: 25381 QLGVPVI--------ARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDG 25432

Query: 1219  LDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
               L E  R  + S + V +L I++    D G Y    +N  G
Sbjct: 25433 QTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG 25474



 Score = 99.0 bits (245), Expect = 3e-20
 Identities = 115/467 (24%), Positives = 176/467 (37%), Gaps = 65/467 (13%)

Query: 824   DLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSD 883
             DL   L  +A R+  G  YE+++   NA+G +  +   Q     GPP  P  +  + V+ 
Sbjct: 26926 DLASILIKDADRLNSGC-YELKLR--NAMGSASATIRVQILDKPGPPGGP--IEFKTVTA 26980

Query: 884   TTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFR 943
               ++L WRPP   G   +  Y VE        W    + L E   I    +  G   +FR
Sbjct: 26981 EKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL-EECIITTTKIIKGNEYIFR 27039

Query: 944   VRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRP 1003
             VRA N  G G P+ +   V     +      +P   + T                 K   
Sbjct: 27040 VRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKIT-----------------KNSM 27082

Query: 1004  QVTWTKE----GQPLAGEEVSIRNSPT--------DTILFIR--AARRVHSGTYQVTVRI 1049
              V W++     G  ++G  +  R+  +        +TI   R        +  YQ  V  
Sbjct: 27083 TVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCA 27142

Query: 1050  ENMEDKATL--------VLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYT 1101
              N   +               +D P PP  +R+ D+   ++ L W  P   G + + GY 
Sbjct: 27143 VNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYV 27202

Query: 1102  VQKADKKTMEWFTVLE--HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVF 1159
             V+    +  EW TV      R T  VV  L  G  YYFRV + N  G         EP+ 
Sbjct: 27203 VEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQG-------EPIE 27255

Query: 1160  IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVRGSPKPKISWFK 1216
             +  P         +A D  EAP     +  R+ +   AG    +    +G P P ++W K
Sbjct: 27256 MNEP--------VQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRK 27307

Query: 1217  NGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             +  +LG DAR+ + +      L I +    D G Y+    N  GE +
Sbjct: 27308 DEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPK 27354



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 116/522 (22%), Positives = 197/522 (37%), Gaps = 81/522 (15%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  P  PK+ ++   S  + W  P YDGG  I GYI+E+       W        I + +
Sbjct: 22838 PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTN 22897

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTT-- 885
              E  +++E   Y  R+ A+N  G+   +    P +    +  P     L +  + +    
Sbjct: 22898 IEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAG 22957

Query: 886   ------VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
                   V +K RP   V  G +DG   +          A +   +  TS+++ ++     
Sbjct: 22958 GSLRLFVPIKGRPTPEVKWGKVDGEIRD---------AAIIDVTSSFTSLVLDNVNRYDS 23008

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
               + +   N +G     T +  VTV+ +L  P                  PVNL +    
Sbjct: 23009 GKYTLTLENSSG-----TKSAFVTVR-VLDTP----------------SPPVNLKVTEIT 23046

Query: 1000  KPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT--------- 1046
             K    +TW       G  +    V  R +   +  +       H  ++++          
Sbjct: 23047 KDSVSITWEPPLLDGGSKIKNYIVEKREATRKS--YAAVVTNCHKNSWKIDQLQEGCSYY 23104

Query: 1047  --VRIEN-----MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWG 1099
               V  EN     +  +    ++V + P PP  + V D    +V+L W  P+  G +++  
Sbjct: 23105 FRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQ 23164

Query: 1100  YTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVF 1159
             Y V+   K + +W +     +    V+  L  G  Y FRV + N  G SD  +     V 
Sbjct: 23165 YIVEMQAKHSEKW-SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLA---VP 23220

Query: 1160  IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGL 1219
             I    +  EP           P+F+    + SV  G    +   + G PKP I+W K+GL
Sbjct: 23221 IVAKDLVIEP--------DVKPAFS----SYSVQVGQDLKIEVPISGRPKPTITWTKDGL 23268

Query: 1220  DLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
              L +  R  +     + TL I++    DGG Y     N+ G+
Sbjct: 23269 PLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQ 23310



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 125/521 (23%), Positives = 208/521 (39%), Gaps = 94/521 (18%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVI---DVPDAPAAPKISNVGEDSCTVQW 792
             F  +  E+  E  + V  +N VG  + +   +     D  D P  P+   V  +  T+QW
Sbjct: 23482 FKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQW 23541

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
               P YDGG  I GYI+E++     RWM+ +F  + E       + E   YE RV A NA 
Sbjct: 23542 TKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAA 23601

Query: 853   G-MSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSL--KWRPPERVGAGGLDGYSVEYC 909
             G +S+PS ++ P             A ++V    +S+  K+R    V AG  + + +E  
Sbjct: 23602 GAISKPSDSTGPI-----------TAKDEVELPRISMDPKFRDTIVVNAG--ETFRLEAD 23648

Query: 910   PEG----CSEWVAALQGLTEHTSILVKDLPTGARLLFR-----------VRAHNMAGPGA 954
               G      EW+   + + E     +K+    A L+ +           +RA N+AG   
Sbjct: 23649 VHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAG--- 23705

Query: 955   PVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN-LLIPFQGKPRPQVTWTKEGQP 1013
               + + PV V ++L RP                G P   + +      +  +TW+   Q 
Sbjct: 23706 --SKSFPVNV-KVLDRP----------------GPPEGPVQVTGVTSEKCSLTWSPPLQD 23746

Query: 1014  LAGEEVS---IRNSPTDTILFIRAARRVHSGTYQVTVRIEN------------------M 1052
               G ++S   +    T  + +   A  V + + +VT  +E                   +
Sbjct: 23747 -GGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPL 23805

Query: 1053  EDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEW 1112
             E    L+      P PP+ L VT+    ++ + W  P   G +E+ GY V+K D+  + W
Sbjct: 23806 ESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRW 23865

Query: 1113  FTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPVFIPRPGIT 1166
                           V  L   + Y FRV ++N  G  + +  T      +PVF P P   
Sbjct: 23866 IKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGP--- 23922

Query: 1167  YEPPNYKALDFSE---APSFTQPLVN-RSVIAGYTAMLCCA 1203
               P N   +D ++     ++ +P+ +  S I GY   +C A
Sbjct: 23923 --PTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKA 23961



 Score = 98.2 bits (243), Expect = 4e-20
 Identities = 195/923 (21%), Positives = 340/923 (36%), Gaps = 157/923 (17%)

Query: 393  EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQC----VVGGEKCSTELF 448
            ++ W K+ +EI+  G+ Y    +    TLT+ +    D   Y C    + G + CS +L 
Sbjct: 7242 KITWAKDNREIRPGGN-YKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLG 7300

Query: 449  VKEPPVLITRPLEDQLVMVGQRVEFECEV-SEEGAQVKWLKDGVELTREETFKYRFKKDG 507
            V+EPP  I +    ++V   +   +EC++      +V W KD  E+  +E+ K+R     
Sbjct: 7301 VQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEI--QESSKFRMSFVD 7358

Query: 508  QRHHLIINEAMLEDAGHYA--LCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAV-F 564
                L ++   +ED+G Y      + G A +   ++ K+  +++     +   K   V  
Sbjct: 7359 SVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHL 7418

Query: 565  KCEVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFAC 623
            +CE+       V W K+ +EL    + K+     +  + I +V  AD  +Y        C
Sbjct: 7419 ECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQ-------C 7471

Query: 624  NLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW 683
              +  +   +  +  +  + PP+       ++ D I  V G +++L   I G    +V+W
Sbjct: 7472 KATNDVG-SDTCVGSIALKAPPRF----VKKLSD-ISTVVGKEVQLQTTIEGAEPISVVW 7525

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEK 743
             K                            DK  +      + +  +++ +       E 
Sbjct: 7526 FK----------------------------DKGEIVRESDNIWISYSENIATLQFSRVEP 7557

Query: 744  EDEGVYTVTVKNPVGEDQVNLTVKVID---VPDAPAAPKISNVGEDSCTVQWEPPAYDGG 800
             + G YT  +KN  G  +   T+ V++   + + P + K++    D+CT++        G
Sbjct: 7558 ANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTT--GDTCTLE----CTVAG 7611

Query: 801  QPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPA 860
             P L          S +W +   +L  +  ++       + +  +V  +  I ++     
Sbjct: 7612 TPEL----------STKWFKDGKELTSDNKYK-------ISFFNKVSGLKIINVAPSDSG 7654

Query: 861  SQPFMPIGPPSEPTHLAVEDVSDTTV--SLKWRPPERVGAGGLD-----------GYSVE 907
               F    P  + +  A   VSD TV  S   +  E  G  G               SV 
Sbjct: 7655 VYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVS 7714

Query: 908  YCPEG--CSEWVAALQGLTEHT-SILVKDLPTGARLLFRVRAHNMAGP---GAPVTTTEP 961
            +  EG   S        LT++T ++ V  L       +   A NMAG     AP+T  EP
Sbjct: 7715 WFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREP 7774

Query: 962  VTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEE--- 1018
                  +Q+P           +    G  V      +G P   V+W K    L   +   
Sbjct: 7775 ---PSFVQKP---------DPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCN 7822

Query: 1019 VSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTD-- 1076
            VS+ +S  +  LF        SG Y  T  + N   KA+    +  K       R+ D  
Sbjct: 7823 VSLEDSVAELELF--DVDTSQSGEY--TCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYS 7878

Query: 1077 -AWGLNVALE----WKPPQDVGNTELWGYTV---QKADKKTMEWFTVLEHYRRTHCVVPE 1128
               G  + LE      PP  V   +  G  V   Q+ +  T E   +LE        +P 
Sbjct: 7879 IEKGKPLILEGTFTGTPPISV-TWKKNGINVTPSQRCNITTTEKSAILE--------IPS 7929

Query: 1129 LIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLV 1188
              + +   +  + +N  G    +A                      +   E P F + L 
Sbjct: 7930 STVEDAGQYNCYIENASGKDSCSA---------------------QILILEPPYFVKQLE 7968

Query: 1189 NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDG 1248
               V  G +A L C + G+P+  +SW+K    L     ++M  +  V TL   +    D 
Sbjct: 7969 PVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDS 8028

Query: 1249 GIYVCRATNLQGEARCECRLEVR 1271
            G Y+C+A N  GE      L V+
Sbjct: 8029 GEYICKAENSVGEVSASTFLTVQ 8051



 Score = 97.4 bits (241), Expect = 8e-20
 Identities = 105/411 (25%), Positives = 162/411 (39%), Gaps = 57/411 (13%)

Query: 876   LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLP 935
             L V  V+    +L W  P+  G   +  Y VE        WV  ++G     S +V  L 
Sbjct: 29147 LTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVI-VEGECPTLSYVVTRLI 29205

Query: 936   TGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI 995
                  +FRVRA N  GPG PV + EP+  +     P           I ++VG       
Sbjct: 29206 KNNEYIFRVRAVNKYGPGVPVES-EPIVARNSFTIPS-------PPGIPEEVGT------ 29251

Query: 996   PFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPT--------DTILF---IRAARRVHS 1040
                GK    + WTK     G  ++   V  R   +        D +++   ++    +  
Sbjct: 29252 ---GKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEG 29308

Query: 1041  GTYQVTVRIENME-----DKATLVLQVVDK---PSPPQDLRVTDAWGLNVALEWKPPQDV 1092
               YQ  V   N        +A+  +   +    P PP   RV D    +++L W  P   
Sbjct: 29309 CDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYD 29368

Query: 1093  GNTELWGYTVQKADKKTMEWFTVLEH--YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
             G T++ GY ++  +K T +W+ V  +   R T   VP+L +G  Y FRV + N+ G S+ 
Sbjct: 29369 GGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEY 29428

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKP 1210
             + +  E   + R  I          D   A    + +  R   AG +  L  +V G P P
Sbjct: 29429 SESIAEIEPVERIEIP---------DLELADDLKKTVTIR---AGASLRLMVSVSGRPPP 29476

Query: 1211  KISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
              I+W K G+DL   A         +L ++  K   +D G Y   A N  G+
Sbjct: 29477 VITWSKQGIDLASRAIIDTTESYSLLIVD--KVNRYDAGKYTIEAENQSGK 29525



 Score = 95.5 bits (236), Expect = 3e-19
 Identities = 180/840 (21%), Positives = 287/840 (34%), Gaps = 171/840 (20%)

Query: 12   FSKKPRSVEVAAGSPAVFEAE-TERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVRE 70
            F  KP SV++A G    F+   T  A +K+ W +   +I     Y +       TLTV +
Sbjct: 7214 FDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLK 7273

Query: 71   VGPADQGSYAV----IAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAA- 125
            VG  D G Y      IAG       L V E  +    L P+    +      E     + 
Sbjct: 7274 VGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSP 7333

Query: 126  -----------ELGES------------------------------APSPKGSSSAALNG 144
                       E+ ES                              A +  GS+S++ + 
Sbjct: 7334 EIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSL 7393

Query: 145  PTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPV-VKWFKGKWVDLSSKV 203
                 P     +F  +P   E   G  +     + G     PP  V W+K K        
Sbjct: 7394 KVKEPP-----IFRKKPHPIETLKGADVHLECELQGT----PPFHVSWYKDK-------- 7436

Query: 204  GQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG 263
             + L+    Y   S+ +L  +HI +   A  G Y+C+                     T 
Sbjct: 7437 -RELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKA--------------------TN 7475

Query: 264  DLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSK--LEAPAEEDV 321
            D+   +     +L    R +        + D S+++ K    +T  +    +     +D 
Sbjct: 7476 DVGSDTCVGSIALKAPPRFVKK------LSDISTVVGKEVQLQTTIEGAEPISVVWFKDK 7529

Query: 322  WEILRQAPP---SEYERIA-FQYGVTDLRGMLKRLKGMRRDEKKSTAFQ--KKLEPAYQV 375
             EI+R++     S  E IA  Q+   +     K    ++ D      F     LEPA  V
Sbjct: 7530 GEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIV 7589

Query: 376  SKGHKIRLTVE---------LADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQC 426
             K   I++T               +   KW K+G+E+  S +KY          L I   
Sbjct: 7590 EKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELT-SDNKYKISFFNKVSGLKIINV 7648

Query: 427  SLADDAAY----QCVVGGEKCSTELFVKEP--PVLITRPLEDQLVMVGQRVEFECEV-SE 479
            + +D   Y    Q  VG + C+  L V +   P   TR L++   + G  V  EC+V   
Sbjct: 7649 APSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGS 7708

Query: 480  EGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSG----GQAL 535
                V W  +G E++     KY+         L +N     D+G Y    +      +  
Sbjct: 7709 PPISVSWFHEGNEISSGR--KYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECS 7766

Query: 536  AELIVQEKKLEVYQ-SIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVS 593
            A L V+E    V +    D++ G      F   V       V W K   ELVP  R  VS
Sbjct: 7767 APLTVREPPSFVQKPDPMDVLTGTN--VTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVS 7824

Query: 594  HIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLH-FMEVKIDFVPRQEPPKIHLDCP 652
                V +L + DV  +   +Y+ +    A   S   H +++    FV R     I     
Sbjct: 7825 LEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIE---- 7880

Query: 653  GRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWV 712
                       G  L L+   +G P  +V W+K     N  P++                
Sbjct: 7881 ----------KGKPLILEGTFTGTPPISVTWKK--NGINVTPSQ---------------- 7912

Query: 713  FDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVP 772
                       R  + TT+  +I  +  +  ED G Y   ++N  G+D  +  + +++ P
Sbjct: 7913 -----------RCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPP 7961



 Score = 95.1 bits (235), Expect = 4e-19
 Identities = 68/224 (30%), Positives = 97/224 (43%), Gaps = 4/224 (1%)

Query: 391   DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVK 450
             +A V W K G +I  S  K+   + G K  L I+     D+  Y   V G+K S  LFV 
Sbjct: 11512 EANVIWSK-GPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVT 11570

Query: 451   EPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRH 510
                +    PLEDQ V  G+   F CE+S E   V W K+  +L    T       +G+ H
Sbjct: 11571 GIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVL--ISSEGKTH 11628

Query: 511   HLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSD 570
              L + E  L+D            + A+L V E        + D     KD+   KCEVS 
Sbjct: 11629 KLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVS- 11687

Query: 571   ENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
             ++V   W K+G+E+VP  +  +   G    L I      D+ +Y
Sbjct: 11688 KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEY 11731



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 97/413 (23%), Positives = 161/413 (38%), Gaps = 53/413 (12%)

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P  + +++VS  ++++ W PPE  G   +  Y VE      + W    Q +   TSI
Sbjct: 25488 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVAR-TSI 25546

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGA-----------PVTTTEPVTVQEILQRPRLQLPRH 978
              +  L TG+   FRV A N  G  +           P +   P    +++   +  +   
Sbjct: 25547 KIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTM--- 25603

Query: 979   LRQTIQKKVGEPVNLLIPF--QGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAAR 1036
                T Q  V +  + +I +  + K R  + W+K  + L  +   ++ S  D  L      
Sbjct: 25604 -LVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIAD-TQMKVSGLDEGLM----- 25656

Query: 1037  RVHSGTYQVTVRIENME-----DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQD 1091
                   Y+  V  EN+       K+   +   D   PP    VT+    +V+L+W  P  
Sbjct: 25657 ------YEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHY 25710

Query: 1092  VGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
              G  ++ GY V++ +     W      + + T+  V EL     Y FRVF++N       
Sbjct: 25711 DGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSE 25770

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVRGS 1207
              + +  P+ +               D  E P     +  R VI   AG    +   + G 
Sbjct: 25771 PSESTGPIIVK--------------DDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGR 25816

Query: 1208  PKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             P P ISW K+G+++ E AR  + S      L ++     D G YV    N+ G
Sbjct: 25817 PLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG 25869



 Score = 94.0 bits (232), Expect = 8e-19
 Identities = 181/842 (21%), Positives = 305/842 (36%), Gaps = 159/842 (18%)

Query: 3    EPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAG-VKVRWQRGGSDISASNKYGLATEG 61
            EP K P   F  KP S++V AG  A FE     A  +++ W +   +I     Y +   G
Sbjct: 6266 EPKKSPF--FDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVG 6323

Query: 62   TRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAP 121
                L + +VG  D G Y   A ++ V  D+   +    EP        A      GE+ 
Sbjct: 6324 NTPHLRILKVGKGDSGQYTCQA-TNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESI 6382

Query: 122  APAAELGESAPSPKGS-------------------SSAALNGPTPGAPDDPIGLFVMRPQ 162
                ++  S P  K S                   +S AL      + +D  G ++    
Sbjct: 6383 QLECKISGS-PEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDS-GDYICEAH 6440

Query: 163  DGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVG-------------QHLQL 209
            +G      S   + +       KP  V   KG  V L  ++              + ++ 
Sbjct: 6441 NGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRN 6500

Query: 210  HDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLS 269
               +   SK +   LHI + + +  G Y C+ + +   D  + ++   E           
Sbjct: 6501 SKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFV------ 6554

Query: 270  AFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAP 329
                       +++SD+   T I D   L    + F+      +     +D  E++R+  
Sbjct: 6555 -----------KKLSDT--STLIGDAVELRAIVEGFQP-----ISVVWLKDRGEVIRE-- 6594

Query: 330  PSEYERIAF-------QYGVTDLRGMLKRLKGMRRDE--KKSTAFQKKLEPAYQVSKGHK 380
             SE  RI+F       Q G  +     K +  ++ D   ++ +A    LEPA  + K   
Sbjct: 6595 -SENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEP 6653

Query: 381  IRLT---------VELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADD 431
            + +T         V     +   KW K+G+E+  + SK+    I    +L I    ++D 
Sbjct: 6654 MTVTTGNPFALECVVTGTPELSAKWFKDGRELS-ADSKHHITFINKVASLKIPCAEMSDK 6712

Query: 432  AAYQCVV----GGEKCSTELFVKE---PPVLITRPLEDQLVMVGQRVEFECEVSEEGA-Q 483
              Y   V    G   C+  + V +   PP  I R L+D   ++G  V  EC VS      
Sbjct: 6713 GLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFI-RKLKDVNAILGASVVLECRVSGSAPIS 6771

Query: 484  VKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLE--DAGHY----ALCTSGGQALAE 537
            V W +DG E+      +  F ++       +N ++LE  D G Y    A      +  A 
Sbjct: 6772 VGWFQDGNEIVSGPKCQSSFSENV----CTLNLSLLEPSDTGIYTCVAANVAGSDECSAV 6827

Query: 538  LIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGV------WLKNGKELVPDSRIK 591
            L VQE     ++   D +      ++    V    +RG       W K  +ELVP     
Sbjct: 6828 LTVQEPPS--FEQTPDSVEVLPGMSLTFTSV----IRGTPPFKVKWFKGSRELVPGESCN 6881

Query: 592  VSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLH-FMEVKIDFVPRQEPPKIHLD 650
            +S    V +L + +V P +  DYS +    A + S   H F++    FV R         
Sbjct: 6882 ISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLA------- 6934

Query: 651  CPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDE 710
                      V  G+ + L+   +G P  +V                             
Sbjct: 6935 -------DFSVETGSPIVLEATYTGTPPISV----------------------------S 6959

Query: 711  WVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID 770
            W+ D+ L+ ++E R  +  T+  +I  +  +  ED   Y+  ++N  G+D     V V++
Sbjct: 6960 WIKDEYLISQSE-RCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLE 7018

Query: 771  VP 772
             P
Sbjct: 7019 PP 7020



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 98/428 (22%), Positives = 164/428 (38%), Gaps = 61/428 (14%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P  +  ++V+  +++L W PP+  G   ++ Y VE      + W   +      T
Sbjct: 22242 GPPTGPVKM--DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVART 22298

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQ----LPRHLRQTI 983
             +I    L TG    FR+ A N  G    + + EP   Q   + P       +    R ++
Sbjct: 22299 TIKACRLKTGCEYQFRIAAENRYGKSTYLNS-EPTVAQYPFKVPGPPGTPVVTLSSRDSM 22357

Query: 984   QKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
             + +  EP++      +    + K R  + W K           +  +P     F +    
Sbjct: 22358 EVQWNEPISDGGSRVIGYHLERKERNSILWVK-----------LNKTPIPQTKF-KTTGL 22405

Query: 1038  VHSGTYQVTVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
                  Y+  V  EN+          +  +     D P  P+ + VT     +V L+WK P
Sbjct: 22406 EEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRN---SVTLQWKKP 22462

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF- 1147
                G +++ GY V+K +     W      +   TH  V  L+  + Y FRV ++N  G  
Sbjct: 22463 TYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVF 22522

Query: 1148  -----SDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCC 1202
                  S  A T ++ V  PR               S  P +   +V   V AG +  +  
Sbjct: 22523 SEPSESTGAITARDEVDPPR--------------ISMDPKYKDTIV---VHAGESFKVDA 22565

Query: 1203  AVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEA 1262
              + G P P I W K   +L   AR  + S     +L ++     D G Y+ +A N+ GE 
Sbjct: 22566 DIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGER 22625

Query: 1263  RCECRLEV 1270
                  ++V
Sbjct: 22626 SVTVNVKV 22633



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 114/418 (27%), Positives = 156/418 (37%), Gaps = 43/418 (10%)

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGC--SEWVAALQGLTEHT 927
             P  P +   ED+  T+V  KW PP   G   +  Y++E   +    SEW+     L  H 
Sbjct: 14802 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTL-RHC 14860

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
                V  L  G   LFRVRA N  GPG P  + +P+  ++    P             K +
Sbjct: 14861 KYSVTKLIEGKEYLFRVRAENRFGPGPPCVS-KPLVAKDPFGPP---------DAPDKPI 14910

Query: 988   GEPV--NLLIPFQGKPR----PQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSG 1041
              E V  N ++    +P+    P + +  E + +     S  N      L       +   
Sbjct: 14911 VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGL 14970

Query: 1042  TYQVTVRIENMEDKATL--------VLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
             TY   V  EN                   +  P PP   RVTD     + LEW+PP   G
Sbjct: 14971 TYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNG 15029

Query: 1094  NTELWGYTVQKADKKTMEWFTVLEHYRRTH-CVVPELIIGNGYYFRVFSQNMVGFSDRAA 1152
               E+ GY V K    T EW    E   +     V E+  G  Y  RV + N  G      
Sbjct: 15030 GGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGE 15089

Query: 1153  TTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKI 1212
             T  +PV +  P    EPP  + LD S             ++AG T  +   V G P P  
Sbjct: 15090 T--QPVTVAEP---QEPPAVE-LDVSVKGGI-------QIMAGKTLRIPAVVTGRPVPTK 15136

Query: 1213  SWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
              W K   +L +D R  + +      L I+     D G YV  ATN  G      R+EV
Sbjct: 15137 VWTKEEGELDKD-RVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 15193



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 101/405 (24%), Positives = 158/405 (39%), Gaps = 35/405 (8%)

Query: 867   IGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
             +G P  PT  +  ++V+   ++LKW PP+  G   +  Y +E      ++WV     + +
Sbjct: 20073 VGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAV-Q 20131

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGA-----PVTTTEPVTVQEILQRPRLQLPRH-- 978
              T+  V  L  G    FRV A N  G G      P+    P  V +    P +   RH  
Sbjct: 20132 KTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDS 20191

Query: 979   --LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQ-PLAGEEVSIRNSPTDTILFIRAA 1035
               L  T  KK G         + K R  + W +  + P+   +  +           R  
Sbjct: 20192 VSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVM 20251

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
                 +G     V   ++  +  + L  +D P  P+ + +T     +V L W  P+  G  
Sbjct: 20252 AINLAG-----VGKPSLPSEPVVALDPIDPPGKPEVINITRN---SVTLIWTEPKYDGGH 20303

Query: 1096  ELWGYTVQKADKKTMEWFTVLEHYRRTHCV--VPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
             +L GY V+K D  +  W     H     C   V +L+ G  Y FR+ ++N  G     + 
Sbjct: 20304 KLTGYIVEKRDLPSKSWMKA-NHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 20362

Query: 1154  TKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML-CCAVRGSPKPKI 1212
             + E +        YE P    LD    P+    L   ++ AG T +L   ++ G P PK 
Sbjct: 20363 STETIICKDE---YEAPTI-VLD----PTIKDGL---TIKAGDTIVLNAISILGKPLPKS 20411

Query: 1213  SWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
             SW K G D+      ++ S      L I+     D G Y   ATN
Sbjct: 20412 SWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATN 20456



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 101/396 (25%), Positives = 150/396 (37%), Gaps = 54/396 (13%)

Query: 393  EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELF 448
            +V W K+ +EI+ SG KY    +     LT+ +    D   Y C     VG + C+ +L 
Sbjct: 8183 KVSWAKDSREIR-SGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLN 8241

Query: 449  VKE---PPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFK 504
            +KE   PP    R  E      G   + E  V+  +   V W K+ +E+      +  FK
Sbjct: 8242 IKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFK 8301

Query: 505  KDGQRHHLIINEAMLEDAGHYALCTSG--GQAL--AELIVQE-KKLEVY-QSIADLMVGA 558
             +     L + +A + DAG Y    S   G AL  + ++++E KK  V+ Q +  + V  
Sbjct: 8302 NNTLV--LQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSE 8359

Query: 559  KDQAVFKCEVS-DENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV 617
             +     C V   E +R  WLK G+E+ P  R   S       L + DV  AD  DY   
Sbjct: 8360 GEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCK 8419

Query: 618  PEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRI-----PDTIVVVAGNKLRLDVP 672
                A + + K    +V I   P   P        GR+     P +I VV          
Sbjct: 8420 ASNVAGSDTTK---SKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAK 8476

Query: 673  ISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKD 732
            + GDP P V W K                             K       GRV +    D
Sbjct: 8477 VGGDPIPNVKWTKG----------------------------KWRQLNQGGRVFIHQKGD 8508

Query: 733  RSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
             +   +    K D G+Y     N  GE + N+ ++V
Sbjct: 8509 EAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQV 8544



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 65/244 (26%), Positives = 113/244 (46%), Gaps = 6/244 (2%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            +V +G  ++L V+++    E  W+K+GQE+Q S   +I         L I   +  D   
Sbjct: 2366 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID-KQSHMLLIEDMTKEDAGN 2424

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVE 492
            Y   +     ST   V    V +  PL+D  V+ G +   EC+VS  +   VKW  +  +
Sbjct: 2425 YSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQ 2484

Query: 493  LTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIA 552
            +  ++  +   K  G +  L+IN     D G Y L     +    L V+  K+++ + + 
Sbjct: 2485 IKPDDRVQAIVK--GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLR 2540

Query: 553  DLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEA 612
            DL        VF+ E+S   +  +W    KE+ P S+ K+   G+++KLT+ ++   DE 
Sbjct: 2541 DLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEG 2600

Query: 613  DYSF 616
             Y+F
Sbjct: 2601 KYTF 2604



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 107/447 (23%), Positives = 169/447 (37%), Gaps = 74/447 (16%)

Query: 846   VYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYS 905
             V A N+ G +  + +       GPP  P     ++VS   V + W PP   G   +  Y 
Sbjct: 24384 VTATNSAGTATENLSVIVLEKPGPPVGPVRF--DEVSADFVVISWEPPAYTGGCQISNYI 24441

Query: 906   VEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
             VE      + W   +      T+I +  L TG    FR+ A N  G  AP+ + + V VQ
Sbjct: 24442 VEKRDTTTTTW-HMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDS-KAVIVQ 24499

Query: 966   EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSI 1021
                + P                G P    +    K +  V W +     G  + G  +  
Sbjct: 24500 YPFKEP----------------GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQ 24543

Query: 1022  RNSPTDTILFIRAARRVHSGT------------YQVTVRIENME--------DKATLVLQ 1061
             +    ++IL+++  +     T            Y+  V  EN+          +  +   
Sbjct: 24544 KEK--NSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD 24601

Query: 1062  VVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYR 1120
               D P  P+ + +T     NV L+WK P   G +++ GY V+K D     W      +  
Sbjct: 24602 PCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVL 24658

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGF------SDRAATTKEPVFIPRPGITYEPPNYKA 1174
              T   V  L+    Y FRV ++N  G       S  A T ++ +  P   +    P YK 
Sbjct: 24659 ETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLD---PKYKD 24715

Query: 1175  LDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGED-ARFRMFSKQ 1233
             +                V AG T +L   +RG P P + W K+G +L E  AR  + S  
Sbjct: 24716 VIV--------------VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTI 24761

Query: 1234  GVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                TL ++     DGG Y+ + +N+ G
Sbjct: 24762 QKTTLVVKDCIRTDGGQYILKLSNVGG 24788



 Score = 90.9 bits (224), Expect = 7e-18
 Identities = 68/227 (29%), Positives = 112/227 (49%), Gaps = 8/227 (3%)

Query: 386   ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSL--ADDAAYQCVVGGEKC 443
             E+++ D   +W   G+ ++ S +  I ++ G KR LT+ +  L  A +  YQ +      
Sbjct: 11419 EISEADIPGQWKLKGELLRPSPTCEI-KAEGGKRFLTLHKVKLDQAGEVLYQAL--NAIT 11475

Query: 444   STELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRF 503
             +  L VKE  +    PL+D  V   ++  FEC ++ E A V W K G ++ +    K+  
Sbjct: 11476 TAILTVKEIELDFAVPLKDVTVPERRQARFECVLTRE-ANVIWSK-GPDIIKSSD-KFDI 11532

Query: 504   KKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAV 563
               DG++H L+IN++  +D G Y     G +  A L V   +L+    + D  V   + A 
Sbjct: 11533 IADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETAT 11592

Query: 564   FKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPAD 610
             F CE+S E +  VW KN  +L     + +S  G+ HKL + +VT  D
Sbjct: 11593 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDD 11639



 Score = 90.5 bits (223), Expect = 9e-18
 Identities = 108/430 (25%), Positives = 157/430 (36%), Gaps = 64/430 (14%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP  P    + D+     SL W  P   G   +  Y VE C     +WV AL  +T+ T
Sbjct: 18993 GPPQPP--FDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTK-T 19049

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
             S  V  L  G   +FRVRA N  G   P+T+                 P+ + Q      
Sbjct: 19050 SCRVGKLIPGQEYIFRVRAENRFGISEPLTS-----------------PKMVAQFPFGVP 19092

Query: 988   GEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARR-VHSGT 1042
              EP N  +    K    V W +     G P+ G    I     +++L+++A    V S  
Sbjct: 19093 SEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG--YLIERKERNSLLWVKANDTLVRSTE 19150

Query: 1043  YQVTVRIENME----------------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEW 1086
             Y     +E +E                 K T  +       PP    V D     V+L W
Sbjct: 19151 YPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIW 19210

Query: 1087  KPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNG------YYFRVF 1140
               P+  G +++ GY V+       +W   +      H +  E     G      Y FR  
Sbjct: 19211 ARPKHDGGSKIIGYFVEACKLPGDKW---VRCNTAPHQIPQEEYTATGLEEKAQYQFRAI 19267

Query: 1141  SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200
             ++  V  S  +  + +PV I    +   PP    +D S A          +V AG    L
Sbjct: 19268 ARTAVNISPPSEPS-DPVTILAENV---PPR---IDLSVAMKSLL-----TVKAGTNVCL 19315

Query: 1201  CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                V G P P +SW K+G  L      +M  ++ + TLE+      D G Y   A N  G
Sbjct: 19316 DATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSG 19375

Query: 1261  EARCECRLEV 1270
                   +L+V
Sbjct: 19376 SKSATIKLKV 19385



 Score = 90.5 bits (223), Expect = 9e-18
 Identities = 111/461 (24%), Positives = 182/461 (39%), Gaps = 71/461 (15%)

Query: 727   VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG---EDQVNLTVKVIDVPDAPAAPKISNV 783
             ++ TK ++    EG E E    + V+ +N VG     +V+      D  D P  P+   +
Sbjct: 24559 IQDTKFKTTGLDEGLEYE----FKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVI 24614

Query: 784   GEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYE 843
               ++ T++W+ PAYDGG  I GYI+E+K     RWM+ +F  + E       ++E   YE
Sbjct: 24615 TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYE 24674

Query: 844   MRVYAVNAIG-MSRPSPASQPFM---PIGPPSEPTHLAVEDV-----SDTTV---SLKWR 891
              RV A NA G  S PS +S        I  P+       +DV      +T V    ++ +
Sbjct: 24675 FRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGK 24734

Query: 892   PPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG 951
             P   V     DG  +E            ++   + T+++VKD        + ++  N+ G
Sbjct: 24735 PIPDV-VWSKDGKELEETAARME-----IKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 24788

Query: 952   PGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN-LLIPFQGKPRPQVTWTKE 1010
                  T + P+TV ++L RP                G P   L +      +  + W   
Sbjct: 24789 -----TKSIPITV-KVLDRP----------------GPPEGPLKVTGVTAEKCYLAWNPP 24826

Query: 1011  GQPLAGEEVS---IRNSPTDTILFIRAARRVHSGTYQVTVRI------------------ 1049
              Q   G  +S   I    T  + + + +  V +  Y+VT  +                  
Sbjct: 24827 LQD-GGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIG 24885

Query: 1050  ENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
             E +E            P PP    V+     ++ + W  P D G TE+ GY ++K DK+ 
Sbjct: 24886 EPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEG 24945

Query: 1110  MEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             + W     +        V  L  G+ Y FRV ++N  G  +
Sbjct: 24946 VRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGE 24986



 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 197/936 (21%), Positives = 332/936 (35%), Gaps = 181/936 (19%)

Query: 394  VKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQC----VVGGEKCSTELFV 449
            ++W K  +E+   GS YI +    + +L +     +D   Y C    V GG +CS  LFV
Sbjct: 4237 IRWFKGNKELVSGGSCYITKE-ALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFV 4295

Query: 450  KEPPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQ 508
            KEP   + +    QL+  G   +  C+V+     ++ W  +  E+  +E+ K+R      
Sbjct: 4296 KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREI--KESSKHRMSFVES 4353

Query: 509  RHHLIINEAMLEDAGHYALCTSGGQALAE-----LIVQE--------KKLEVYQSIADLM 555
               L + +  +ED+G Y +C +  +A ++     +IV+E        K +EV +   D+M
Sbjct: 4354 TAVLRLTDVGIEDSGEY-MCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEY-DVM 4411

Query: 556  VGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYS 615
            + A+       E++       W K+   L    + K      +  L I     AD  +Y 
Sbjct: 4412 LLAEVAGTPPFEIT-------WFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQ 4464

Query: 616  FVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISG 675
                   C ++ ++           R+ P  I      +I  T  +  G        + G
Sbjct: 4465 -------CRVTNEVGSSICSARVTLREPPSFIK-----KIESTSSL-RGGTAAFQATLKG 4511

Query: 676  DPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSI 735
                TV W K                     DSDE   D  +    E  V        S+
Sbjct: 4512 SLPITVTWLK---------------------DSDEITEDDNIRMTFENNVA-------SL 4543

Query: 736  FTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV------------IDVPDA-PAAPKISN 782
            + + G E + +G Y    KN  G  + +  + V            IDV    PA  ++  
Sbjct: 4544 Y-LSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKF 4602

Query: 783  VGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVY 842
             G    T +W     DG +  LG     K K S        D +  L   +    +   Y
Sbjct: 4603 SGTKEITAKWFK---DGQELTLG----SKYKISVT------DTVSILKIISTEKKDSGEY 4649

Query: 843  EMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVED-------------VSDTTVSLK 889
               V   N +G S           I PPS    L   D                  +S++
Sbjct: 4650 TFEVQ--NDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQ 4707

Query: 890  W-RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
            W +  + + A   + Y   +        ++ L+G    T              +   A N
Sbjct: 4708 WFKDDQEISAS--EKYKFSFHDNTAFLEISQLEGTDSGT--------------YTCSATN 4751

Query: 949  MAGPG---APVTTTEPVTVQEILQRPRLQ-LPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
             AG       +T  EP      +++P+ Q +  + R  ++  VG          G     
Sbjct: 4752 KAGHNQCSGHLTVKEP---PYFVEKPQSQDVNPNTRVQLKALVG----------GTAPMT 4798

Query: 1005 VTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTY--QVTVRIENMEDKATLVL- 1060
            + W K+ + L +G   S+    T T L + AA+   SGTY  Q++  +     KATL + 
Sbjct: 4799 IKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVK 4858

Query: 1061 ---QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
               Q + KPSP   LR   +      +   P   V +  L G  +    K  + +   L 
Sbjct: 4859 EPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRV-SWYLDGNEITAIQKHGISFIDGLA 4917

Query: 1118 HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDF 1177
             ++     +    + N   +   ++N  G +  +   K                      
Sbjct: 4918 TFQ-----ISGARVENSGTYVCEARNDAGTASCSIELK---------------------V 4951

Query: 1178 SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             E P+F + L    V+      L C V G+P  +++W KN  ++    ++ +  +  V  
Sbjct: 4952 KEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFN 5011

Query: 1238 LEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
            L I K  P D G Y C  +N  G   C  R+ ++ P
Sbjct: 5012 LHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEP 5047



 Score = 89.0 bits (219), Expect = 3e-17
 Identities = 135/650 (20%), Positives = 234/650 (36%), Gaps = 98/650 (15%)

Query: 661   VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD------------APEDTGDS 708
             V A NK  +  P+  DP   V+ Q   T  + AP  P P              PE  G S
Sbjct: 28126 VSAVNKFGVGRPLDSDP---VVAQIQYTVPD-APGIPEPSNITGNSITLTWARPESDGGS 28181

Query: 709   D--EWVFDKKLLCETEGRVRVETTKDRSI----FTVEGAEKEDEGVYTVTVKNPVGEDQV 762
             +  +++ +++   E +    V+    R I    F V G  + +E  + V  +N  G    
Sbjct: 28182 EIQQYILERR---EKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPA 28238

Query: 763   NLTVKVI------DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSY 816
             +   ++I      + P  P   K+++  + + +++W  P +DGG  I+GYI+E  K    
Sbjct: 28239 SGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLG 28298

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIG----------MSRPSPASQPFMP 866
              W ++N +   +  +    +  G  Y+ RV A+N  G          +      + P + 
Sbjct: 28299 DWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELD 28358

Query: 867   IGPPSEPTHLAVEDVS---------DTTVSLKWRPPE-----RVGAGGLDGYSVEYCPEG 912
             I    + TH+     S           T +  W  P+     R      D +S     E 
Sbjct: 28359 IDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-LTVEN 28417

Query: 913   CSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQ--R 970
             C+   A    LT      V++      + F V+  +  GP  P+T  +       L    
Sbjct: 28418 CNRNDAGKYTLT------VENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDA 28471

Query: 971   PRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTIL 1030
             P L     +   + +K             +   + +W    +    +   + +       
Sbjct: 28472 PLLDGGARIHHYVVEK-------------REASRRSWQVISEKCTRQIFKVNDLAEGVPY 28518

Query: 1031  FIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQ 1090
             + R +       Y V    E  E      +   ++P+PP+ L V D    +  L W  P 
Sbjct: 28519 YFRVSA---VNEYGVGEPYEMPEP-----IVATEQPAPPRRLDVVDTSKSSAVLAWLKPD 28570

Query: 1091  DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
               G + + GY ++   K +  W     H ++    V  L+    Y FRV ++N  G+S+ 
Sbjct: 28571 HDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEP 28629

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKP 1210
                    V I  P I  EP        ++    T  L+     AG    +   + G P P
Sbjct: 28630 REAFSS-VIIKEPQI--EPT-------ADLTGITNQLITCK--AGSPFTIDVPISGRPAP 28677

Query: 1211  KISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             K++W    + L E  R  + + +   TL ++     D G Y     N  G
Sbjct: 28678 KVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAG 28727



 Score = 88.2 bits (217), Expect = 5e-17
 Identities = 100/421 (23%), Positives = 169/421 (40%), Gaps = 41/421 (9%)

Query: 359  EKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAK 418
            E +   F+K ++    + K  +     E+++ D  V+W+K+ QE+Q++    I +     
Sbjct: 3054 EARHIEFRKHIKDIKVLEK-KRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVH 3112

Query: 419  RTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVS 478
            R L I    ++D   Y  V GG   + +LFV+   V I    ++  V+  QR   E EV+
Sbjct: 3113 RLL-IPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVN 3171

Query: 479  EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAEL 538
            E+     W KDG+E+  +   ++++  + + H + I+E    DAG Y       ++   L
Sbjct: 3172 EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL 3231

Query: 539  IVQ-EKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIG 596
             V   +  +V Q +  + V +   A F   +S      + W K  + L    + K  H G
Sbjct: 3232 YVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDG 3291

Query: 597  RVHKLTIDDVTPADEADYSFVPEG--FACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGR 654
            + + L + +  P D A Y+   +        SA L  +EV     P QE P         
Sbjct: 3292 QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLS-VEVPEVVSPDQEMPVYPPAIITP 3350

Query: 655  IPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFD 714
            + DT V   G   R    +SG       + K                            D
Sbjct: 3351 LQDT-VTSEGQPARFQCRVSGTDLKVSWYSK----------------------------D 3381

Query: 715  KKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV-IDVPD 773
            KK+  +     R+   +D     +  A  EDEG YT    N VG  QV+ T  + ++ P+
Sbjct: 3382 KKI--KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVG--QVSSTANLSLEAPE 3437

Query: 774  A 774
            +
Sbjct: 3438 S 3438



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 71/263 (26%), Positives = 119/263 (45%), Gaps = 10/263 (3%)

Query: 375  VSKGHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            V +G K  L  +++  D   VKW  N ++I+           G K+ L I++   +D+  
Sbjct: 2456 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVK-GTKQRLVINRTHASDEGP 2514

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
            Y+ +VG  + +  L V++  + I R L D      Q V FE E+S  G  V W     E+
Sbjct: 2515 YKLIVGRVETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEI 2572

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIAD 553
              + + KY+ +  G+ + L +   M +D G Y           +L V    +   + + D
Sbjct: 2573 --KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPLTD 2628

Query: 554  LMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
              V    +AVF+CEV++ + +G WL++GK L   + I+    G   +L I      D  +
Sbjct: 2629 QTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGE 2688

Query: 614  YSFVPEGFACNLSAKLHFMEVKI 636
            Y++  +      SAKL    VKI
Sbjct: 2689 YTY--KVATSKTSAKLKVEAVKI 2709



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 156/799 (19%), Positives = 296/799 (37%), Gaps = 121/799 (15%)

Query: 1     MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASN--KYGLA 58
             +P      ++ F K   S E+A  +  V E+   RA  +V W + G  +  +   ++  +
Sbjct: 32712 LPVSAPPKITQFLKAEASKEIAKLT-CVVESSVLRAK-EVTWYKDGKKLKENGHFQFHYS 32769

Query: 59    TEGTRHTLTVREVGPADQGSYAVI----AGSSKVKFDLKVIEAEKAEPMLAPAPAPAEAT 114
              +GT + L +  +  +DQG Y        G+SK                        +A 
Sbjct: 32770 ADGT-YELKINNLTESDQGEYVCEISGEGGTSKTNLQFM-----------------GQAF 32811

Query: 115   GAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIG---LFVMRPQDGEVTVGGS 171
              +  E  +  +E  +S    K + S       P AP+ PI    + V   QD  V+    
Sbjct: 32812 KSIHEKVSKISETKKS--DQKTTESTVTRKTEPKAPE-PISSKPVIVTGLQDTTVSSDSV 32868

Query: 172   ITFSARVAGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQ 230
               F+ +  G      P   W K GK +    K         S D+    +  E+H TD  
Sbjct: 32869 AKFAVKATGEPR---PTAIWTKDGKAITQGGKYKL------SEDKGG--FFLEIHKTDTS 32917

Query: 231   PAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDT 290
              +  G Y C V        S+  LT+ +A+   +   +S  + + +    + +       
Sbjct: 32918 DS--GLYTCTVKNSAGSVSSSCKLTI-KAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQ 32974

Query: 291   GILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLK 350
               L  S  +K  ++    + +  E  ++  + E ++++  +  E+      +T       
Sbjct: 32975 KALR-SEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKT----- 33028

Query: 351   RLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKY 410
                    +E ++ A  K       +++G ++ L   +A    +VKW+ NG E+  S  +Y
Sbjct: 33029 ---SQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA-TDVKWVLNGVELTNS-EEY 33083

Query: 411   IFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELF----VKEPPVLITRPLED 462
              +   G+ +TLTI Q S  D+    C+     G  KC  +L     + + P  I++P   
Sbjct: 33084 RYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP-RS 33142

Query: 463   QLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLED 521
             Q +  GQ V F CE+S E   +++W K+ + ++          +    + L I  A + D
Sbjct: 33143 QNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS--ISRSRNVYSLEIRNASVSD 33200

Query: 522   AGHYAL--------CTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENV 573
             +G Y +        C++    +   +V+E   EV       ++        +   S ++V
Sbjct: 33201 SGKYTIKAKNFRGQCSATASLMVLPLVEEPSREV-------VLRTSGDTSLQGSFSSQSV 33253

Query: 574   RGVWLKNGKELVPDSRIKVSHIGRVH--KLTIDDVTPADEADYSFVPEGF--ACNLSAKL 629
             +    K        S    S +  +    ++   ++   E+        F    N++   
Sbjct: 33254 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLE 33313

Query: 630   HFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQ 689
                   +    R  PPKI       +P  I +  G  L +    +G+P P V W      
Sbjct: 33314 SSTSKMLKAGIRGIPPKIE-----ALPSDISIDEGKVLTVACAFTGEPTPEVTWSCG--- 33365

Query: 690   GNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVY 749
                                      +K+  + +GR  +E T D +   +   +K+D G+Y
Sbjct: 33366 ------------------------GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLY 33401

Query: 750   TVTVKNPVGEDQVNLTVKV 768
             T+++ N  G D   + + +
Sbjct: 33402 TLSLGNEFGSDSATVNIHI 33420



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 67/265 (25%), Positives = 115/265 (43%), Gaps = 6/265 (2%)

Query: 375   VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY 434
             V +G       EL+     V W KN  ++  S +  +  S G    L + + +L D +  
Sbjct: 11585 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRT-VLISSEGKTHKLEMKEVTLDDISQI 11643

Query: 435   QCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELT 494
             +  V     + +L V E     T  L D+  +    +  +CEVS++   VKW KDG E+ 
Sbjct: 11644 KAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKD-VPVKWFKDGEEIV 11702

Query: 495   REETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADL 554
                  KY  K DG R  L I +A L+D G Y       +  A + V+ + ++V + +  +
Sbjct: 11703 PSP--KYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGV 11760

Query: 555   MVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
              V   + A F+ E+S+ +V G W   G+ L      ++   G+ H L + +       + 
Sbjct: 11761 EVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEV 11820

Query: 615   SFVPEGFACNLSAKLHFMEVKIDFV 639
             SF  +      +A L   E+ + F+
Sbjct: 11821 SF--QAANAKSAANLKVKELPLIFI 11843



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 99/420 (23%), Positives = 160/420 (38%), Gaps = 56/420 (13%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAK 418
            K+   F ++L+P  +V K   + L  E+      EV WLKN +EI+ S  KY      + 
Sbjct: 4952 KEPPTFIRELKPV-EVVKYSDVELECEVTGTPPFEVTWLKNNREIR-SSKKYTLTDRVSV 5009

Query: 419  RTLTISQCSLADDAAYQCVVGGE----KCSTELFVKEPPVLITRPLEDQLVMVGQRVEFE 474
              L I++C  +D   YQC+V  E     CST + +KEPP  I + +E+   ++     F+
Sbjct: 5010 FNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKK-IENTTTVLKSSATFQ 5068

Query: 475  CEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHY---ALCTS 530
              V+      + WLKD   L  ++     F        L I       +G Y   A   S
Sbjct: 5069 STVAGSPPISITWLKDDQILDEDDNVYISFVDSVAT--LQIRSVDNGHSGRYTCQAKNES 5126

Query: 531  GGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDE-NVRGVWLKNGKELVPDSR 589
            G +     ++ ++  ++ +    + V  KD    +C V+    ++  WLK+GK++VP   
Sbjct: 5127 GVERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRY 5186

Query: 590  IKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHL 649
              +S    V    I  V   D   Y+F  E    + S   +   +  +  P        +
Sbjct: 5187 FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKM 5246

Query: 650  DCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSD 709
            D           V G+ + ++  +SG    +  W K              D  E      
Sbjct: 5247 D----------KVLGSSIHMECKVSGSLPISAQWFK--------------DGKE------ 5276

Query: 710  EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN--LTVK 767
                       T  + R+   +      V   E ED   YT  V N  G+D  +  LTVK
Sbjct: 5277 ---------ISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVK 5327



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 103/436 (23%), Positives = 166/436 (38%), Gaps = 67/436 (15%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAK 418
            K+   F+KK  P  +  KG  + L  EL       V W K+ +E++ SG KY   S    
Sbjct: 7396 KEPPIFRKKPHPI-ETLKGADVHLECELQGTPPFHVSWYKDKRELR-SGKKYKIMSENFL 7453

Query: 419  RTLTISQCSLADDAAYQCV----VGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFE 474
             ++ I     AD   YQC     VG + C   + +K PP  + + L D   +VG+ V+ +
Sbjct: 7454 TSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKK-LSDISTVVGKEVQLQ 7512

Query: 475  CEVSEEGAQ---VKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSG 531
              +  EGA+   V W KD  E+ RE    +    +     L  +     +AG Y      
Sbjct: 7513 TTI--EGAEPISVVWFKDKGEIVRESDNIWISYSENIAT-LQFSRVEPANAGKYTCQIKN 7569

Query: 532  GQALAELIVQEKKLE---VYQSIADLMVGAKDQAVFKCEVSDE-NVRGVWLKNGKELVPD 587
               + E       LE   + +    + V   D    +C V+    +   W K+GKEL  D
Sbjct: 7570 DAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSD 7629

Query: 588  SRIKVSHIGRVHKLTIDDVTPADEADYSFVPEG----FACNLSAKLHFMEVKIDFVPRQE 643
            ++ K+S   +V  L I +V P+D   YSF  +      +C  S ++    V   F  + +
Sbjct: 7630 NKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLK 7689

Query: 644  PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
                              ++G+ + ++  + G P  +V W     +GN+           
Sbjct: 7690 ETN--------------GLSGSSVVMECKVYGSPPISVSW---FHEGNEI---------- 7722

Query: 704  DTGDSDEWVFDKKLLCETEGRVRVETTKDRS-IFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                             + GR    T  D +   TV   E+ D G YT    N  G D+ 
Sbjct: 7723 -----------------SSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDEC 7765

Query: 763  NLTVKVIDVPDAPAAP 778
            +  + V + P     P
Sbjct: 7766 SAPLTVREPPSFVQKP 7781



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 106/418 (25%), Positives = 147/418 (35%), Gaps = 55/418 (13%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P  +  ++VS   V+  W PPE  G   +  Y VE      + WV  L      T
Sbjct: 21160 GPPTGP--IKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVE-LATTVIRT 21216

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTT-----EPVTVQEILQRPRLQLPRHLRQT 982
             +     L TG    FRV+A N  G G  +T+       P  V      P++        T
Sbjct: 21217 TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTAVTKDSMT 21276

Query: 983   IQ-----KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
             I         G P+ L    + K R  + W    + L    +   +  TD I        
Sbjct: 21277 ISWHEPLSDGGSPI-LGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGI-------- 21327

Query: 1038  VHSGTYQVTVRIENMEDKAT--------LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
                  Y+  V  ENM  K+         L L  +D P  P  L +T      V L+W  P
Sbjct: 21328 ----AYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRH---TVTLKWAKP 21380

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS 1148
             +  G  ++  Y V+K D     W      +       V  L     Y FRV ++N     
Sbjct: 21381 EYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKN----- 21435

Query: 1149  DRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVR 1205
               AA    P   P   IT         D  EAP     +  +  +   AG    L   V 
Sbjct: 21436 --AAGAISPPSEPSDAITCR-------DDVEAPKIKVDVKFKDTVILKAGEAFRLEADVS 21486

Query: 1206  GSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             G P P + W K+G +L   A+  +        L  +     D G Y   ATN  G A+
Sbjct: 21487 GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAK 21544



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 99/432 (22%), Positives = 160/432 (37%), Gaps = 45/432 (10%)

Query: 846   VYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYS 905
             +   N +G    S          PP  P     +DVS  +++L W PP   G   +  Y 
Sbjct: 23302 ITVANVVGQKTASIEIVTLDKPDPPKGPVKF--DDVSAESITLSWNPPLYTGGCQITNYI 23359

Query: 906   VEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
             V+      + W   +      T++ V  L TG    FR+ A N  G    + + +P+  Q
Sbjct: 23360 VQKRDTTTTVW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES-DPIVAQ 23417

Query: 966   EILQRPRLQ----LPRHLRQTIQKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLA 1015
                + P            + ++  +  EPVN      +    + K R  + WTK  + + 
Sbjct: 23418 YPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTII 23477

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVT 1075
              +      +  + I +     RV++    V V   +   +  +     D P  P+ + V 
Sbjct: 23478 HDTQFKAQNLEEGIEY---EFRVYAENI-VGVGKASKNSECYVARDPCDPPGTPEPIMVK 23533

Query: 1076  DAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNG 1134
                   + L+W  P   G + + GY V+K D     W      +   T   V  L     
Sbjct: 23534 RN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQR 23590

Query: 1135  YYFRVFSQNMVGFSDRAA------TTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLV 1188
             Y FRV ++N  G   + +      T K+ V +PR               S  P F   +V
Sbjct: 23591 YEFRVIAKNAAGAISKPSDSTGPITAKDEVELPR--------------ISMDPKFRDTIV 23636

Query: 1189  NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDG 1248
                V AG T  L   V G P P I W +   ++ E AR  + +      L ++     DG
Sbjct: 23637 ---VNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 23693

Query: 1249  GIYVCRATNLQG 1260
             G Y+ RA+N+ G
Sbjct: 23694 GQYILRASNVAG 23705



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 109/404 (26%), Positives = 150/404 (37%), Gaps = 61/404 (15%)

Query: 847   YAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSV 906
             Y V A   +    A      +  P    +L + DVS    ++ W PPE  G   +  Y +
Sbjct: 18274 YVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYIL 18333

Query: 907   EYCPEGCSEWVA-ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
             E C      W   +   LT  T+  V  L  G   +FRVRA N  G G P T ++PV   
Sbjct: 18334 EKCETKRMVWSTYSATVLTPGTT--VTRLIEGNEYIFRVRAENKIGTGPP-TESKPV--- 18387

Query: 966   EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAG----- 1016
                          + +T   K G P    +    K    V W       G+ + G     
Sbjct: 18388 -------------IAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEK 18434

Query: 1017  -EEVSIRNSPTDTILFIRAARRVHS----GTYQVTVRIEN--------MEDKATLVLQVV 1063
              E+ S R  P +         +V +      YQ  V+ EN        +  +  +    +
Sbjct: 18435 KEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPI 18494

Query: 1064  DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK----ADKKTMEWF---TVL 1116
             + P PP + RV D    ++ L W  P   G   + GY V+     AD    E +      
Sbjct: 18495 EPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAA 18554

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALD 1176
                 R    V  L     Y FRV +QN VG   R A  KE +   +P    EPP    LD
Sbjct: 18555 AQLVRKEFTVTSLDENQEYEFRVCAQNQVGIG-RPAELKEAI---KPKEILEPPEID-LD 18609

Query: 1177  FSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLD 1220
              S      + LV   V AG    L   VRG P PK++W K G+D
Sbjct: 18610 AS-----MRKLV--IVRAGCPIRLFAIVRGRPAPKVTWRKVGID 18646



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 110/462 (23%), Positives = 181/462 (39%), Gaps = 59/462 (12%)

Query: 769   IDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQE 828
             +D  D P  P   N+   + T++W  P Y GG  I  YI+E++   + RW++ NF  I E
Sbjct: 21354 LDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILE 21413

Query: 829   LSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSL 888
                    + E   YE RV A NA G   P       +      E   + V+     TV L
Sbjct: 21414 NEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVIL 21473

Query: 889   KWRPPERVGA--GGLDGYSVEYCPEGCS-EWVAALQGLTE--HTSILVKDL--------- 934
             K     R+ A   G    ++E+  +G   E  A L+       T+++ KD          
Sbjct: 21474 KAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYT 21533

Query: 935   -----PTG-ARLLFRVRAHNMAG-PGAPVTTTEPVTVQEILQ-RPRLQLPRHLRQTIQKK 986
                  P G A+ +F V+  +  G P  P+  TE  + + +L   P L             
Sbjct: 21534 LTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLD-----------D 21582

Query: 987   VGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRN--SPTDTILFIRAARRVHSGTYQ 1044
              G  ++  I  Q +   ++ WT     +   ++ +       + I  + A  +   G   
Sbjct: 21583 GGAKIDHYI-VQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVG--- 21638

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK 1104
                  E +E +  L +     P PP++  VT     ++ + W  P   G +E+  Y V++
Sbjct: 21639 -----EPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVER 21693

Query: 1105  ADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPV 1158
              DK    W     +        V  L  G+ Y FR+ ++N  G S  + T+      + V
Sbjct: 21694 RDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTV 21753

Query: 1159  FIPRPGITYEPPNYKALDFSEAP---SFTQPLVN-RSVIAGY 1196
             F P P     P N + LD S +    ++ +P+ +  S I GY
Sbjct: 21754 FKPGP-----PGNPRVLDTSRSSISIAWNKPIYDGGSEITGY 21790



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 66/214 (30%), Positives = 97/214 (45%), Gaps = 18/214 (8%)

Query: 1064  DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL-EHYRRT 1122
             +KP  P    +T     +  + WKPP   G  ++  Y ++K +KK  +W +V  E  R T
Sbjct: 30823 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 30882

Query: 1123  HCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPS 1182
                V  LI G  Y FRV  +N+ G S+ +  + EP+  P+  +  + P++K         
Sbjct: 30883 VFSVKNLIEGLEYEFRVKCENLGGESEWSEIS-EPI-TPKSDVPIQAPHFK--------- 30931

Query: 1183  FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA---RFRMFSKQGVLTLE 1239
               + L N +V     A L C V G PKP + W++ G ++  D    R + F K G   L 
Sbjct: 30932 --EELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEF-KGGYHQLI 30988

Query: 1240  IRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
             I      D  +Y  RATN  G       LEV VP
Sbjct: 30989 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVP 31022



 Score = 83.2 bits (204), Expect = 1e-15
 Identities = 264/1332 (19%), Positives = 454/1332 (34%), Gaps = 185/1332 (13%)

Query: 11   AFSKKPRSVEVAAGSPAVFEAETERAG-VKVRWQRGGSDISASNKYGLATEGTRHTLTVR 69
            +F  KP S +V  GS    ++  + +  + +RW +G  ++ +     +  E    +L + 
Sbjct: 4207 SFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELY 4266

Query: 70   EVGPADQGSYAV----IAGSSKVKFDLKVIE----AEKAEP--MLAPAPAPAEATGAPGE 119
             V  +D G+Y      +AG  +   +L V E     EK EP  +L    A   A    G 
Sbjct: 4267 LVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLACKVTGT 4326

Query: 120  AP------APAAELGESAPSPKG--SSSAALNGPTPGAPDDPIGLFVMRPQDGE------ 165
             P      A   E+ ES+        S+A L     G  D    +   + + G       
Sbjct: 4327 PPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSI 4386

Query: 166  VTVGGSITFSARVAGASLLK-------------PPV-VKWFKGKWVDLSSKVGQHLQLHD 211
            V V  S  F+       +LK             PP  + WFK   +  S +         
Sbjct: 4387 VIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGR--------- 4437

Query: 212  SYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAF 271
             Y    + +L  L I     A  G Y+C V+ +      +  +T+ E         +   
Sbjct: 4438 KYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPP-----SFIKKI 4492

Query: 272  RRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPS 331
              TS   GG     +     +    + LK  DS     D  +    E +V  +       
Sbjct: 4493 ESTSSLRGGTAAFQATLKGSLPITVTWLK--DSDEITEDDNIRMTFENNVASLYLSGIEV 4550

Query: 332  EYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELA-DH 390
            +++         D    ++R   +   ++ +T  ++ +  +  V++G    L V+ +   
Sbjct: 4551 KHDGKYVCQAKND--AGIQRCSALLSVKEPATITEEAV--SIDVTQGDPATLQVKFSGTK 4606

Query: 391  DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY----QCVVGGEKCSTE 446
            +   KW K+GQE+ + GSKY          L I      D   Y    Q  VG   C   
Sbjct: 4607 EITAKWFKDGQELTL-GSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKAR 4665

Query: 447  LFVKE--PPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRF 503
            + V +   P   T+ L+    + G  ++ EC V+      ++W KD  E++  E  KY+F
Sbjct: 4666 INVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASE--KYKF 4723

Query: 504  KKDGQRHHLIINEAMLEDAGHYALCTSG----GQALAELIVQEKKLEVYQSIADLMVGAK 559
                    L I++    D+G Y    +      Q    L V+E    V +      V   
Sbjct: 4724 SFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFV-EKPQSQDVNPN 4782

Query: 560  DQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVP 618
             +   K  V       + W K+ KEL         H G    +  DD + + E   +   
Sbjct: 4783 TRVQLKALVGGTAPMTIKWFKDNKEL---------HSGAARSVWKDDTSTSLELFAAKAT 4833

Query: 619  EG--FACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGD 676
            +   + C LS  +     K     ++ P  I    P      +V+  G     +  I+G 
Sbjct: 4834 DSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSP-----VLVLRNGQSTTFECQITGT 4888

Query: 677  PAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIF 736
            P   V W      GN+  A                   K  +   +G          + F
Sbjct: 4889 PKIRVSW---YLDGNEITA-----------------IQKHGISFIDG---------LATF 4919

Query: 737  TVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVP------DAPAAPKISNVGEDSCTV 790
             + GA  E+ G Y    +N  G    ++ +KV + P            K S+V E  C V
Sbjct: 4920 QISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDV-ELECEV 4978

Query: 791  QWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVN 850
               PP        + ++   ++ +S +   L  D +   +    +       E +    N
Sbjct: 4979 TGTPPFE------VTWLKNNREIRSSKKYTLT-DRVSVFNLHITKCDPSDTGEYQCIVSN 5031

Query: 851  AIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
              G       S       PPS      ++ + +TT  LK     +    G    S+    
Sbjct: 5032 EGG---SCSCSTRVALKEPPS-----FIKKIENTTTVLKSSATFQSTVAGSPPISI---- 5079

Query: 911  EGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG----PGAPVTTTEPVTVQE 966
                 W+   Q L E  ++ +  + + A L  R   +  +G         +  E      
Sbjct: 5080 ----TWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFL 5135

Query: 967  ILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPT 1026
            ++Q P   + +     + +K  +P+ L     G P  +V W K+G+ +        +   
Sbjct: 5136 LVQEPAQIVEKAKSVDVTEK--DPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFEN 5193

Query: 1027 DTILF-IRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPP----QDLRVTDAWGLN 1081
            +   F I++  +  SG Y   V  +         L+V+D+  PP    +  ++    G +
Sbjct: 5194 NVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSS 5253

Query: 1082 VALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFS 1141
            + +E K    +  +  W       +  T   + ++ H R     V  L + +   +    
Sbjct: 5254 IHMECKVSGSLPISAQW--FKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKV 5311

Query: 1142 QNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLC 1201
             N+ G  D A +          GI         L   E PSF      +  I   T    
Sbjct: 5312 SNVAG--DDACS----------GI---------LTVKEPPSFLVKPGRQQAIPDSTVEFK 5350

Query: 1202 CAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
              ++G+P  KI WFK+ ++L    +  +  +     L +        G Y C  TN  G 
Sbjct: 5351 AILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGS 5410

Query: 1262 ARCECRLEVRVP 1273
              C   L V  P
Sbjct: 5411 DSCTTMLLVTEP 5422



 Score = 82.0 bits (201), Expect = 3e-15
 Identities = 140/673 (20%), Positives = 242/673 (35%), Gaps = 83/673 (12%)

Query: 24   GSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIA 83
            G PA F+       +KV W      I  S  + +      + L + E  P D+G+Y  +A
Sbjct: 3359 GQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVA 3418

Query: 84   GSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALN 143
             ++     +  + +     + AP     E      E    AA + +    P         
Sbjct: 3419 SNA-----VGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPL-------- 3465

Query: 144  GPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKV 203
                                 EV +G    F+  +  A  ++    +WFK          
Sbjct: 3466 ---------------------EVALGHLAKFTCEIQSAPNVR---FQWFKA--------- 3492

Query: 204  GQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG 263
            G+ +   D     S  Y+  L I   Q    G Y C+ S +         LTV EA    
Sbjct: 3493 GREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPT 3552

Query: 264  DLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWE 323
             L    +   T+  G   +   +   T +++  ++ +K  +  +P  +   + AE     
Sbjct: 3553 FLSRPKSL--TTFVGKAAKFICTVTGTPVIE--TIWQKDGAALSPSPNWRISDAENK--H 3606

Query: 324  ILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRL 383
            IL  +  +  +R  +    ++  G       +   +K    F K+LEP  Q +   K+ L
Sbjct: 3607 ILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPH--FIKELEPV-QSAINKKVHL 3663

Query: 384  TVEL-ADHDAEVKWLKNGQEIQMSGS-KYIFESIGAKRTLTISQCSLADDAAYQCVV--- 438
              ++  D    V W K+GQ++      K  FE   A  TL I    L D   Y C     
Sbjct: 3664 ECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIA--TLEIPLAKLKDSGTYVCTASNE 3721

Query: 439  -GGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGA-QVKWLKDGVELTRE 496
             G   CS  + V+EPP  + +     L++ G+     C++      QV W K+  EL+  
Sbjct: 3722 AGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSES 3781

Query: 497  ETFKYRFKKDGQRHHLIINEAMLEDAGHY---ALCTSGGQALAELIVQEKKLEVYQSIAD 553
             T +  F        L I +  +ED+G Y   A+   G  + +  IV ++     +++  
Sbjct: 3782 NTVRMYFV--NSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEP 3839

Query: 554  LMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEA 612
              +     A+ +CEVS      + W K+ K++    + ++     +  L I     AD  
Sbjct: 3840 ADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVG 3899

Query: 613  DYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVP 672
            +Y  V      N   K   M   +     +EPP        +  D ++ + G  + L   
Sbjct: 3900 EYECV----VANEVGKCGCMATHL----LKEPPTF-----VKKVDDLIALGGQTVTLQAA 3946

Query: 673  ISGDPAPTVIWQK 685
            + G    +V W K
Sbjct: 3947 VRGSEPISVTWMK 3959



 Score = 82.0 bits (201), Expect = 3e-15
 Identities = 91/374 (24%), Positives = 142/374 (37%), Gaps = 41/374 (10%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P  + ++++  T++++ W PPE  G   L GY VE        W+   + +T  T
Sbjct: 29833 GPPTGP--IKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRST 29890

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
                 + L  G   +FRV A N  G G+ + +     V E     R+  P    Q      
Sbjct: 29891 FKFTR-LTEGNEYVFRVAATNRFGIGSYLQSE----VIECRSSIRIPGPPETLQIFDVSR 29945

Query: 988   GEPVNLLIPFQGKPRPQVTW--TKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQV 1045
                     P +     QVT    +  +  A   V +   P  T+   R+        Y+ 
Sbjct: 29946 DGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPV-TMTRYRSTGLTEGLEYEH 30004

Query: 1046  TVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTEL 1097
              V   N           K  + +  +  P  PQ+ RVTD    +V+L W  P+D G +++
Sbjct: 30005 RVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKV 30064

Query: 1098  WGYTVQKADKKTMEWF------TVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRA 1151
              GY ++       EW       T +  Y  TH  +P+   G  Y FRV + N  G     
Sbjct: 30065 TGYLIEMQKVDQHEWTKCNTTPTKIREYTLTH--LPQ---GAEYRFRVLACNAGG----- 30114

Query: 1152  ATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPK 1211
                 EP  +P      E   Y   +  E   + + +  R    G    L   ++G P P 
Sbjct: 30115 --PGEPAEVPGTVKVTEMLEYPDYELDER--YQEGIFVRQ---GGVIRLTIPIKGKPFPI 30167

Query: 1212  ISWFKNGLDLGEDA 1225
               W K G D+ + A
Sbjct: 30168 CKWTKEGQDISKRA 30181



 Score = 81.3 bits (199), Expect = 6e-15
 Identities = 100/418 (23%), Positives = 150/418 (35%), Gaps = 61/418 (14%)

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P  + + +VS    +L W PP   G   +  Y +E        W    + +     +
Sbjct: 20473 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHV 20532

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGE 989
               K L  G   +FRV A N  G G PV + EPV + +    P                G 
Sbjct: 20533 ATK-LIQGNEYIFRVSAVNHYGKGEPVQS-EPVKMVDRFGPP----------------GP 20574

Query: 990   PVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHS----- 1040
             P    +    K    V+W +     G  + G  V  R   +  + ++RA +   S     
Sbjct: 20575 PEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKS--LRWVRAIKTPVSDLRCK 20632

Query: 1041  -------GTYQVTVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALE 1085
                     TY+  V  EN            + L+      P PP +  VTD    + +L 
Sbjct: 20633 VTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLA 20692

Query: 1086  WKPPQDVGNTELWGYTVQKADKKTMEWF--TVLEHYRRTHCVVPELIIGNGYYFRVFSQN 1143
             W  P   G  E+ GY V+        W   T     R T  VVP+L     Y FR+ + N
Sbjct: 20693 WGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIN 20752

Query: 1144  MVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCA 1203
               G         EP  IP   I        A DF       + LV R   AG +  +   
Sbjct: 20753 DAGVG-------EPAVIPDVEIVERE---MAPDFELDAELRRTLVVR---AGLSIRIFVP 20799

Query: 1204  VRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
             ++G P P+++W K+ ++L   A     + +    L I +   +D G +V    N  G+
Sbjct: 20800 IKGRPAPEVTWTKDNINLKNRANIE--NTESFTLLIIPECNRYDTGKFVMTIENPAGK 20855



 Score = 79.3 bits (194), Expect = 2e-14
 Identities = 165/758 (21%), Positives = 271/758 (35%), Gaps = 127/758 (16%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAK 418
            K    F K+L   Y + KG  + L           V W KNG  +  S  +    +    
Sbjct: 7865 KAPAKFVKRLND-YSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPS-QRCNITTTEKS 7922

Query: 419  RTLTISQCSLADDAAYQCVV----GGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFE 474
              L I   ++ D   Y C +    G + CS ++ + EPP  + + LE   V VG     +
Sbjct: 7923 AILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFV-KQLEPVKVSVGDSASLQ 7981

Query: 475  CEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALC---TS 530
            C+++      V W K   +L    T+K  F+ +     L+ N+  + D+G Y +C    S
Sbjct: 7982 CQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVAT--LVFNQVDINDSGEY-ICKAENS 8038

Query: 531  GGQALAE--LIVQEKKL--EVYQSIADLMVGAKDQAVFKCEVS-DENVRGVWLKNGKELV 585
             G+  A   L VQE+KL     + + D+        VF C +S  E +   W K+GK L 
Sbjct: 8039 VGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLK 8098

Query: 586  PDSRIKVSHIGRVHKLTIDDVTPADEADYSFV---PEGFACNLSAKLHFMEVKIDFVPRQ 642
                ++ S +     L I     +    YS     P G A + SA+L   E K       
Sbjct: 8099 DSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASS-SARLILTEGK------- 8150

Query: 643  EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             PP   +         +  V G     +  ++G     V W K                 
Sbjct: 8151 NPPFFDIRLA-----PVDAVVGESADFECHVTGTQPIKVSWAK----------------- 8188

Query: 703  EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQ- 761
                DS E          + G+ ++   ++ +  TV   +K D G YT    N VG+D  
Sbjct: 8189 ----DSRE--------IRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSC 8236

Query: 762  -VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMR 820
               L +K   +P +        V E             G QPI           +  W +
Sbjct: 8237 TAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPI-----------TVAWYK 8285

Query: 821  LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM-----------PIGP 869
             N ++    + E       +V ++R   +N  G+     ++               P  P
Sbjct: 8286 NNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKP 8345

Query: 870  PSEPTHLAVEDVSD-----TTVSLKWRPPERVG--AGGLDGYSVEYCPEGCSEWVAALQG 922
            P    HL    VS+      +  ++   P R+     G +    + C    +   A L+ 
Sbjct: 8346 PVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLE- 8404

Query: 923  LTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQT 982
                    ++D+       +  +A N+AG     TT   VT+++   +P +  P   +  
Sbjct: 8405 --------LRDVAKADSGDYVCKASNVAGSD---TTKSKVTIKD---KPAV-APATKKAA 8449

Query: 983  IQKK---VGEPVNL----------LIPFQGKPRPQVTWTKE--GQPLAGEEVSIRNSPTD 1027
            +  +   V EP ++          +    G P P V WTK    Q   G  V I     +
Sbjct: 8450 VDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDE 8509

Query: 1028 TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
              L IR   +  SG Y+     E+ E ++ + LQV ++
Sbjct: 8510 AKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDER 8547



 Score = 78.2 bits (191), Expect = 5e-14
 Identities = 70/236 (29%), Positives = 112/236 (47%), Gaps = 14/236 (5%)

Query: 396   WLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVV---GGEKCST-ELFVKE 451
             W+K+G  I+ S  K+ F + G  R L I    L+D   Y CV+     EK ST +L V+E
Sbjct: 11151 WMKDGSNIRES-PKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEE 11209

Query: 452   PPVLITRPLEDQLVMV-GQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRH 510
              PV   + LE+++ +V GQ +   CE+++E   V W KDG ++  E+  +      G   
Sbjct: 11210 LPVRFVKTLEEEVTVVKGQPLYLSCELNKE-RDVVWRKDG-KIVVEKPGRIVPGVIGLMR 11267

Query: 511   HLIINEAMLEDAGHYALCTSGGQAL----AELIVQEKKLEVYQSIADLMVGAKDQAVFKC 566
              L IN+A   DAG Y +       L       +V+  +  + + I D  V  K  A+F C
Sbjct: 11268 ALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 11327

Query: 567   EVSDENVRGVWLKNGKEL--VPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEG 620
             +++ +     W K   E+   P+ + ++   G    L I +  P D A+Y+   EG
Sbjct: 11328 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEG 11383



 Score = 77.8 bits (190), Expect = 6e-14
 Identities = 98/433 (22%), Positives = 154/433 (35%), Gaps = 42/433 (9%)

Query: 847   YAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSV 906
             Y + A   S    A+     +  P  P  + +  +      L W PP   G   +  Y V
Sbjct: 19366 YTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIV 19425

Query: 907   EYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             +        W A +      TS  V+ L  G    FR+ A N  G G PV T EP   + 
Sbjct: 19426 DKRETSRPNW-AQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFT-EPAIAKN 19483

Query: 967   ILQRPRLQLPRHLRQTIQKKV-----------GEPVNLLIPFQGKPRPQVTWTKEGQ-PL 1014
                 P    P  +    +  +           G P+   +  + +    V WTK  + P+
Sbjct: 19484 PYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYL-LEKRETQAVNWTKVNRKPI 19542

Query: 1015  AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRV 1074
                 +        T    R      +G  +      +   KA         P PP   +V
Sbjct: 19543 IERTLKATGLQEGTEYEFRVTAINKAGPGK-----PSDASKAAYARDPQYPPGPPAFPKV 19597

Query: 1075  TDAWGLNVALEWKPPQDVGNTELWGYTVQ--KADKKTMEWFTVLEHYRRTHCVVPELIIG 1132
              D    +V+L W  P   G + + GY V+  +AD        + ++ ++T   V  L+  
Sbjct: 19598 YDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMED 19657

Query: 1133  NGYYFRVFSQNMVGFSDRAATTKE----PVFIPRPGITYEPPNYKALDFSEAPSFTQPLV 1188
               Y FRV++ N +G+SD +    +     + IP  G          LD        + L+
Sbjct: 19658 TQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEG---------ELD----ADLRKTLI 19704

Query: 1189  NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDG 1248
              R   AG T  L   V+G P PKI+W K  ++L +     + S      L       +D 
Sbjct: 19705 LR---AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDA 19761

Query: 1249  GIYVCRATNLQGE 1261
             G Y+    N  G+
Sbjct: 19762 GKYILTLENSCGK 19774



 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 65/250 (26%), Positives = 112/250 (44%), Gaps = 8/250 (3%)

Query: 375  VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY 434
            V++  +     E+A+ D++ +WL++G+ + ++ +    ES G KR L I+   L D   Y
Sbjct: 2631 VAESQEAVFECEVANPDSKGEWLRDGKHLPLTNN-IRSESDGHKRRLIIAATKLDDIGEY 2689

Query: 435  QCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQ-VKWLKDGVEL 493
               V   K S +L V+   V I + L++  V   Q   F  E++    + V+W+K+GV L
Sbjct: 2690 TYKVATSKTSAKLKVEA--VKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVL 2747

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIAD 553
               E  KY     G  + L I    + D   Y        A A L V+  K  + +   D
Sbjct: 2748 ESNE--KYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVK--IIKKPKD 2803

Query: 554  LMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
            +         F+  VS + V   W     E+ P  + ++    +VHKL + +++P+D  +
Sbjct: 2804 VTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGE 2863

Query: 614  YSFVPEGFAC 623
            Y+ V     C
Sbjct: 2864 YTAVVGQLEC 2873



 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 52/242 (21%), Positives = 99/242 (40%), Gaps = 3/242 (1%)

Query: 374   QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
             +V +  + +   E++      +WLK  QEI     ++     G K ++ I   +  D+A 
Sbjct: 11850 KVFEKDEAKFECEVSREPKTFRWLKGTQEIT-GDDRFELIKDGTKHSMVIKSAAFEDEAK 11908

Query: 434   YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
             Y      +  S +L ++   +    PL+D      +   F  E+S +  +VKW K+   L
Sbjct: 11909 YMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL 11968

Query: 494   TREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIAD 553
                 T     + +G+ H +   +  ++D     +   G  + A+L V E        + D
Sbjct: 11969 --HTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQD 12026

Query: 554   LMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
                  KD+ + +CE+S  +    W K+GKE+ P     +   G+   L +     +D   
Sbjct: 12027 YTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQ 12086

Query: 614   YS 615
             Y+
Sbjct: 12087 YT 12088



 Score = 76.6 bits (187), Expect = 1e-13
 Identities = 96/419 (22%), Positives = 148/419 (35%), Gaps = 82/419 (19%)

Query: 393  EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVV----GGEKCSTELF 448
            ++ W K  +++  +G K  F   G + TL + +    D A Y C      G    S  L 
Sbjct: 3269 KISWYKE-EQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLS 3327

Query: 449  VKEPPVL------------ITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTRE 496
            V+ P V+            I  PL+D +   GQ   F+C VS    +V W     ++   
Sbjct: 3328 VEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPS 3387

Query: 497  ETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSG--GQA--------------LAELIV 540
              F+    +D   + L I EA  ED G Y    S   GQ               L E I 
Sbjct: 3388 RFFRMTQFED--TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIE 3445

Query: 541  QEKKLE------VYQSIADLMVGAKDQAVFKCEV-SDENVRGVWLKNGKELVPDSRIKVS 593
            QE ++E      + + I  L V     A F CE+ S  NVR  W K G+E+    +  + 
Sbjct: 3446 QEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR 3505

Query: 594  HIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPG 653
                +  L I      D  +Y+       C  S +   +         +  P   L  P 
Sbjct: 3506 SSKYISSLEILRTQVVDCGEYT-------CKASNEYGSVSCTATLTVTEAYPPTFLSRP- 3557

Query: 654  RIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVF 713
                ++    G   +    ++G P    IWQK     + A   P+P+          W  
Sbjct: 3558 ---KSLTTFVGKAAKFICTVTGTPVIETIWQK-----DGAALSPSPN----------W-- 3597

Query: 714  DKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVP 772
                        R+   +++ I  +     +D GVY+    N  G D     + +ID P
Sbjct: 3598 ------------RISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKP 3644



 Score = 76.6 bits (187), Expect = 1e-13
 Identities = 275/1343 (20%), Positives = 445/1343 (33%), Gaps = 243/1343 (18%)

Query: 38   VKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAV----IAGSSKVKFDLK 93
            +KV W +  ++I  S+K+ ++   +   L +  +   D G Y       AGS+     LK
Sbjct: 7335 IKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLK 7394

Query: 94   VIEAEKAEPMLAPAPAPAEAT-GAP--------GEAP----------------------- 121
            V    K  P+    P P E   GA         G  P                       
Sbjct: 7395 V----KEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSE 7450

Query: 122  ----------APAAELGE---SAPSPKGSS----SAALNGPTPGAPDDPIGLFVMRPQDG 164
                        AA++GE    A +  GS     S AL  P           FV +  D 
Sbjct: 7451 NFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPR---------FVKKLSDI 7501

Query: 165  EVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFEL 224
               VG  +     + GA   +P  V WFK K        G+ ++  D+   +    +  L
Sbjct: 7502 STVVGKEVQLQTTIEGA---EPISVVWFKDK--------GEIVRESDNIWISYSENIATL 7550

Query: 225  HITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRIS 284
              +  +PA  G Y C++           +  + E   T     LS     ++      I 
Sbjct: 7551 QFSRVEPANAGKYTCQIKN---------DAGMQECFAT-----LSVLEPATIVEKPESIK 7596

Query: 285  DSHEDTGILDFS-------SLLKKRDSFRTPRDSKLEAPAEEDV--WEILRQAPPSEYER 335
             +  DT  L+ +       S    +D      D+K +      V   +I+  AP      
Sbjct: 7597 VTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSG-- 7654

Query: 336  IAFQYGVTDLRGMLKRLKGMR-RDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEV 394
              + + V +  G       ++  D     +F +KL+    +S    +            V
Sbjct: 7655 -VYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISV 7713

Query: 395  KWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVV----GGEKCSTELFVK 450
             W   G EI  SG KY          LT++    +D   Y C+     G ++CS  L V+
Sbjct: 7714 SWFHEGNEIS-SGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVR 7772

Query: 451  EPPVLITRPLEDQLVMVGQRVEFECEVSEEGA-QVKWLKDGVELTREETFKYRFKKDGQR 509
            EPP  + +P +   V+ G  V F   V       V W K   EL   +  +     +   
Sbjct: 7773 EPPSFVQKP-DPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGD--RCNVSLEDSV 7829

Query: 510  HHLIINEAMLEDAGHYALCTSGGQALAELIVQ---EKKLEVYQSIADLMVGAKDQAVFKC 566
              L + +     +G Y    S     A        +   +  + + D  +      + + 
Sbjct: 7830 AELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEG 7889

Query: 567  EVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFAC-- 623
              +      V W KNG  + P  R  ++   +   L I   T  D   Y+   E  +   
Sbjct: 7890 TFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKD 7949

Query: 624  NLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW 683
            + SA++  +E    FV + EP K+ +              G+   L   ++G P   V W
Sbjct: 7950 SCSAQILILEPPY-FVKQLEPVKVSV--------------GDSASLQCQLAGTPEIGVSW 7994

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEK 743
             K                            D KL   T  ++         +F     + 
Sbjct: 7995 YKG---------------------------DTKLRPTTTYKMHFRNNVATLVFNQ--VDI 8025

Query: 744  EDEGVYTVTVKNPVGEDQVN--LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD--- 798
             D G Y    +N VGE   +  LTV+   +P     P  S    D       P  +D   
Sbjct: 8026 NDSGEYICKAENSVGEVSASTFLTVQEQKLP-----PSFSRQLRDVQETVGLPVVFDCAI 8080

Query: 799  -GGQPI-LGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSR 856
             G +PI + +  + K  K    ++ +F L    +    +    +  +    A N IG + 
Sbjct: 8081 SGSEPISVSWYKDGKPLKDSPNVQTSF-LDNTATLNIFKTDRSLAGQYSCTATNPIGSAS 8139

Query: 857  PSPASQPFMPIGPPSEPTHLAVEDV-------------SDTTVSLKWRPPER-VGAGGLD 902
             S          PP     LA  D                  + + W    R + +GG  
Sbjct: 8140 SSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGK- 8198

Query: 903  GYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPV 962
             Y + Y                 H ++L  D     +  +   A N  G  +    T  +
Sbjct: 8199 -YQISYLENSA------------HLTVLKVDKGDSGQ--YTCYAVNEVGKDS---CTAQL 8240

Query: 963  TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTK---EGQPLAGEEV 1019
             ++E L  P     + L +T+++  G    L     G     V W K   E QP +  E+
Sbjct: 8241 NIKERLIPP--SFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEI 8298

Query: 1020 SIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPP---QDLR-VT 1075
            + +N+    +L +R A    +G Y   V  +      T  + + +   PP   Q L  VT
Sbjct: 8299 TFKNNTL--VLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVT 8356

Query: 1076 DAWGLNVALEWKPPQDVGNTELW---GYTVQKADKKTMEWFT---VLEHYRRTHCVVPEL 1129
             + G  V L             W   G  ++ +D+ +  + +   VLE        + ++
Sbjct: 8357 VSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLE--------LRDV 8408

Query: 1130 IIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP-RPGITYEPPNYKALDFSEAPSFTQPLV 1188
               +   +   + N+ G    + TTK  V I  +P +   P   KA         ++P  
Sbjct: 8409 AKADSGDYVCKASNVAG----SDTTKSKVTIKDKPAVA--PATKKAAVDGRLFFVSEPQS 8462

Query: 1189 NRSVIAGYTAMLCCAVRGSPKPKISWFKNGL-DLGEDARFRMFSKQGVLTLEIRKPCPFD 1247
             R V+   TA     V G P P + W K     L +  R  +  K     LEIR     D
Sbjct: 8463 IR-VVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTD 8521

Query: 1248 GGIYVCRATNLQGEARCECRLEV 1270
             G+Y C A N  GE      L+V
Sbjct: 8522 SGLYRCVAFNEHGEIESNVNLQV 8544



 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 156/762 (20%), Positives = 276/762 (36%), Gaps = 170/762 (22%)

Query: 38   VKVRWQRGGSDISASNKYGLA-TEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIE 96
            ++V W + G +I+AS++Y +A  EGT  +L +  V   D G++                 
Sbjct: 4142 MRVSWFKDGKEIAASDRYRIAFVEGTA-SLEIIRVDMNDAGNFT---------------- 4184

Query: 97   AEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGL 156
                            AT + G   +  A + +  PS                       
Sbjct: 4185 --------------CRATNSVGSKDSSGALIVQEPPS----------------------- 4207

Query: 157  FVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRA 216
            FV +P   +V  G ++   +   G++   P  ++WFKG    +S   G      ++ + +
Sbjct: 4208 FVTKPGSKDVLPGSAVCLKSTFQGST---PLTIRWFKGNKELVSG--GSCYITKEALESS 4262

Query: 217  SKVYLFELHITDAQPAFTGSYRCEVST-KDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTS 275
             ++YL        + + +G+Y C+VS      +CS  NL V E     +           
Sbjct: 4263 LELYL-------VKTSDSGTYTCKVSNVAGGVECSA-NLFVKEPATFVEK---------- 4304

Query: 276  LAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYER 335
                             L+ S LLKK D+ +         P +   +   R+   S   R
Sbjct: 4305 -----------------LEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHR 4347

Query: 336  IAF----------QYGVTDLRGMLKRLKGMRRDE--------KKSTAFQKKLEPAYQVSK 377
            ++F            G+ D    +   +     +        K+S  F K+ +P  +V K
Sbjct: 4348 MSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPI-EVLK 4406

Query: 378  GHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQC 436
             + + L  E+A     E+ W K+   I  SG KY         +L I +   AD   YQC
Sbjct: 4407 EYDVMLLAEVAGTPPFEITWFKDNT-ILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQC 4465

Query: 437  ----VVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE-GAQVKWLKDGV 491
                 VG   CS  + ++EPP  I + +E    + G    F+  +       V WLKD  
Sbjct: 4466 RVTNEVGSSICSARVTLREPPSFIKK-IESTSSLRGGTAAFQATLKGSLPITVTWLKDSD 4524

Query: 492  ELTREETFKYRFKKDGQRHHLIINEAMLEDAGHY---ALCTSGGQALAELIVQEKKLEVY 548
            E+T ++  +  F+ +     L ++   ++  G Y   A   +G Q  + L+  ++   + 
Sbjct: 4525 EITEDDNIRMTFENNVAS--LYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATIT 4582

Query: 549  QSIADLMVGAKDQAVFKCEVSD-ENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVT 607
            +    + V   D A  + + S  + +   W K+G+EL   S+ K+S    V  L I    
Sbjct: 4583 EEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTE 4642

Query: 608  PADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKL 667
              D  +Y+F  +      S K     + +   P        +D           + G+ +
Sbjct: 4643 KKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDS----------IKGSFI 4692

Query: 668  RLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRV 727
             L+  ++G    ++ W K                 ++   S+++ F              
Sbjct: 4693 DLECIVAGSHPISIQWFK---------------DDQEISASEKYKFSFH----------- 4726

Query: 728  ETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV--NLTVK 767
            + T    I  +EG    D G YT +  N  G +Q   +LTVK
Sbjct: 4727 DNTAFLEISQLEGT---DSGTYTCSATNKAGHNQCSGHLTVK 4765



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 60/195 (30%), Positives = 92/195 (47%), Gaps = 17/195 (8%)

Query: 439   GGEKCSTEL----FVKEPPVLITRPLEDQLV----MVGQRVEFECEVSEEGAQVKWLKDG 490
             GGEK   E      +K  P+   + ++D ++     VG    FEC VS   A   W+KDG
Sbjct: 11096 GGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDG 11155

Query: 491   VELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQ----ALAELIVQEKKLE 546
               +   E+ K+RF  DG+   L I +  L DAG Y      G     + A+L+V+E  + 
Sbjct: 11156 SNI--RESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVR 11213

Query: 547   VYQSIADLMVGAKDQAVF-KCEVSDENVRGVWLKNGKELV-PDSRIKVSHIGRVHKLTID 604
               +++ + +   K Q ++  CE++ E    VW K+GK +V    RI    IG +  LTI+
Sbjct: 11214 FVKTLEEEVTVVKGQPLYLSCELNKER-DVVWRKDGKIVVEKPGRIVPGVIGLMRALTIN 11272

Query: 605   DVTPADEADYSFVPE 619
             D    D   Y+   E
Sbjct: 11273 DADDTDAGTYTVTVE 11287



 Score = 70.9 bits (172), Expect = 8e-12
 Identities = 62/255 (24%), Positives = 106/255 (41%), Gaps = 6/255 (2%)

Query: 386   ELADHDAEVKWLKNGQEIQMS-GSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCS 444
             ++A     +KW K   EI      K      G    L I      D A Y   + G++  
Sbjct: 11328 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYP 11387

Query: 445   TELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFK 504
              +L + E  V + +P+ED  +   +   F+ E+SE     +W   G  L    T +   K
Sbjct: 11388 AKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCE--IK 11445

Query: 505   KDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVF 564
              +G +  L +++  L+ AG            A L V+E +L+    + D+ V  + QA F
Sbjct: 11446 AEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQARF 11505

Query: 565   KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
             +C ++ E    +W K    +    +  +   G+ H L I+D    DE  Y+   EG    
Sbjct: 11506 ECVLTRE-ANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEG--KK 11562

Query: 625   LSAKLHFMEVKIDFV 639
              SA+L    +++ F+
Sbjct: 11563 TSARLFVTGIRLKFM 11577



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 144/622 (23%), Positives = 227/622 (36%), Gaps = 79/622 (12%)

Query: 675   GDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRS 734
             G P   VI +  +T   K PA       + TG    ++ +KK L +        T    +
Sbjct: 24607 GRPEAIVITRNNVTLKWKKPAYDG--GSKITG----YIVEKKDLPDGRWMKASFTNVLET 24660

Query: 735   IFTVEGAEKEDEGVYTVTVKNPVG------EDQVNLTVK-VIDVPDAPAAPKISNVGEDS 787
              FTV G  ++    + V  +N  G      +    +T +  ID P+A   PK  +V    
Sbjct: 24661 EFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVH 24720

Query: 788   CTVQWEPPAYDGGQPILGYILERKKKKSYRWM-RLNF-DLIQELSHEARRMI--EGVVYE 843
                 +   A   G+PI   +  +  K+      R+     IQ+ +   +  I  +G  Y 
Sbjct: 24721 AGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYI 24780

Query: 844   MRVYAVNAIGMSRPSPASQPFMPI-GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLD 902
             +++   + +G ++  P +   +   GPP  P  L V  V+     L W PP + G   + 
Sbjct: 24781 LKL---SNVGGTKSIPITVKVLDRPGPPEGP--LKVTGVTAEKCYLAWNPPLQDGGANIS 24835

Query: 903   GYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPV 962
              Y +E        W      +      + K LP G   +FRV A N  G G P+ +  PV
Sbjct: 24836 HYIIEKRETSRLSWTQVSTEVQALNYKVTKLLP-GNEYIFRVMAVNKYGIGEPLESG-PV 24893

Query: 963   TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEE 1018
             T     + P                G P    +    K    VTW +     G  + G  
Sbjct: 24894 TACNPYKPP----------------GPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI 24937

Query: 1019  VSIR----------NSPTDTILFIRAARRVHSGTYQVTVRIENME-----DKATLVLQVV 1063
             +  R          N  T T L +R        +Y+  V  EN        + ++  +  
Sbjct: 24938 LEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRAC 24997

Query: 1064  DK---PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEH-- 1118
             D    P PP + +VTD    +V+L W  P   G   + GY V+  +    EW T      
Sbjct: 24998 DALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTG 25057

Query: 1119  YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFS 1178
              +     V +L     Y FR+ + N  G  + A      V   R     EPP  + LD  
Sbjct: 25058 LQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQER----IEPPEIE-LD-- 25110

Query: 1179  EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
                   + +V R   A  T  L   ++G P+P++ W K    L + A+  + S   +L +
Sbjct: 25111 --ADLRKVVVLR---ASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVI 25165

Query: 1239  EIRKPCPFDGGIYVCRATNLQG 1260
             +      FD G Y     N  G
Sbjct: 25166 D--NVTRFDSGRYNLTLENNSG 25185



 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 66/244 (27%), Positives = 95/244 (38%), Gaps = 30/244 (12%)

Query: 1034  AARRVHSGTYQVTVRIENME----------------DKATLVLQVVDKPSPPQDLRVTDA 1077
             A  + H  TY+VT   E  E                 + T  ++  + PSPP  L + D 
Sbjct: 20917 ATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDI 20976

Query: 1078  WGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYF 1137
                 V+L W  P+  G +++ GY ++   K + +W T +   +   CVV  L  G  Y F
Sbjct: 20977 TKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTVKGLECVVRNLTEGEEYTF 21035

Query: 1138  RVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYT 1197
             +V + N  G   R+A  +      RP I  E      LD        Q LV     AG  
Sbjct: 21036 QVMAVNSAG---RSAPRES-----RPVIVKEQTMLPELDLR---GIYQKLVIAK--AGDN 21082

Query: 1198  AMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
               +   V G PKP ++W K    L +  R    +      L I +    D G Y   A N
Sbjct: 21083 IKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN 21142

Query: 1258  LQGE 1261
             + GE
Sbjct: 21143 IVGE 21146



 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 96/461 (20%), Positives = 178/461 (38%), Gaps = 66/461 (14%)

Query: 351  RLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDA--------EVKWLKNGQE 402
            ++  +  D+  S     K  P++ V  G +  +     +  A        ++KW K+  E
Sbjct: 5310 KVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVE 5369

Query: 403  IQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVV----GGEKCSTELFVKEPPVLITR 458
            + +SG K      G+   L +     +    Y C V    G + C+T L V EPP  + +
Sbjct: 5370 L-VSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKK 5428

Query: 459  PLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEA 517
                ++V  G     EC+++     +V W ++  EL   +  KYR         + +N  
Sbjct: 5429 LEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASD--KYRMTFIDSVAVIQMNNL 5486

Query: 518  MLEDAGHYALCTS---GGQALAELIVQEKKLEVYQSIADLMVGAKDQAV-FKCEVS-DEN 572
              ED+G + +C +    G       V  K+  V+ S   ++   K+  V  +CE+S    
Sbjct: 5487 STEDSGDF-ICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPP 5545

Query: 573  VRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFM 632
               VW K+ ++L    + K++       + I +V  +D  +Y        C    ++   
Sbjct: 5546 FEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYH-------CKAQNEVG-S 5597

Query: 633  EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNK 692
            +  +  V  +EPP+          +++ VVAG    L   I G                 
Sbjct: 5598 DTCVCTVKLKEPPRFVSKL-----NSLTVVAGEPAELQASIEG----------------- 5635

Query: 693  APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
              A+P            +W+ +K+ +      +R+   ++ +      AE  + G Y   
Sbjct: 5636 --AQPI---------FVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQ 5684

Query: 753  VKNPVGEDQVNLTVKVID--VPDAPAAPKISNVGEDSCTVQ 791
            +KN  G  +   T+ V++  V    A P    VGE +CT++
Sbjct: 5685 IKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGE-TCTLE 5724



 Score = 66.6 bits (161), Expect = 1e-10
 Identities = 166/772 (21%), Positives = 275/772 (35%), Gaps = 163/772 (21%)

Query: 577  WLKNGKELVPD--SRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEV 634
            W  +G+++V D   ++ +   G    L I   TP+D  +++ V +  A   S  +    +
Sbjct: 1490 WFHDGQQIVNDYTHKVVIKEDG-TQSLIIVPATPSDSGEWTVVAQNRAGRSSISVI---L 1545

Query: 635  KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAP 694
             ++ V  Q  P             + +  G++L + V  +G+P P ++W K         
Sbjct: 1546 TVEAVEHQVKPMFVEKLKN-----VNIKEGSRLEMKVRATGNPNPDIVWLK--------- 1591

Query: 695  ARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVK 754
                        +SD  V  K        ++R+E TK  +   ++    +D   YT T  
Sbjct: 1592 ------------NSDIIVPHKY------PKIRIEGTKGEAALKIDSTVSQDSAWYTATAI 1633

Query: 755  NPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
            N  G D     V V                     V++  P     +P    I+ R    
Sbjct: 1634 NKAGRDTTRCKVNV--------------------EVEFAEP-----EPERKLIIPRG--- 1665

Query: 815  SYRWMRLNFDLIQ--ELSHEARRMIEGVVYEMRVYA-------VNAIGMSRPSPASQP-- 863
            +YR   +    ++   L +   +  EG +Y+            + ++ + R  PA     
Sbjct: 1666 TYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECR 1725

Query: 864  FMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPE-GCSEWVAALQG 922
              PIG P+      + D      + + R     G   LD Y V Y  + G     A  + 
Sbjct: 1726 LTPIGDPTMVVEW-LHDGKPLEAANRLRMINEFGYCSLD-YGVAYSRDSGIITCRATNKY 1783

Query: 923  LTEHTS--ILVKD---------LPTGARLLFRVRA-HNMAGPGAPVTTTEPVTVQEILQR 970
             T+HTS  ++VKD         LP G + L R+     MA  GA    T   T Q+  Q+
Sbjct: 1784 GTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVT---TDQKEKQK 1840

Query: 971  PRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPTDTI 1029
            P + L     + ++   GE         G P+P+V W   GQ +   +   +R    D I
Sbjct: 1841 PDIVL---YPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY---DGI 1894

Query: 1030 LFIRAARRVHSGTYQVTVRIEN----MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALE 1085
             ++         T +V V  EN    +E K  L +Q        +D R      L  A E
Sbjct: 1895 HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQ------QREDFRSV----LRRAPE 1944

Query: 1086 WKPPQDVGNTELWGYTVQKADK-----KTMEWFTVLEHYRRTHCVVPELI---------- 1130
             +P   V       + VQK D+     +T E   +    R TH  VPE            
Sbjct: 1945 PRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRR 2004

Query: 1131 IGNGYYFRV---------------------------FSQNMVGFSDRAATTKEPVFIPRP 1163
               GYY  +                           +++ +     +A   +  + IP  
Sbjct: 2005 TEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIP-- 2062

Query: 1164 GITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGE 1223
              T++P   +     EAP   + + +++V  G  A     V G P P+  W+KNG+ +  
Sbjct: 2063 --TFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIER 2120

Query: 1224 DAR-FRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
              R +  + +  V  L IR     D    + +A N+ GE      L V+  Q
Sbjct: 2121 SDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ 2172



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 35/246 (14%)

Query: 15    KPRSVEVAAGSPAVFEAETERAGVK-VRWQRGGSDISASNKYGLATEGTRHTLTVREVGP 73
             KPRS+ V  G  A F  +T+   V  V W R G  +S S ++ + T   + T  +  V  
Sbjct: 32566 KPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQA 32625

Query: 74    ADQGSYAVIA----GSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGE 129
             +D+G+Y+V+     G  + +F L + +A   E  +   P          ++P P  +  E
Sbjct: 32626 SDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRV--------KSPEPRVKSPE 32677

Query: 130   SAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSAR------------ 177
             +  SPK   S   + P   +P +       + Q   V+    IT   +            
Sbjct: 32678 AVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTC 32737

Query: 178   VAGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGS 236
             V  +S+L+   V W+K GK      K   H Q H S D       +EL I +   +  G 
Sbjct: 32738 VVESSVLRAKEVTWYKDGK----KLKENGHFQFHYSADGT-----YELKINNLTESDQGE 32788

Query: 237   YRCEVS 242
             Y CE+S
Sbjct: 32789 YVCEIS 32794



 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 70/293 (23%), Positives = 120/293 (40%), Gaps = 38/293 (12%)

Query: 981  QTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVH 1039
            + +Q  + + V+L        +  VTW+K+GQ L  G++  I        L I  A+   
Sbjct: 3651 EPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKD 3710

Query: 1040 SGTYQVTVRIENMEDKATLVLQVVDKPS------PPQDLRVTDAWGLNVALEWKPPQDVG 1093
            SGTY  T   E      +  + V + PS      P   +   ++  L+  L+  P   V 
Sbjct: 3711 SGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQV- 3769

Query: 1094 NTELWGYTVQKADKKTMEWFTVLEHYRRTHCV--VPELIIGNGYYFRVFSQNMVGFSDRA 1151
                   T  K +K+  E  TV  ++  +  +  + ++ + +   +   + N VG SD  
Sbjct: 3770 -------TWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVG-SDSC 3821

Query: 1152 ATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPK 1211
            +T                     +   E PSF + L    ++ G  A+L C V G+   +
Sbjct: 3822 ST--------------------EIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFE 3861

Query: 1212 ISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARC 1264
            ISWFK+   +    ++R+FS++ ++ LEI      D G Y C   N  G+  C
Sbjct: 3862 ISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGC 3914



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 102/453 (22%), Positives = 153/453 (33%), Gaps = 71/453 (15%)

Query: 820   RLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPAS-------QPFMPIGPPSE 872
             R+N ++   L   +  + +       VY V A   S  + A         P   +GP   
Sbjct: 28002 RMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP--- 28058

Query: 873   PTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVK 932
                +   +++   ++L W  P   G   +  Y +E        W A ++   E  S    
Sbjct: 28059 ---IRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAW-ALIEDKCEAQSYTAI 28114

Query: 933   DLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ---EILQRPRLQLPRHLRQTI------ 983
              L  G    FRV A N  G G P+ + +PV  Q    +   P +  P ++          
Sbjct: 28115 KLINGNEYQFRVSAVNKFGVGRPLDS-DPVVAQIQYTVPDAPGIPEPSNITGNSITLTWA 28173

Query: 984   --QKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSG 1041
               +   G  +   I  + + +    W K           I   P     F +        
Sbjct: 28174 RPESDGGSEIQQYI-LERREKKSTRWVKV----------ISKRPISETRF-KVTGLTEGN 28221

Query: 1042  TYQVTVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
              Y+  V  EN           +     + V+ P PP  ++VTD     V+LEW  P   G
Sbjct: 28222 EYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDG 28281

Query: 1094  NTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAA 1152
               E+ GY ++       +W  V  E   +T   V +L  G  Y FRV + N  G  D   
Sbjct: 28282 GMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCE 28341

Query: 1153  TTKEPVFIPRPGITYEPPNYKALDFSEAP------SFTQPLVNRSVIAGYTAMLCCAVRG 1206
              T                  KA+D   AP      +F Q  V R   AG +  L  A +G
Sbjct: 28342 VTG---------------TIKAVDRLTAPELDIDANFKQTHVVR---AGASIRLFIAYQG 28383

Query: 1207  SPKPKISWFKNGLDLGEDARFRMFSKQGVLTLE 1239
              P P   W K   +L   A          LT+E
Sbjct: 28384 RPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVE 28416



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 98/435 (22%), Positives = 159/435 (36%), Gaps = 53/435 (12%)

Query: 844   MRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDG 903
             ++ ++V  + + RP P + P            + V  VS  +  L W  P+  G   +  
Sbjct: 28728 VKTFSVTVVVIGRPGPVTGP------------IEVSSVSAESCVLSWGEPKDGGGTEITN 28775

Query: 904   YSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG-----PGAPVTT 958
             Y VE    G + W   +    + T I V  L       FRV + N  G       AP+  
Sbjct: 28776 YIVEKRESGTTAW-QLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIA 28834

Query: 959   TEPVTVQEILQRPRLQLPRHLRQTI--QKKVGEPVNLLIPF--QGKPRPQVTWTKEGQPL 1014
               P        RP +        +I  ++   +  + +I +  + K R  + W KE +  
Sbjct: 28835 EHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVP 28894

Query: 1015  AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRV 1074
               E        T  +  +    R ++      V   +   +  +    VD P  P+   V
Sbjct: 28895 CLE---CNYKVTGLVEGLEYQFRTYA-LNAAGVSKASEASRPIMAQNPVDAPGRPE---V 28947

Query: 1075  TDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTM---EW----FTVLEHYRRTHCVVP 1127
             TD     V+L W  P   G +++ GY +++     +    W    +T++     T   + 
Sbjct: 28948 TDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALS 29007

Query: 1128  ELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPL 1187
             E   G+ Y FRV ++N  G   + + +  PV        Y PP  + LD           
Sbjct: 29008 E---GDTYEFRVLAKNAAGVISKGSESTGPVTCRDE---YAPPKAE-LDARLHGDLV--- 29057

Query: 1188  VNRSVIAGYTAMLCCAVRGSPKPKISWFKNG--LDLGEDARFRMFSKQGVLTLEIRKPCP 1245
                ++ AG   +L  AV G P+PKI W K    LDL E    +   K+   T  I+    
Sbjct: 29058 ---TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRA--TAVIKFCDR 29112

Query: 1246  FDGGIYVCRATNLQG 1260
              D G Y     N  G
Sbjct: 29113 SDSGKYTLTVKNASG 29127



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 81/335 (24%), Positives = 134/335 (40%), Gaps = 41/335 (12%)

Query: 950  AGPG---APVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
            AGPG   AP   T+PV VQ++++                  G  V       G P+P V 
Sbjct: 1074 AGPGEPAAPYFITKPV-VQKLVE------------------GGSVVFGCQVGGNPKPHVY 1114

Query: 1007 WTKEGQPLAGE---EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVV 1063
            W K G PL      +VS      +  L I       +G Y + VR ++ E  A+  L   
Sbjct: 1115 WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEE 1174

Query: 1064 DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKK-TMEWFTVLEHYRRT 1122
                     +    +   V    + P+ VG T   G+   + +K+   E   + +   + 
Sbjct: 1175 ADYELLMKSQQEMLYQTQVTAFVQEPK-VGETAP-GFVYSEYEKEYEKEQALIRKKMAKD 1232

Query: 1123 HCVVPELIIGNGYYFRVFSQNMVGFSDRAA--TTKEPVFIPRPGITYEPPNYKALDFSEA 1180
              VV   +    ++   F + ++   +     TT E +      +  +     A+D SE+
Sbjct: 1233 TVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEEL------LEEDGEEKMAVDISES 1286

Query: 1181 PS----FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRM-FSKQGV 1235
             +    F   + N  ++ G      C + G P PKI+W+K+G  +    R++M F + G 
Sbjct: 1287 EAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGR 1346

Query: 1236 LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             +L I    P D GIY   A+N++G A C  +L V
Sbjct: 1347 ASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1381



 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 65/275 (23%), Positives = 104/275 (37%), Gaps = 65/275 (23%)

Query: 1032  IRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQD 1091
             ++A  +V  G Y   + ++N      +       P PP D+ V +     + + WKPP  
Sbjct: 14553 VKAVNKVGGGEY---IELKN----PVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLY 14605

Query: 1092  VGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELII-------GNGYYFRVFSQNM 1144
              G +++ GY ++K  K    W    EH      +VP L         G  Y FRV ++N 
Sbjct: 14606 DGGSKIMGYIIEKIAKGEERWKRCNEH------LVPILTYTAKGLEEGKEYQFRVRAENA 14659

Query: 1145  VGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAV 1204
              G S+ +  T               P  KA+D  +AP       +  V  G    L  ++
Sbjct: 14660 AGISEPSRAT---------------PPTKAVDPIDAPKVILR-TSLEVKRGDEIALDASI 14703

Query: 1205  RGSPKPKISWFKN-GLDLGEDARFRMF----------------------------SKQGV 1235
              GSP P I+W K+  + + E+ + R                              SK+G 
Sbjct: 14704 SGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGE 14763

Query: 1236  LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
               L +R     D G+Y+ +  N  G A+  C + V
Sbjct: 14764 SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 55/197 (27%), Positives = 95/197 (48%), Gaps = 10/197 (5%)

Query: 451  EPPVLITRPLEDQLVMVGQRVEFECEV-SEEGAQVKWLKDGVELTREETFKYRFKKDGQR 509
            E P +  R ++ Q V  G    F   V  +   + +W K+GV++ R +   + + +D   
Sbjct: 2076 EAPKIFER-IQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNV- 2133

Query: 510  HHLIINEAMLEDAGHY---ALCTSG-GQALAELIVQEKKLEVY-QSIADLMVGAKD-QAV 563
              L+I +   ED+      A+  +G   + A L+VQ K+L  + Q + D++   KD  A 
Sbjct: 2134 CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMAT 2193

Query: 564  FKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV-PEGFA 622
            F+CE S+  V+  W K+G E+    + ++    +VH L+I  +  +D  DYS V  E   
Sbjct: 2194 FECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN 2253

Query: 623  CNLSAKLHFMEVKIDFV 639
               +AKL      ++FV
Sbjct: 2254 VKTTAKLIVEGAVVEFV 2270



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 28/95 (29%), Positives = 46/95 (48%)

Query: 1176  DFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGV 1235
             + S+AP+F     ++++  G   +  C + G P P+I WFKN L +   +   +   + V
Sbjct: 33129 ELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNV 33188

Query: 1236  LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
              +LEIR     D G Y  +A N +G+      L V
Sbjct: 33189 YSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 33223



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 84/343 (24%), Positives = 125/343 (36%), Gaps = 68/343 (19%)

Query: 441   EKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEV-SEEGAQVKWLKDGVELTREETF 499
             E  S + F  +    IT  +    V  GQ   F   V S+  A+VKW  +GVEL  +E+ 
Sbjct: 32361 EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVEL--QESS 32418

Query: 500   KYRFKKDGQRHHLIINEAMLEDAGHY-ALCTS-GGQALAELIVQEKKLEVYQSIADLMVG 557
             K  +        L I +   +D+G Y A+CT+  G+A                 A L V 
Sbjct: 32419 KIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEA--------------SDYATLDVT 32464

Query: 558   AKDQAVFKCEVSDENV-RGVWLKNGKELVPDSRIKVSHIGRVHKLTIDD--------VTP 608
               D   +  +  DE V R V+     EL       VS   +  ++            +T 
Sbjct: 32465 GGDYTTYASQRRDEEVPRSVF----PELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTE 32520

Query: 609   ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRI---PDTIVVVAGN 665
               E+  S+     A   SA L    ++     R    KI      RI   P ++ V  G 
Sbjct: 32521 TRESLSSYEHSASAEMKSAALEEKSLEEKSTTR----KIKTTLAARILTKPRSMTVYEGE 32576

Query: 666   KLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRV 725
               R      G+P PTV W +                             K  +  T  R 
Sbjct: 32577 SARFSCDTDGEPVPTVTWLR-----------------------------KGQVLSTSARH 32607

Query: 726   RVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
             +V TTK +S F +   +  DEG Y+V V+N  G+ +   T+ +
Sbjct: 32608 QVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 32650



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 69/305 (22%), Positives = 116/305 (38%), Gaps = 26/305 (8%)

Query: 976   PRHLRQTIQKKVGEPVNLLIPFQ--GKPRPQVTWTKEGQPLA-GEEVSIRNSPTDTILFI 1032
             P  + Q   + + E  N+L   +  G+P P++ W K   P++    VSI  S     L I
Sbjct: 33134 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 33193

Query: 1033  RAARRVHSGTYQVTVRIENMEDKAT---LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
             R A    SG Y +  +    +  AT   +VL +V++PS    LR +    L  +   +  
Sbjct: 33194 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 33253

Query: 1090  Q-DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS 1148
             Q      E    +   +   +M          ++   + E  +       + S + +G S
Sbjct: 33254 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFV------EMSSSSFMGIS 33307

Query: 1149  DRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSP 1208
             +          + + GI   PP  +AL     PS      + S+  G    + CA  G P
Sbjct: 33308 NMTQLESSTSKMLKAGIRGIPPKIEAL-----PS------DISIDEGKVLTVACAFTGEP 33356

Query: 1209  KPKISWFKNG--LDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCEC 1266
              P+++W   G  +   E  RF + +   + TL I      DGG+Y     N  G      
Sbjct: 33357 TPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATV 33416

Query: 1267  RLEVR 1271
              + +R
Sbjct: 33417 NIHIR 33421



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 81/342 (23%), Positives = 131/342 (38%), Gaps = 44/342 (12%)

Query: 945  RAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
            +A N  G    V+ +  +TVQE  Q+      R LR  +Q+ VG PV       G     
Sbjct: 8034 KAENSVGE---VSASTFLTVQE--QKLPPSFSRQLRD-VQETVGLPVVFDCAISGSEPIS 8087

Query: 1005 VTWTKEGQPLAGEEVSIRNSPTDTI--LFIRAARRVHSGTYQVTVR--IENMEDKATLVL 1060
            V+W K+G+PL  +  +++ S  D    L I    R  +G Y  T    I +    A L+L
Sbjct: 8088 VSWYKDGKPLK-DSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLIL 8146

Query: 1061 QVVDKPS------PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFT 1114
                 P        P D  V ++      +    P  V     W    ++         +
Sbjct: 8147 TEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVS----WAKDSREIRSGGKYQIS 8202

Query: 1115 VLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK-EPVFIPRPGITYEPPNYK 1173
             LE+    H  V ++  G+   +  ++ N VG     A    +   IP            
Sbjct: 8203 YLEN--SAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIP------------ 8248

Query: 1174 ALDFSEAPSFTQPLVNR-SVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSK 1232
                   PSFT+ L        G +  L   V GS    ++W+KN +++   +   +  K
Sbjct: 8249 -------PSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFK 8301

Query: 1233 QGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
               L L++RK    D G+Y C+ +N  G A C   + ++ P+
Sbjct: 8302 NNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPK 8343



 Score = 55.8 bits (133), Expect = 3e-07
 Identities = 155/744 (20%), Positives = 254/744 (34%), Gaps = 112/744 (15%)

Query: 7    KPVSAFSKKPRSVEVAAGSPAVFEAETERAG-VKVRWQRGGSDISASNKYGLATEGTRHT 65
            K    FS  P  VE    +    E E       +V W +    + +S KY +A++    +
Sbjct: 5514 KEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTS 5573

Query: 66   LTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEP-----------MLAPAPAPAEAT 114
            + +  V  +D G Y   A  ++V  D  V   +  EP           ++A  PA  +A+
Sbjct: 5574 IHILNVDTSDIGEYHCKA-QNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQAS 5632

Query: 115  GAPGEAP--------------------------APAAELGESAPSPKGSSSAALNGPTPG 148
               G  P                              +  ++ P+  G     +     G
Sbjct: 5633 -IEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDG-G 5690

Query: 149  APDDPIGLFVMRPQ-------DGEVTVGGSITFSARVAGASLLKPPVVKWFK-GKWVDLS 200
              ++   L V+ P           VTVG + T   +VAG   L    V+W+K GK +  S
Sbjct: 5691 MRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELS---VEWYKDGKLLTSS 5747

Query: 201  SKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTK-DKFDCSNFNLTVHEA 259
             K          Y++ S + +  +   DA     G+Y  +V     K  C+         
Sbjct: 5748 QK-----HKFSFYNKISSLRILSVERQDA-----GTYTFQVQNNVGKSSCT-------AV 5790

Query: 260  MGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFS--SLLKKRDSFRTPRDSKLEAPA 317
            +   D  +  +F R     GG   +    +  +   S  S+    +  +    +K +   
Sbjct: 5791 VDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTF 5850

Query: 318  EEDVWEI----LRQAPPSEYERIAFQY-GVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPA 372
             ++V  +    L  +    Y  +A    G  + R +L          ++  +F K+ EP 
Sbjct: 5851 SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT--------VQEPPSFVKEPEPL 5902

Query: 373  YQVSKGHKIRLT-VELADHDAEVKWLKNGQEIQMSGSKYI-FESIGAKRTLTISQCSLAD 430
             +V  G  +  T V       +V W +  +E+       I FE   A+  L +    ++ 
Sbjct: 5903 -EVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAE--LELFNIDISQ 5959

Query: 431  DAAYQCVV----GGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE-GAQVK 485
               Y CVV    G   C+T LFVKEP   + R L D  V  G+ +  E   +      V 
Sbjct: 5960 SGEYTCVVSNNAGQASCTTRLFVKEPAAFLKR-LSDHSVEPGKSIILESTYTGTLPISVT 6018

Query: 486  WLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYAL---CTSGGQALAELIVQE 542
            W KDG  +T  E  K       +   L I  +   DAG Y+      +G      L+   
Sbjct: 6019 WKKDGFNITTSE--KCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTL 6076

Query: 543  KKLEVYQSIADLMVGAKDQAVFKCEVS-DENVRGVWLKNGKELVPDSRIKVSHIGRVHKL 601
            +       +  L     D    +C+V+    +   W K   +L P    +      V  L
Sbjct: 6077 EPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATL 6136

Query: 602  TIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVV 661
              + V   D  +Y+   E      S+K  F         RQ PP        R    I  
Sbjct: 6137 VFNKVNINDSGEYTCKAENSIGTASSKTVFR-----IQERQLPPSF-----ARQLKDIEQ 6186

Query: 662  VAGNKLRLDVPISGDPAPTVIWQK 685
              G  + L   ++G     V W +
Sbjct: 6187 TVGLPVTLTCRLNGSAPIQVCWYR 6210



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 27/94 (28%), Positives = 44/94 (46%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P+    L N +VI G +  L C + G P P ++W++    +     F++  + G+  L I
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 1002

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
            R+    D G + C A N  G     C L V+V +
Sbjct: 1003 REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 1036



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 24/85 (28%), Positives = 44/85 (51%)

Query: 12    FSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREV 71
             F  KP+++E+  G  A F     +    V+W+R    + + +KY +  +G +  L V++ 
Sbjct: 12554 FISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDA 12613

Query: 72    GPADQGSYAVIAGSSKVKFDLKVIE 96
                D G+Y V+ G+++    L VIE
Sbjct: 12614 TLQDMGTYVVMVGAARAAAHLTVIE 12638



 Score = 54.3 bits (129), Expect = 7e-07
 Identities = 31/96 (32%), Positives = 42/96 (43%)

Query: 1179 EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
            E P   Q L   +V +G  A  C  + G P+PKISW+K    L    + +        TL
Sbjct: 3237 EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTL 3296

Query: 1239 EIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
             + +  P D  +Y C A N  G A     L V VP+
Sbjct: 3297 LLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3332



 Score = 54.3 bits (129), Expect = 7e-07
 Identities = 111/523 (21%), Positives = 174/523 (33%), Gaps = 88/523 (16%)

Query: 316   PAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRD-------EKKSTAFQKK 368
             PAEE   +  R++P  E  R      V+  R + +  +  R D        K +   QK 
Sbjct: 32296 PAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKT 32355

Query: 369   LEPAYQV------SKGHKIRLTVELADH------------------DAEVKWLKNGQEIQ 404
              E  Y+V      +  H  R+T+ +  H                   AEVKW  NG E+Q
Sbjct: 32356 SERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQ 32415

Query: 405   MSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFV--------------- 449
              S SK  + +     TL I  C   D   Y+ V    K     +                
Sbjct: 32416 ES-SKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQ 32474

Query: 450   ---KEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKD 506
                +E P  +   L           +   E+ E  + V+ +K  +  TRE    Y     
Sbjct: 32475 RRDEEVPRSVFPELTRTEAYAVSSFKKTSEM-EASSSVREVKSQMTETRESLSSYEHSAS 32533

Query: 507   GQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKC 566
              +     + E  LE+        +     A ++ + + + VY+          + A F C
Sbjct: 32534 AEMKSAALEEKSLEEKSTTRKIKT--TLAARILTKPRSMTVYEG---------ESARFSC 32582

Query: 567   EVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNL 625
             +   E V  V WL+ G+ L   +R +V+         I  V  +DE +YS V E      
Sbjct: 32583 DTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQ 32642

Query: 626   SA-------KLHFMEVKIDFVPRQEPPKIHLDCPGRI--PDTIVVVAGNKLRLDVPISGD 676
              A       K    E  +   PR + P+  +  P  +  P  +     +  +   P    
Sbjct: 32643 EAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETK 32702

Query: 677   PAPT-------VIWQKAITQGNKAPARP-------APDAPEDTGDSDEWVFDKKLLCETE 722
             P PT       V     ITQ  KA A           ++         W  D K L E  
Sbjct: 32703 PTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKE-N 32761

Query: 723   GRVRVETTKDRSI-FTVEGAEKEDEGVYTVTVKNPVGEDQVNL 764
             G  +   + D +    +    + D+G Y   +    G  + NL
Sbjct: 32762 GHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNL 32804



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 93/427 (21%), Positives = 144/427 (33%), Gaps = 76/427 (17%)

Query: 376  SKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQ 435
            S+G   R    ++  D +V W    ++I+ S   +          L I++    D+  Y 
Sbjct: 3357 SEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRF-FRMTQFEDTYQLEIAEAYPEDEGTYT 3415

Query: 436  CVVG---GEKCST--------------------ELFVKEPPVLITRPLEDQLVMVGQRVE 472
             V     G+  ST                    E+ +K  PV I R +E   V +G   +
Sbjct: 3416 FVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPV-IKRKIEPLEVALGHLAK 3474

Query: 473  FECEV-SEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSG 531
            F CE+ S    + +W K G E+   +    R  K      L I    + D G Y    S 
Sbjct: 3475 FTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSK--YISSLEILRTQVVDCGEYTCKASN 3532

Query: 532  G----QALAELIVQEKKLEVYQSIA-DLMVGAKDQAVFKCEVSDENV-RGVWLKNGKELV 585
                    A L V E     + S    L       A F C V+   V   +W K+G  L 
Sbjct: 3533 EYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALS 3592

Query: 586  PDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPP 645
            P    ++S     H L + ++T  D   YS       C  S K      + + +   +P 
Sbjct: 3593 PSPNWRISDAENKHILELSNLTIQDRGVYS-------CKASNKFGADICQAELIIIDKPH 3645

Query: 646  KIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDT 705
             I      +  + +      K+ L+  +  D   TV W K    G K P           
Sbjct: 3646 FI------KELEPVQSAINKKVHLECQVDEDRKVTVTWSK---DGQKLP----------P 3686

Query: 706  GDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLT 765
            G   +  F+ K+                +   +  A+ +D G Y  T  N  G    + T
Sbjct: 3687 GKDYKICFEDKI----------------ATLEIPLAKLKDSGTYVCTASNEAGSSSCSAT 3730

Query: 766  VKVIDVP 772
            V V + P
Sbjct: 3731 VTVREPP 3737



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 31/104 (29%), Positives = 46/104 (44%)

Query: 1167  YEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDAR 1226
             YE  + +      AP  T  + +  V  G        V+  P  ++ W+ NG++L E ++
Sbjct: 32360 YEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSK 32419

Query: 1227  FRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
                 +  GVLTLEI      D G Y    TN +GEA     L+V
Sbjct: 32420 IHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 150/740 (20%), Positives = 256/740 (34%), Gaps = 107/740 (14%)

Query: 12   FSKKPRSVEVAAGSPAVFEAE-TERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVRE 70
            F  +P+S+    G  A F    T    ++  WQ+ G+ +S S  + ++    +H L +  
Sbjct: 3553 FLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSN 3612

Query: 71   VGPADQGSYAVIAGSSKVKFDLKVIEAEKA---EPMLAPAPAPAEA-----------TGA 116
            +   D+G Y+  A +   KF   + +AE     +P       P ++              
Sbjct: 3613 LTIQDRGVYSCKASN---KFGADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDE 3669

Query: 117  PGEAPAPAAELGESAPSPKG------SSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGG 170
              +     ++ G+  P  K          A L  P     D    +     + G  +   
Sbjct: 3670 DRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSA 3729

Query: 171  SIT------FSARVAGASLLKP-------------PVVK--WFK-GKWVDLSSKVGQHLQ 208
            ++T      F  +V  + L+ P             PV++  WFK  K +  S+ V  +  
Sbjct: 3730 TVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFV 3789

Query: 209  LHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLL 268
              ++           L ITD +   +GSY CE       D  +  + + E         +
Sbjct: 3790 NSEAI----------LDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPP-----SFI 3834

Query: 269  SAFRRTSLAGGGRRISDSH-EDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEI--L 325
                   +  G   +       TG  +  S  K +   R+ +  +L +       EI   
Sbjct: 3835 KTLEPADIVRGTNALLQCEVSGTGPFEI-SWFKDKKQIRSSKKYRLFSQKSLVCLEIFSF 3893

Query: 326  RQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTV 385
              A   EYE +     V     M   L       K+   F KK++    +  G  + L  
Sbjct: 3894 NSADVGEYECVVAN-EVGKCGCMATHLL------KEPPTFVKKVDDLIALG-GQTVTLQA 3945

Query: 386  EL-ADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV----VGG 440
             +       V W+K GQE+     K           L I    ++    Y C+     G 
Sbjct: 3946 AVRGSEPISVTWMK-GQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGS 4004

Query: 441  EKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETF 499
            +    EL VKEP  +I R  E   V  G     E  V+     + KW KDG  L   + +
Sbjct: 4005 QTSVGELIVKEPAKIIER-AELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKY 4063

Query: 500  KYRFKKDGQRHHLIINEAMLEDAGHYALCTSG--GQALAE--LIVQEKKLEVY--QSIAD 553
            +  FK +  +  L    A L D+G Y    S   G +  E    V ++ +  +  + + +
Sbjct: 4064 RISFKNNVAQ--LKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRN 4121

Query: 554  LMVGAKDQAVFKCEVSDE-NVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEA 612
            +           C+++    +R  W K+GKE+    R +++ +     L I  V   D  
Sbjct: 4122 VDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAG 4181

Query: 613  DYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVP 672
            +       F C  +  +   +     +  QEPP          P +  V+ G+ + L   
Sbjct: 4182 N-------FTCRATNSVGSKDSSGALIV-QEPPSFVTK-----PGSKDVLPGSAVCLKST 4228

Query: 673  ISGDPAPTVIWQKAITQGNK 692
              G    T+ W K    GNK
Sbjct: 4229 FQGSTPLTIRWFK----GNK 4244



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 28/90 (31%), Positives = 42/90 (46%)

Query: 6     KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHT 65
             K+P   F+K      V  G+ AV E E  R   KV+W + G++I  S KY +  +G    
Sbjct: 12281 KEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRK 12340

Query: 66    LTVREVGPADQGSYAVIAGSSKVKFDLKVI 95
             L + +  P D  +Y   A   K   +L V+
Sbjct: 12341 LVIHDCTPEDIKTYTCDAKDFKTSCNLNVV 12370



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 52/164 (31%), Positives = 74/164 (45%), Gaps = 17/164 (10%)

Query: 378   GHKIRLTVELADH-DAEVKWLKNGQEIQMSGS--KYIFESIGAKRTLTISQCSLADDAAY 434
             G  +R  V +  H +  V W K+GQ+I+   +  KY FES      LTI+  +  DDA Y
Sbjct: 31704 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEY 31763

Query: 435   QCVV----GGEKCSTELFV--KEPPVLIT-RPLEDQLV-----MVGQRVEFECEVSE-EG 481
               V     G + C  +L V    PP   T RP+  +L+       GQ V FE  VS    
Sbjct: 31764 TVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPP 31823

Query: 482   AQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHY 525
               +KW KDG  L+     +    +    + L I + + ED G+Y
Sbjct: 31824 PTLKWEKDGQPLSLGPNIEI-IHEGLDYYALHIRDTLPEDTGYY 31866



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 14    KKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGP 73
             + P+ +  A G+  VF AE  +  V+V+W R    +   +K+ + +EG  H L + ++ P
Sbjct: 12916 RPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKP 12975

Query: 74    ADQGSYAVIAGSSKVKFDLKVIEAEK 99
              DQG Y  IA   + +  L++  A K
Sbjct: 12976 RDQGEYRFIAKDKEARAKLELAAAPK 13001



 Score = 51.6 bits (122), Expect = 5e-06
 Identities = 28/91 (30%), Positives = 42/91 (46%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P F Q L   +V  G    L C V+GS   +I W K G ++    R       G   LE+
Sbjct: 8346 PVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLEL 8405

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
            R     D G YVC+A+N+ G    + ++ ++
Sbjct: 8406 RDVAKADSGDYVCKASNVAGSDTTKSKVTIK 8436



 Score = 50.8 bits (120), Expect = 8e-06
 Identities = 51/207 (24%), Positives = 78/207 (37%), Gaps = 17/207 (8%)

Query: 1055  KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGY-TVQKADKKTMEWF 1113
             K  L    + +P PP+ L VT+    +  L W PP   G  ++ GY T  + +++  + +
Sbjct: 18788 KPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRW 18847

Query: 1114  TVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYK 1173
             T     +    VV  L  G  Y FRV ++N VG S           +PR         Y+
Sbjct: 18848 TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVS-----------LPREAEGV----YE 18892

Query: 1174  ALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQ 1233
             A +    P    P    ++ AG    +   V G P P   W K   ++   +   +    
Sbjct: 18893 AKEQLLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKAD 18951

Query: 1234  GVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                 L I+     D G Y   A N  G
Sbjct: 18952 SSSILIIKDVTRKDSGYYSLTAENSSG 18978



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 22/81 (27%), Positives = 39/81 (48%)

Query: 17    RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
             + +E        F  +  R  V ++W + G ++   N+     +  +H LT+++ G  D+
Sbjct: 12741 KDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDE 12800

Query: 77    GSYAVIAGSSKVKFDLKVIEA 97
             G Y V AG  K   +L +IEA
Sbjct: 12801 GEYIVTAGQDKSVAELLIIEA 12821



 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 53/164 (32%), Positives = 80/164 (48%), Gaps = 20/164 (12%)

Query: 393 EVKWLKNGQEIQMS---GSKYIFESIGAKRTLTISQCSLADDAAYQCVV---GGEKCST- 445
           EV W ++GQ I  S   G +  F    AK  LTI   + A+   Y        G+  ST 
Sbjct: 36  EVSWFRDGQVISTSTLPGVQISFSDGRAK--LTIPAVTKANSGRYSLKATNGSGQATSTA 93

Query: 446 ELFVKE---PPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV-KWLKDGVELTREETFKY 501
           EL VK    PP  + R L+   V  G +V  +  V+     V K+ +DG E+  + +  +
Sbjct: 94  ELLVKAETAPPNFVQR-LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI--QSSLDF 150

Query: 502 RFKKDGQRHHLIINEAMLEDAGHYAL--CTSGGQA--LAELIVQ 541
           +  ++G  + L+I EA  ED+G Y++    S G+A   AEL+VQ
Sbjct: 151 QISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 129/664 (19%), Positives = 223/664 (33%), Gaps = 104/664 (15%)

Query: 131  APSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVK 190
            A +P GS+S +        P     +F   P   E      ++    ++G     P  V 
Sbjct: 5498 AQNPAGSTSCSTKVIVKEPP-----VFSSFPPIVETLKNAEVSLECELSGTP---PFEVV 5549

Query: 191  WFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCS 250
            W+K K    SSK          Y  ASK +   +HI +   +  G Y C+   +   D  
Sbjct: 5550 WYKDKRQLRSSK---------KYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTC 5600

Query: 251  NFNLTVHE-AMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPR 309
               + + E       L+ L     T +AG    +  S E    +    L +K +  R   
Sbjct: 5601 VCTVKLKEPPRFVSKLNSL-----TVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESE 5655

Query: 310  DSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKL 369
            + ++         +  +  P +  + I            +K   GMR    ++ A    L
Sbjct: 5656 NIRITFVENVATLQFAKAEPANAGKYIC----------QIKNDGGMR----ENMATLMVL 5701

Query: 370  EPAYQVSKGHKIRLTV---------ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT 420
            EPA  V K   + +TV              +  V+W K+G ++  S  K+ F       +
Sbjct: 5702 EPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDG-KLLTSSQKHKFSFYNKISS 5760

Query: 421  LTISQCSLADDAAY----QCVVGGEKCSTELFVKE--PPVLITRPLEDQLVMVGQRVEFE 474
            L I      D   Y    Q  VG   C+  + V +   P   TR L++   ++G     E
Sbjct: 5761 LRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILE 5820

Query: 475  CEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHY----ALCT 529
            C+V+      V W  +  ++     ++  F  +     L +N     D G+Y    A   
Sbjct: 5821 CKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCT--LQLNSLDSSDMGNYTCVAANVA 5878

Query: 530  SGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSR 589
               +  A L VQE    V +     ++  K+             +  W +  +ELV   R
Sbjct: 5879 GSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDR 5938

Query: 590  IKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLH-FMEVKIDFVPRQEPPKIH 648
              +     V +L + ++  +   +Y+ V    A   S     F++    F+ R     + 
Sbjct: 5939 CNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVE 5998

Query: 649  LDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDS 708
                           G  + L+   +G    +V W+K              D    T   
Sbjct: 5999 --------------PGKSIILESTYTGTLPISVTWKK--------------DGFNIT--- 6027

Query: 709  DEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
                        T  +  + TT+   I  +  + K D G Y+  ++N  G D     V  
Sbjct: 6028 ------------TSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVST 6075

Query: 769  IDVP 772
            ++ P
Sbjct: 6076 LEPP 6079



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 54/228 (23%), Positives = 83/228 (36%), Gaps = 35/228 (15%)

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
             L +  +  P+ P+ L  T+     + L+WK P+  G + + GY ++K      ++    E
Sbjct: 15287 LAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDF----E 15342

Query: 1118  HYRRTHCVVPELIIGN-----GYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNY 1172
                +  C     ++ N      Y FRV + N +G S+ +                 P N 
Sbjct: 15343 RVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSL----------------PLNV 15386

Query: 1173  KALDFSEAPSFTQPLVNRS----VIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFR 1228
                D    P+    L  R     V AG    +   V G P PKI W KN   + +     
Sbjct: 15387 VIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDAL 15446

Query: 1229  MFSKQGV------LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
               +K+ V        L I K    D G Y   A+N  G       +EV
Sbjct: 15447 QITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 15494



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 24/94 (25%), Positives = 40/94 (42%)

Query: 1178  SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             S  P     L + +V +   A       G P+P   W K+G  + +  ++++   +G   
Sbjct: 32849 SSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF 32908

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
             LEI K    D G+Y C   N  G     C+L ++
Sbjct: 32909 LEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIK 32942



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 24/81 (29%), Positives = 37/81 (45%)

Query: 14   KKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGP 73
            KKP+ V     +   FE       V V+W     +I  S+K+ L +E   H L ++ + P
Sbjct: 2799 KKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2858

Query: 74   ADQGSYAVIAGSSKVKFDLKV 94
            +D G Y  + G  + K  L V
Sbjct: 2859 SDAGEYTAVVGQLECKAKLFV 2879



 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 1178 SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA--RFRMFSKQGV 1235
            ++AP+FTQPL +  V+ G TA     + G P P++SWF++G  +        ++    G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1236 LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
              L I      + G Y  +ATN  G+A     L V+
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 54/233 (23%), Positives = 91/233 (39%), Gaps = 50/233 (21%)

Query: 545   LEVYQSIADLMVGAKD----QAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK 600
             L+  + I D+++   +     A+F+C VS       W+K+G  +    + +    G+  K
Sbjct: 11115 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRK 11174

Query: 601   LTIDDVTPADEADYSFVPE--GFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDT 658
             L I DV  +D  +Y+ V          +AKL   E+ + FV   E             + 
Sbjct: 11175 LHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLE-------------EE 11221

Query: 659   IVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLL 718
             + VV G  L L   ++ +    V+W+K                            D K++
Sbjct: 11222 VTVVKGQPLYLSCELNKE--RDVVWRK----------------------------DGKIV 11251

Query: 719   CETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDV 771
              E  GR+           T+  A+  D G YTVTV+N     + +  VKV++V
Sbjct: 11252 VEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN-ANNLECSSCVKVVEV 11303



 Score = 47.8 bits (112), Expect = 7e-05
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 3/93 (3%)

Query: 1181  PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDL---GEDARFRMFSKQGVLT 1237
             P FT PL N++   G        +   P+P ++W+K+G  +     D ++   S +G+  
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 31749

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             L I      D   Y   A N  GE  C+ +L V
Sbjct: 31750 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 22/82 (26%), Positives = 35/82 (42%)

Query: 13   SKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVG 72
            +K  +++EV     A FE E     V   W + G +I  S K+ +  +G  H L +    
Sbjct: 2885 TKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTS 2944

Query: 73   PADQGSYAVIAGSSKVKFDLKV 94
              D   Y  + G+ +V   L V
Sbjct: 2945 TEDSAEYTFVCGNDQVSATLTV 2966



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 37/80 (46%)

Query: 17    RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
             + V V AG  A F+ E     + V W   G  +  S+K    +EG  HTLT+R+V   D 
Sbjct: 12203 KDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDA 12262

Query: 77    GSYAVIAGSSKVKFDLKVIE 96
             G   + A   K   +L V E
Sbjct: 12263 GEVQLTAKDFKTHANLFVKE 12282



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 1183  FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRK 1242
             FT+PL +++V  G TA+L C V      K+ WFKNG ++ +  ++ + +   V  L I  
Sbjct: 12287 FTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 12345

Query: 1243  PCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
               P D   Y C A +     +  C L V  P
Sbjct: 12346 CTPEDIKTYTCDAKDF----KTSCNLNVVPP 12372



 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 33/108 (30%), Positives = 43/108 (39%), Gaps = 6/108 (5%)

Query: 1165  ITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNG--LDLG 1222
             +T  PP     D +  P F + L N     G +      V G P P + W K+G  L LG
Sbjct: 31782 VTLHPP---PTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLG 31838

Query: 1223  EDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
              +    +        L IR   P D G Y   ATN  G   C+  L+V
Sbjct: 31839 PNIEI-IHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 48/223 (21%), Positives = 85/223 (38%), Gaps = 8/223 (3%)

Query: 558   AKDQAVFKCEVSDENVRG---VWLKNGKELVPDSRIKVSHIGR-VHKLTIDDVTPADEAD 613
             +K+ A   C V    +R     W K+GK+L  +   +  +     ++L I+++T +D+ +
Sbjct: 32729 SKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGE 32788

Query: 614   YSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPI 673
             Y     G        L FM      +  +           +      V    + +   PI
Sbjct: 32789 YVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI 32848

Query: 674   SGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDR 733
             S  P   V   +  T  + + A+ A  A  +   +  W  D K + +  G+ ++   K  
Sbjct: 32849 SSKPV-IVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG-GKYKLSEDKGG 32906

Query: 734   SIFTVEGAEKEDEGVYTVTVKNPVG--EDQVNLTVKVIDVPDA 774
                 +   +  D G+YT TVKN  G       LT+K I   +A
Sbjct: 32907 FFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEA 32949



 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 26/91 (28%), Positives = 43/91 (47%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P+F Q L + +V  G    L   V G P P + ++++G ++     F++  +  + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
             +  P D G Y   ATN  G A     L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 29/108 (26%), Positives = 49/108 (45%), Gaps = 16/108 (14%)

Query: 10    SAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVR 69
             + F+K   ++EV+         E  + G +V W +G  +I  + +Y + TEG +  L ++
Sbjct: 12463 AVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQ 12522

Query: 70    EVGPADQGSYAVIAGSS----KVKF------------DLKVIEAEKAE 101
                  D G+Y     SS    KVK             +L+++E EKAE
Sbjct: 12523 NAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAE 12570



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 23/76 (30%), Positives = 35/76 (46%)

Query: 28   VFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSK 87
            VFE E   +G+ V W     +I  S+KY +   G  + LTV  +   D+G Y   AG + 
Sbjct: 2551 VFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENM 2610

Query: 88   VKFDLKVIEAEKAEPM 103
                L V     ++P+
Sbjct: 2611 TSGKLTVAGGAISKPL 2626



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 14/111 (12%)

Query: 453  PVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHH 511
            P  IT+P+  +LV  G  V F C+V       V W K GV LT    +K  + K      
Sbjct: 1082 PYFITKPVVQKLVEGGS-VVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1140

Query: 512  LIINEAMLEDAGHYALC-------TSGGQALA-----ELIVQEKKLEVYQS 550
            L+I+    +DAG Y +        TS   +L      EL+++ ++  +YQ+
Sbjct: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQT 1191



 Score = 41.6 bits (96), Expect = 0.005
 Identities = 21/86 (24%), Positives = 38/86 (44%)

Query: 9    VSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTV 68
            V  F K+ + +EV        E       ++ +W     ++ ++ KY + +   R  LTV
Sbjct: 2266 VVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTV 2325

Query: 69   REVGPADQGSYAVIAGSSKVKFDLKV 94
            ++V   DQG Y+ +    K    LK+
Sbjct: 2326 KDVTKEDQGEYSFVIDGKKTTCKLKM 2351



 Score = 41.6 bits (96), Expect = 0.005
 Identities = 26/94 (27%), Positives = 38/94 (40%), Gaps = 1/94 (1%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P+   PL +     G  A   C V G+   K+SW+     +     FRM   +    LEI
Sbjct: 3345 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
             +  P D G Y   A+N  G+      L +  P+
Sbjct: 3404 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPE 3437



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 23/105 (21%), Positives = 46/105 (43%), Gaps = 16/105 (15%)

Query: 12   FSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREV 71
            F K  + ++V     A+FE E     + V+W +   ++  +++  +  E   H L +   
Sbjct: 3060 FRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPST 3119

Query: 72   GPADQGSYAVIAGSS----------------KVKFDLKVIEAEKA 100
              +D G Y V+AG +                 +K +++VIE ++A
Sbjct: 3120 RMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRA 3164



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 23/91 (25%), Positives = 41/91 (45%)

Query: 8     PVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLT 67
             P   F +    ++V     A FE E  R   KV+W + G++I    KY + ++G    L 
Sbjct: 12372 PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV 12431

Query: 68    VREVGPADQGSYAVIAGSSKVKFDLKVIEAE 98
             + +    D+  Y+    +++    L V+E E
Sbjct: 12432 INKCLLDDEAEYSCEVRTARTSGMLTVLEEE 12462



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 38/167 (22%), Positives = 69/167 (41%), Gaps = 8/167 (4%)

Query: 457 TRPLEDQLVMVGQRVEFECEVSE-EGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIIN 515
           T+PL+  +V+ G    FE  +S     +V W +DG  ++       +      R  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 516 EAMLEDAGHYALCTSGGQ----ALAELIVQEKKL--EVYQSIADLMVGAKDQAVFKCEVS 569
                ++G Y+L  + G     + AEL+V+ +       Q +  + V    Q   +  V+
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 570 DENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYS 615
                 V + ++G E+      ++S  G ++ L I +  P D   YS
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 27   AVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA-VIAGS 85
            A FE ET    VKV+W + G ++   +KY + ++   H L++  +  +D   Y+ V+   
Sbjct: 2192 ATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVED 2251

Query: 86   SKVKFDLKVI 95
              VK   K+I
Sbjct: 2252 ENVKTTAKLI 2261



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 29/105 (27%), Positives = 44/105 (41%), Gaps = 9/105 (8%)

Query: 27    AVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA--VIAG 84
             AVF  +  R    V+W R G +I    KY    +G+ H L +++    D+  YA  V   
Sbjct: 12840 AVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDR 12899

Query: 85    SSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGE 129
              S+ +  ++ I  E   P       P +   APG      AEL +
Sbjct: 12900 KSRARLFVEEIPVEIIRP-------PQDILEAPGADVVFLAELNK 12937



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 40    VRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEK 99
             ++W R G ++  S KY ++++G  HTLTV      D+G Y  IA +   + +       +
Sbjct: 30564 IKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQ 30623

Query: 100   AEPMLAPA-PAPAEATGAPG 118
             A P   P  P   +  GA G
Sbjct: 30624 ATPQFHPGYPLKEKYYGAVG 30643



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 69/326 (21%), Positives = 130/326 (39%), Gaps = 64/326 (19%)

Query: 478   SEEGAQVKWLKDGVELTREE---TFKYR------FKKDGQRHHLIINEAMLEDAGHYALC 528
             + E  Q  WLK  +E    +   T K+R       KKD    +++++ A +   G  A+ 
Sbjct: 31496 ASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLIKKD---LNMVVSAARISCGG--AIR 31550

Query: 529   TSGGQALAELIVQEKKL-----EVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKE 583
             +  G ++A++ V   ++     ++  ++ +   G   + V K E  D++ +  W    ++
Sbjct: 31551 SQKGVSVAKVKVASIEIGPVSGQIMHAVGE--EGGHVKYVCKIENYDQSTQVTWYFGVRQ 31608

Query: 584   LVPDSRIKVSHIGRVHKLTIDDVTPADEADY--SFVPEGFACNLSAKLHFMEVK--IDFV 639
             L    + ++++   V  L + D+T  D+  Y    V +    +  A+L    V+   D+ 
Sbjct: 31609 LENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYY 31668

Query: 640   PRQEPPKIH--------LDCPGRIPDTI---VVVAGNKLRLDVPISGDPAPTVIWQKAIT 688
              R+   KI         L+ P      +       G  +R  V I+  P P V W K+  
Sbjct: 31669 CRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKS-- 31726

Query: 689   QGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGV 748
              G K   +P  +  + T +SD+ ++                       T+     +D+  
Sbjct: 31727 -GQKI--KPGDNDKKYTFESDKGLYQ---------------------LTINSVTTDDDAE 31762

Query: 749   YTVTVKNPVGED--QVNLTVKVIDVP 772
             YTV  +N  GED  +  LTV +   P
Sbjct: 31763 YTVVARNKYGEDSCKAKLTVTLHPPP 31788



 Score = 40.4 bits (93), Expect = 0.011
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 38    VKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKV 94
             V V+W + G +I  S KY +  +G R  L +++    D+G Y    G+ K K ++ V
Sbjct: 11690 VPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTV 11746



 Score = 40.4 bits (93), Expect = 0.011
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 19    VEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGS 78
             V+V     A FE E  R     RW +G  +I+  +++ L  +GT+H++ ++     D+  
Sbjct: 11849 VKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAK 11908

Query: 79    Y 79
             Y
Sbjct: 11909 Y 11909



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 46/199 (23%), Positives = 87/199 (43%), Gaps = 20/199 (10%)

Query: 453  PVLITRPLEDQLVMVGQRVEFECEV-SEEGAQVKWLKDGVELTREETFKYRFKKDGQRHH 511
            PV + +P+  +  + GQ   F+ +V      +  W  DG ++  + T K   K+DG +  
Sbjct: 1457 PVFVLKPVSFKC-LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ-S 1514

Query: 512  LIINEAMLEDAGHYALCT---SGGQALAELI-VQEKKLEVYQSIADLM--VGAKDQAVFK 565
            LII  A   D+G + +     +G  +++ ++ V+  + +V     + +  V  K+ +  +
Sbjct: 1515 LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLE 1574

Query: 566  CEV---SDENVRGVWLKNGKELVPDS--RIKVSHIGRVHKLTIDDVTPADEADYSFVPEG 620
             +V    + N   VWLKN   +VP    +I++        L ID     D A Y+     
Sbjct: 1575 MKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAIN 1634

Query: 621  FA------CNLSAKLHFME 633
             A      C ++ ++ F E
Sbjct: 1635 KAGRDTTRCKVNVEVEFAE 1653



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 1/98 (1%)

Query: 1177 FSEAPS-FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGV 1235
            + +AP+ F + L + S+  G   +L     G+P   ++W KNG+++    R  + + +  
Sbjct: 7863 YIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKS 7922

Query: 1236 LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
              LEI      D G Y C   N  G+  C  ++ +  P
Sbjct: 7923 AILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP 7960



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 29/94 (30%), Positives = 37/94 (39%), Gaps = 1/94 (1%)

Query: 11   AFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVRE 70
            A SK      VA    AVFE E      K  W R G  +  +N     ++G +  L +  
Sbjct: 2621 AISKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAA 2680

Query: 71   VGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPML 104
                D G Y     +SK    LKV EA K +  L
Sbjct: 2681 TKLDDIGEYTYKVATSKTSAKLKV-EAVKIKKTL 2713



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 16/88 (18%)

Query: 29   FEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSS-- 86
            FE      G+  +W + G +I +++K  + T+   H+L +R V   D   Y  +AG +  
Sbjct: 2988 FEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATS 3047

Query: 87   ---------KVKF-----DLKVIEAEKA 100
                      ++F     D+KV+E ++A
Sbjct: 3048 TATLYVEARHIEFRKHIKDIKVLEKKRA 3075



 Score = 38.5 bits (88), Expect = 0.041
 Identities = 22/81 (27%), Positives = 35/81 (43%)

Query: 1191  SVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGI 1250
             +V  G +A   C   G P P ++W + G  L   AR ++ + +   T EI      D G 
Sbjct: 32571 TVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGN 32630

Query: 1251  YVCRATNLQGEARCECRLEVR 1271
             Y     N +G+   E  L ++
Sbjct: 32631 YSVVVENSEGKQEAEFTLTIQ 32651



 Score = 38.1 bits (87), Expect = 0.054
 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 9/102 (8%)

Query: 11   AFSKKPRSVEVAAGSPAVFEAETERAG-VKVRWQRGGSDISASNKYGLATEGTRHTLTVR 69
            +F++K +     +GS  V E +   +  + V W   G++IS+  KY          LTV 
Sbjct: 7683 SFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVN 7742

Query: 70   EVGPADQGSYAVI----AGSSKVKFDLKVIE----AEKAEPM 103
             +  +D G Y  I    AGS +    L V E     +K +PM
Sbjct: 7743 MLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPM 7784



 Score = 37.7 bits (86), Expect = 0.071
 Identities = 30/109 (27%), Positives = 43/109 (39%), Gaps = 1/109 (0%)

Query: 1163 PGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLG 1222
            PG   E  +   L+    P F    V+   + G TA     V G P P+  WF +G  + 
Sbjct: 1439 PGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIV 1498

Query: 1223 EDARFRMFSKQ-GVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             D   ++  K+ G  +L I    P D G +   A N  G +     L V
Sbjct: 1499 NDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTV 1547



 Score = 36.6 bits (83), Expect = 0.16
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 456   ITRPLEDQLVMVGQRVEFECE-VSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLII 514
             I + ++D    +G+  +  C+ V      +KW + G EL +    KY+   DG+ H L +
Sbjct: 30535 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSR--KYKMSSDGRTHTLTV 30592

Query: 515   NEAMLEDAGHY 525
                  ED G Y
Sbjct: 30593 MTEEQEDEGVY 30603



 Score = 36.6 bits (83), Expect = 0.16
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 1175  LDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSP--KPKISWFKNGLDLGEDARFRM-FS 1231
             L  S  P  TQ L  ++  +   A L C V  S     +++W+K+G  L E+  F+  +S
Sbjct: 32712 LPVSAPPKITQFL--KAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYS 32769

Query: 1232  KQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
               G   L+I      D G YVC  +   G ++
Sbjct: 32770 ADGTYELKINNLTESDQGEYVCEISGEGGTSK 32801



 Score = 36.2 bits (82), Expect = 0.21
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query: 17   RSVEVAAGSPAVFEAETERAGV-KVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPAD 75
            + V V  G+ AV E +     V  V+W      I   ++     +GT+  L +     +D
Sbjct: 2452 KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASD 2511

Query: 76   QGSYAVIAGSSKVKFDLKV 94
            +G Y +I G  +   +L V
Sbjct: 2512 EGPYKLIVGRVETNCNLSV 2530



 Score = 36.2 bits (82), Expect = 0.21
 Identities = 55/274 (20%), Positives = 91/274 (33%), Gaps = 66/274 (24%)

Query: 17   RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDIS--ASNKYGLATEGTRHTLTVREVGPA 74
            + V+V     AV E E     V   W + G +I+     ++    E   H + + E   +
Sbjct: 3154 KEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQS 3213

Query: 75   DQGSYAVIAGSSKVKFDLKVIEAE------KAEPMLAPAPAPAEATGAPGEAPAPAAE-- 126
            D G Y  +AG ++    L V   E      + +P+   +  PA         P P     
Sbjct: 3214 DAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWY 3273

Query: 127  ------------------------LGESAPSPKG---------------SSSAALNGPTP 147
                                    L E+ P                   S+S ++  P  
Sbjct: 3274 KEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEV 3333

Query: 148  GAPDDPIGLF---VMRP-QDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKV 203
             +PD  + ++   ++ P QD   + G    F  RV+G  L     V W+        S+ 
Sbjct: 3334 VSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL----KVSWYSKDKKIKPSRF 3389

Query: 204  GQHLQLHDSYDRASKVYLFELHITDAQPAFTGSY 237
             +  Q  D+Y         +L I +A P   G+Y
Sbjct: 3390 FRMTQFEDTY---------QLEIAEAYPEDEGTY 3414



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 14   KKPRSVEVAAGSPAVFEAETERAGVK-VRWQRGGSDISASNKYGLATEGTRHTLTVREVG 72
            K  +++ V     AVF  E     VK V+W + G  + ++ KY ++ +GT ++L ++   
Sbjct: 2711 KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCA 2770

Query: 73   PADQGSYAVIAG 84
              D+  Y    G
Sbjct: 2771 IVDESVYGFRLG 2782



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 25/95 (26%), Positives = 39/95 (41%)

Query: 1179 EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
            E  +F + L + SV  G   +L     G+P   +SW K+   + +  R  +   +    L
Sbjct: 6925 EPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTIL 6984

Query: 1239 EIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
            EI +    D   Y C   N  G+  CE  + V  P
Sbjct: 6985 EILESTIEDYAQYSCLIENEAGQDICEALVSVLEP 7019



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 23/78 (29%), Positives = 35/78 (44%)

Query: 19    VEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGS 78
             VEV  G  A FE E     V  +W+  G  ++AS    +  +G +H L +        G 
Sbjct: 11760 VEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGE 11819

Query: 79    YAVIAGSSKVKFDLKVIE 96
              +  A ++K   +LKV E
Sbjct: 11820 VSFQAANAKSAANLKVKE 11837



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 28    VFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSK 87
             + + E  +A   V+W + G +I  S    +  +G +  L +++   +D G Y    G+ K
Sbjct: 12036 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDK 12095

Query: 88    V--KFDLKVIEAEKAEPM 103
                K D++  E +   P+
Sbjct: 12096 TSGKLDIEDREIKLVRPL 12113



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 19/118 (16%)

Query: 577   WLKNGKELVP---DSRIKVSHIGRVHKLTIDDVTPADEADYSFVP------EGFACNLSA 627
             W K+G+++ P   D +        +++LTI+ VT  D+A+Y+ V       +     L+ 
Sbjct: 31723 WYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782

Query: 628   KLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQK 685
              LH         P  +    + +C            G  +  ++ +SG P PT+ W+K
Sbjct: 31783 TLHPPPTDSTLRPMFKRLLANAECQ----------EGQSVCFEIRVSGIPPPTLKWEK 31830



 Score = 35.4 bits (80), Expect = 0.35
 Identities = 16/47 (34%), Positives = 30/47 (63%)

Query: 40  VRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSS 86
           V++ R G++I +S  + ++ EG  ++L + E  P D G+Y+V A +S
Sbjct: 135 VKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181



 Score = 35.4 bits (80), Expect = 0.35
 Identities = 45/203 (22%), Positives = 72/203 (35%), Gaps = 60/203 (29%)

Query: 40    VRWQRGGSDISASN---KYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIE 96
             V W + G  I   +   KY   ++   + LT+  V   D   Y V+A +   +      +
Sbjct: 31721 VTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE------D 31774

Query: 97    AEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGL 156
             + KA+  +   P P ++T  P                                      +
Sbjct: 31775 SCKAKLTVTLHPPPTDSTLRP--------------------------------------M 31796

Query: 157   FVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDR 215
             F     + E   G S+ F  RV+G   + PP +KW K G+ + L   +     +H+  D 
Sbjct: 31797 FKRLLANAECQEGQSVCFEIRVSG---IPPPTLKWEKDGQPLSLGPNIEI---IHEGLD- 31849

Query: 216   ASKVYLFELHITDAQPAFTGSYR 238
                   + LHI D  P  TG YR
Sbjct: 31850 -----YYALHIRDTLPEDTGYYR 31867



 Score = 35.0 bits (79), Expect = 0.46
 Identities = 19/65 (29%), Positives = 28/65 (43%)

Query: 17    RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
             +   V      VF  E    G K +W R    I  S+KY +  +   +TL +R+    DQ
Sbjct: 12647 KDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQ 12706

Query: 77    GSYAV 81
              +Y V
Sbjct: 12707 ANYNV 12711



 Score = 34.3 bits (77), Expect = 0.78
 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 9/85 (10%)

Query: 5    GKKPVSAFSKKPRSVEVAAG--SPAVFEAETERAGVKVR-------WQRGGSDISASNKY 55
            GKK       KPR + +  G     V E +  +  VKV        W + G ++  S++ 
Sbjct: 2342 GKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRV 2401

Query: 56   GLATEGTRHTLTVREVGPADQGSYA 80
             +  +   H L + ++   D G+Y+
Sbjct: 2402 HIVIDKQSHMLLIEDMTKEDAGNYS 2426



 Score = 34.3 bits (77), Expect = 0.78
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 1179  EAPS-FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             EAP+ F + L +++V     A+  C +    K  + W++NG ++ E  +++ F K G + 
Sbjct: 12820 EAPTEFVEHLEDQTVTEFDDAVFSCQL-SREKANVKWYRNGREIKEGKKYK-FEKDGSIH 12877

Query: 1238  LEIRKPCPFDGGI-YVCRATNLQGEAR 1263
               I K C  D    Y C   + +  AR
Sbjct: 12878 RLIIKDCRLDDECEYACGVEDRKSRAR 12904



 Score = 34.3 bits (77), Expect = 0.78
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 393   EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELF 448
             ++KW + G+E+  S  KY   S G   TLT+      D+  Y C+    VG  + S++L 
Sbjct: 30563 DIKWYRFGKELIQS-RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLL 30621

Query: 449   VKEPP 453
             ++  P
Sbjct: 30622 LQATP 30626



 Score = 33.9 bits (76), Expect = 1.0
 Identities = 24/80 (30%), Positives = 33/80 (41%), Gaps = 2/80 (2%)

Query: 5    GKKPVSAFSKKPRSVEVAAGSPAVFEAE-TERAGVKVRWQRGGSDISASNKYGLATEGTR 63
            GK P   F  +   V+   G  A FE   T    +KV W +   +I +  KY ++     
Sbjct: 8149 GKNP-PFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENS 8207

Query: 64   HTLTVREVGPADQGSYAVIA 83
              LTV +V   D G Y   A
Sbjct: 8208 AHLTVLKVDKGDSGQYTCYA 8227



 Score = 33.9 bits (76), Expect = 1.0
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 24    GSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVI 82
             GS A+FE     +     W + GS+I  S K+    +G    L + +V  +D G Y  +
Sbjct: 11133 GSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCV 11191



 Score = 33.5 bits (75), Expect = 1.3
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 1/80 (1%)

Query: 7    KPVSAFSKKPRSVEVAAGSPAVFEAE-TERAGVKVRWQRGGSDISASNKYGLATEGTRHT 65
            K    F ++ + VEV   S    E E T     +V W +   +I +S KY L    +   
Sbjct: 4952 KEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFN 5011

Query: 66   LTVREVGPADQGSYAVIAGS 85
            L + +  P+D G Y  I  +
Sbjct: 5012 LHITKCDPSDTGEYQCIVSN 5031



 Score = 33.5 bits (75), Expect = 1.3
 Identities = 25/125 (20%), Positives = 50/125 (40%), Gaps = 7/125 (5%)

Query: 16    PRSVEVAAGSPAVFEAETE-RAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPA 74
             P  + + AG     EA    +     +W++G  ++  S+   +    +   L +++V   
Sbjct: 18905 PEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRK 18964

Query: 75    DQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSP 134
             D G Y++ A +S         + +K + ++  AP P +      +  A A  L    P  
Sbjct: 18965 DSGYYSLTAENS------SGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLE 19018

Query: 135   KGSSS 139
              G S+
Sbjct: 19019 DGGSN 19023



 Score = 33.1 bits (74), Expect = 1.7
 Identities = 53/201 (26%), Positives = 74/201 (36%), Gaps = 44/201 (21%)

Query: 87    KVKFDLKVIEAEKAEPMLAP--APAPAEATGAPGEAPAPAAELGE----------SAPSP 134
             K + ++K I+    EP   P  AP      G   EA AP  E  +            PSP
Sbjct: 11024 KPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPSP 11083

Query: 135   KGSSSAALNGPTPGA--PDD----------PIGLFVMRPQDGEVT----VGGSITFSARV 178
               +    L   + G   PD+          P+  FV   +D  +T    VG S  F   V
Sbjct: 11084 IEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLK-FVKEIKDIILTESEFVGSSAIFECLV 11142

Query: 179   AGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSY 237
             + ++     +  W K G  +  S K   H  + D  DR       +LHI D Q +  G Y
Sbjct: 11143 SPSTA----ITTWMKDGSNIRESPK---HRFIADGKDR-------KLHIIDVQLSDAGEY 11188

Query: 238   RCEVSTKDKFDCSNFNLTVHE 258
              C +   +K   S   L V E
Sbjct: 11189 TCVLRLGNKEKTSTAKLVVEE 11209



 Score = 33.1 bits (74), Expect = 1.7
 Identities = 16/72 (22%), Positives = 31/72 (43%)

Query: 27    AVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSS 86
             AVF  E     ++V+W +    +  +    +  EG  H++T +++   D     V A   
Sbjct: 11946 AVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGM 12005

Query: 87    KVKFDLKVIEAE 98
               +  L V+E +
Sbjct: 12006 SSEAKLTVLEGD 12017



 Score = 33.1 bits (74), Expect = 1.7
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 19    VEVAAGSPAVFEAETE-RAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQG 77
             V + AGS  V +A    +   K+ W +G  ++    K  L   G R T  ++    +D G
Sbjct: 29057 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 29116

Query: 78    SYAV----IAGSSKVKFDLKVIEA 97
              Y +     +G+  V   +KV+++
Sbjct: 29117 KYTLTVKNASGTKAVSVMVKVLDS 29140



 Score = 32.7 bits (73), Expect = 2.3
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 460  LEDQLVMVGQRVEFECEVSEEGA-QVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAM 518
            +++  ++ G  V F C++S     ++ W KDG  +   E ++  F +DG R  L I   +
Sbjct: 1297 IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG-RASLRIPVVL 1355

Query: 519  LEDAGHYALCTS 530
             ED G Y    S
Sbjct: 1356 PEDEGIYTAFAS 1367



 Score = 32.3 bits (72), Expect = 3.0
 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 3/89 (3%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P++ + L + ++  G T  + C     P  K  WF+NG  L    R +   +  V  L I
Sbjct: 8745 PAWERHLQDVTLKEGQTCTMTCQF-SVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTI 8803

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLE 1269
                  D G Y C+  +L  E   E R+E
Sbjct: 8804 ADVRAEDQGQYTCKYEDL--ETSAELRIE 8830



 Score = 32.3 bits (72), Expect = 3.0
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 1/83 (1%)

Query: 12    FSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREV 71
             F+   + V V     A FE    R    V W +G   I +S+K+ +  +G +H L + + 
Sbjct: 11488 FAVPLKDVTVPERRQARFECVLTREA-NVIWSKGPDIIKSSDKFDIIADGKKHILVINDS 11546

Query: 72    GPADQGSYAVIAGSSKVKFDLKV 94
                D+G Y       K    L V
Sbjct: 11547 QFDDEGVYTAEVEGKKTSARLFV 11569



 Score = 32.3 bits (72), Expect = 3.0
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 467   VGQRVEFECEVSEEG---AQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAG 523
             V  R + + +V  +G   A V W KDG  L  +ET +           L I EA  ED G
Sbjct: 25406 VKAREQLKIDVPFKGRPQATVNWRKDGQTL--KETTRVNVSSSKTVTSLSIKEASKEDVG 25463

Query: 524   HYALCTS 530
              Y LC S
Sbjct: 25464 TYELCVS 25470



 Score = 32.0 bits (71), Expect = 3.9
 Identities = 27/96 (28%), Positives = 39/96 (40%), Gaps = 5/96 (5%)

Query: 7    KPVSAFSKKPRSVEVAAGSPAVFEAETERA-GVKVRWQRGGSDISASNKYGLATEGTRHT 65
            K      +K   +EVA G  A F  E + A  V+ +W + G +I  S+K  + +     +
Sbjct: 3453 KAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISS 3512

Query: 66   LTVREVGPADQGSYAVIA----GSSKVKFDLKVIEA 97
            L +      D G Y   A    GS      L V EA
Sbjct: 3513 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEA 3548



 Score = 32.0 bits (71), Expect = 3.9
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 1/76 (1%)

Query: 1179  EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
             E   FT+ L N  V    T  L C V   P  ++ W+K   ++ E  R+ + ++     L
Sbjct: 12461 EEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRIL 12519

Query: 1239  EIRKPCPFDGGIYVCR 1254
              I+     D G Y CR
Sbjct: 12520 VIQNAHLEDAGNYNCR 12535



 Score = 32.0 bits (71), Expect = 3.9
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 988   GEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPTD-TILFIRAARRVHSGTYQV 1045
             G+ V   I   G P P + W K+GQPL+ G  + I +   D   L IR      +G Y+V
Sbjct: 31809 GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRV 31868

Query: 1046  T 1046
             T
Sbjct: 31869 T 31869



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 15/74 (20%), Positives = 34/74 (45%), Gaps = 1/74 (1%)

Query: 7    KPVSAFSKKPRSVEVAAGSPAVFEAE-TERAGVKVRWQRGGSDISASNKYGLATEGTRHT 65
            K  +  +++  S++V  G PA  + + +    +  +W + G +++  +KY ++   T   
Sbjct: 4576 KEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSI 4635

Query: 66   LTVREVGPADQGSY 79
            L +      D G Y
Sbjct: 4636 LKIISTEKKDSGEY 4649



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 25/95 (26%), Positives = 40/95 (42%), Gaps = 15/95 (15%)

Query: 7    KPVSAFSKKPRSVE-VAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHT 65
            K V    K P ++E V AG+P +          KV+W + G  I  S  + ++ E    +
Sbjct: 5148 KSVDVTEKDPMTLECVVAGTPEL----------KVKWLKDGKQIVPSRYFSMSFENNVAS 5197

Query: 66   LTVREVGPADQGSYAVIA----GSSKVKFDLKVIE 96
              ++ V   D G Y        GSS     L+V++
Sbjct: 5198 FRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD 5232



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 5/81 (6%)

Query: 21    VAAGSPAVFEAETERAGVKV-RWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSY 79
             V AG+   F A      V   +W   GS+I     Y + T+     LT++     D G Y
Sbjct: 17522 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 17581

Query: 80    AV----IAGSSKVKFDLKVIE 96
              +     AGS  V   L V++
Sbjct: 17582 QITVSNAAGSKTVAVHLTVLD 17602



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 25/107 (23%), Positives = 43/107 (40%), Gaps = 11/107 (10%)

Query: 18    SVEVAAGSPAVFEAETERAGVK-VRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
             ++ V AG     EA+     +  + W RG  +I  S +  +     +  L V++    D 
Sbjct: 23634 TIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 23693

Query: 77    GSYAV----IAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGE 119
             G Y +    +AGS     ++KV++         P   P + TG   E
Sbjct: 23694 GQYILRASNVAGSKSFPVNVKVLDRP------GPPEGPVQVTGVTSE 23734



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 32/96 (33%), Positives = 42/96 (43%), Gaps = 18/96 (18%)

Query: 988   GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDT----ILFIRAARRVHSGTY 1043
             GE         G+P P VTW ++GQ L+    S R+  T T       I + +    G Y
Sbjct: 32575 GESARFSCDTDGEPVPTVTWLRKGQVLS---TSARHQVTTTKYKSTFEISSVQASDEGNY 32631

Query: 1044  QVTVRIENMEDKA----TLVLQ---VVDK--PSPPQ 1070
              V V  EN E K     TL +Q   V +K   SPP+
Sbjct: 32632 SVVV--ENSEGKQEAEFTLTIQKARVTEKAVTSPPR 32665



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 2/81 (2%)

Query: 6    KKPVSAFSKKPRSVEVAAGSPAVFEAETERAG-VKVRWQRGGSDISASNKYGLATEGTRH 64
            K+P S F K     ++  G+ A+ + E    G  ++ W +    I +S KY L ++ +  
Sbjct: 3828 KEPPS-FIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLV 3886

Query: 65   TLTVREVGPADQGSYAVIAGS 85
             L +     AD G Y  +  +
Sbjct: 3887 CLEIFSFNSADVGEYECVVAN 3907



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 1183  FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRK 1242
             F +PL +  V     A   C +      K+ WFK+G ++ +  ++ + SK  V  L I K
Sbjct: 12376 FLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINK 12434

Query: 1243  PCPFDGGIYVC 1253
                 D   Y C
Sbjct: 12435 CLLDDEAEYSC 12445



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 43/175 (24%), Positives = 71/175 (40%), Gaps = 15/175 (8%)

Query: 379   HKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT-LTISQCSLADDAAYQCV 437
             + + L+ E  +HD   + L    E+Q  GS         K T  TI+     ++ +++  
Sbjct: 22063 NSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQGEEYSFRVS 22122

Query: 438   VGGEKCSTELFVKEPPV----LITRPLEDQL-----VMVGQRVEFECE-VSEEGAQVKWL 487
                EK  ++      PV    L+  P    L     V+ G+ ++ +   +      V W 
Sbjct: 22123 AQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWH 22182

Query: 488   KDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYA--LCTSGGQALAELIV 540
             KD V L  ++T +   +       L I +A  ED GHY   L  S G+A+  L V
Sbjct: 22183 KDNVPL--KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNV 22235



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 3/87 (3%)

Query: 23    AGSPAVFEAETE-RAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSY-A 80
             AGSP   +     R   KV W+     +  +++  + T   R TLTV++    D G Y  
Sbjct: 28661 AGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFL 28720

Query: 81    VIAGSSKVK-FDLKVIEAEKAEPMLAP 106
              +  ++ VK F + V+   +  P+  P
Sbjct: 28721 TLENTAGVKTFSVTVVVIGRPGPVTGP 28747



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 31/113 (27%), Positives = 44/113 (38%), Gaps = 8/113 (7%)

Query: 963   TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSI 1021
             T++ + + P   LP + +      VGE V   +     P P VTW K GQ +  G+    
Sbjct: 31682 TMRLLERPPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKK 31738

Query: 1022  RNSPTDTILF---IRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQD 1071
                 +D  L+   I +        Y V  R +  ED     L V   P PP D
Sbjct: 31739 YTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHP-PPTD 31790



 Score = 30.8 bits (68), Expect = 8.6
 Identities = 20/91 (21%), Positives = 41/91 (45%), Gaps = 4/91 (4%)

Query: 19   VEVAAGSPAVFEAETERAG-VKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQG 77
            VE   G PA  + + +    +++ W +  + + ++  Y +  +    +L + +V  +D G
Sbjct: 7029 VEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVG 7088

Query: 78   SYAVIAGSS---KVKFDLKVIEAEKAEPMLA 105
             Y+  A +S        + VI+A K  P  A
Sbjct: 7089 EYSCKADNSVGAVASSAVLVIKARKLPPFFA 7119



 Score = 30.8 bits (68), Expect = 8.6
 Identities = 20/78 (25%), Positives = 31/78 (39%)

Query: 21    VAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA 80
             V  G  A F  E     + V W +  + +  S    +++EG  H L ++EV   D     
Sbjct: 11585 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 11644

Query: 81    VIAGSSKVKFDLKVIEAE 98
                        LKV+EA+
Sbjct: 11645 AQVKELSSTAQLKVLEAD 11662


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  286 bits (732), Expect = 9e-77
 Identities = 238/845 (28%), Positives = 366/845 (43%), Gaps = 77/845 (9%)

Query: 386  ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCST 445
            +L+   A VKW +NG+EI+  G KY FE  G+   L I  C L D+  Y C V   K   
Sbjct: 6540 QLSREKANVKWYRNGREIK-EGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 6598

Query: 446  ELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKK 505
             LFV+E PV I RP +D L   G  V F  E++++  +V+WL++ + + + +  K++   
Sbjct: 6599 RLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD--KHQMMS 6656

Query: 506  DGQRHHLIINEAMLEDAGHYALCTSGGQALAEL-IVQEKKLEVYQSIADLMVGAKDQAVF 564
            +G+ H L I +    D G Y       +A A+L +    K++       + VG     V 
Sbjct: 6657 EGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVV 6716

Query: 565  KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
              +   +     W K  + L   S   +          I +    D+  Y  V +    N
Sbjct: 6717 PYDAYPK-AEAEWFKENEPL---STKTIDTTAEQTSFRILEAKKGDKGRYKIVLQ----N 6768

Query: 625  LSAKLH-FMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW 683
               K   F+ +K+            +D PG + +           L+V  + D   ++ W
Sbjct: 6769 KHGKAEGFINLKV------------IDVPGPVRN-----------LEVTETFDGEVSLAW 6805

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEK 743
            ++ +T G         +  +    +     D+   CE               FTV G +K
Sbjct: 6806 EEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE---------------FTVTGLQK 6850

Query: 744  ED-EGVYTVTVKNPVGEDQVNLTVKVI------DVPDAPAAPKISNVGEDSCTVQWEPPA 796
               E ++ V+ +N VG  +   T   +      DVP  P    I++V     ++ WEPP 
Sbjct: 6851 GGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPE 6910

Query: 797  YDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSR 856
            YDGG  I  Y++E + K S RW        ++LS     ++EG  Y  RV A N IG+ +
Sbjct: 6911 YDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGK 6970

Query: 857  PSPASQPFM----PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG 912
            PS A+ PF+    PI  PS P +L   D + ++V LKW PP + G   + GY +E C EG
Sbjct: 6971 PSAAT-PFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEG 7029

Query: 913  CSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPR 972
               W+     L    +  V  L  G + L+RV A N AG   P     P+T  +    P 
Sbjct: 7030 KDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPT 7089

Query: 973  LQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILF 1031
            + L    +  ++  V  P+ +L+P  G PRP  TW    + L  G+ V ++       L 
Sbjct: 7090 MDLSA-FKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELV 7148

Query: 1032 IRAARRVHSGTYQVTVRIENMED--KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
            I  + R   G Y  T+++EN        + + V+ +PS P++L+  D    +V L W+PP
Sbjct: 7149 ISPSERSDKGIY--TLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPP 7206

Query: 1090 QDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             D G + L GY V+K +     W  V++        VP+L+ G  Y F+V ++N  G   
Sbjct: 7207 DDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCG-PG 7265

Query: 1150 RAATTKEPVFIPRPGITYEPP-NYKALDFSEAPSFT--QPLVN--RSVIAGYTAMLCCAV 1204
              A   EPV +  P    +PP N K  D +    F    P  N   S I GY    C   
Sbjct: 7266 EPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERC--P 7323

Query: 1205 RGSPK 1209
            RGS K
Sbjct: 7324 RGSDK 7328



 Score =  243 bits (619), Expect = 1e-63
 Identities = 204/708 (28%), Positives = 303/708 (42%), Gaps = 81/708 (11%)

Query: 567   EVSDENVRGVWLKNGKELVPDSRIKVSHI--GRVHKLTIDDVTPADEADYSFVPEGFACN 624
             +V DE  R     +  E  P+++ KV+ +  G+ +K  +  V  A E+D + VPE     
Sbjct: 10848 KVGDEEWRRA--NHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVK 10905

Query: 625   LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQ 684
                             R EPP++ LD        I V  G+ LRL   I G P P V W+
Sbjct: 10906 ---------------DRLEPPELILDANMAREQHIKV--GDTLRLSAIIKGVPFPKVTWK 10948

Query: 685   KAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKE 744
             K              DAP                     + R++ T   S   +  A  E
Sbjct: 10949 KEDR-----------DAPT--------------------KARIDVTPVGSKLEIRNAAHE 10977

Query: 745   DEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL 804
             D G+Y++TV+NP G   V++ V V+D P  P   ++S + +DSC + W+ P  DGG  I 
Sbjct: 10978 DGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVIT 11037

Query: 805   GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMS------RPS 858
              Y++ER+   S +W  L+    ++ SH A+ + EG  Y  RV A N  G        +P 
Sbjct: 11038 NYVVERRDVASAQWSPLS-ATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPI 11096

Query: 859   PASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVA 918
              A  P  P GPP +  H+   DV  T VSL W  P+R G   + GY VEY  EG  +W+ 
Sbjct: 11097 KALDPLHPPGPPKDLHHV---DVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK 11153

Query: 919   ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
                    +   +V  L  G    FRV+A N+ G G P  TT P+  QE L  P ++L   
Sbjct: 11154 F--KTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVK 11210

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARR 1037
             L + +  K G  V      +G P P   WT +G  +   E  ++      ++L I+   R
Sbjct: 11211 LIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 11270

Query: 1038  VHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTE 1096
               +G YQ+TV          + L V+D P PP   + + D    ++ + W+PP+D G + 
Sbjct: 11271 RDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSP 11330

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS---DRAAT 1153
             +  Y V+K D +   W  V     +T   +P L  G  Y FRV ++N +G     D   T
Sbjct: 11331 VINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPT 11390

Query: 1154  TKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVN-RSVIAGY------TAMLCCAVRG 1206
               +  F P P    +P      + +   S+T P  +  S I GY             V  
Sbjct: 11391 VAKHKFSP-PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNK 11449

Query: 1207  SPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCR 1254
             +P   + +   GL  G    FR+F++       + KP P    I  CR
Sbjct: 11450 TPIADLKFRVTGLYEGNTYEFRVFAEN---LAGLSKPSPSSDPIKACR 11494



 Score =  238 bits (608), Expect = 2e-62
 Identities = 190/681 (27%), Positives = 288/681 (42%), Gaps = 96/681 (14%)

Query: 344  DLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEI 403
            DLR +++ LK +   EKKS  F  K+            RL V L       KW KNG+E+
Sbjct: 6428 DLR-IVEPLKDIETMEKKSVTFWCKVN-----------RLNVTL-------KWTKNGEEV 6468

Query: 404  QMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQ 463
                ++  +     K  LTI  C   D+  Y    G +K   EL + E P      LEDQ
Sbjct: 6469 PFD-NRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 6527

Query: 464  LVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAG 523
             V       F C++S E A VKW ++G E+  +E  KY+F+KDG  H LII +  L+D  
Sbjct: 6528 TVTEFDDAVFSCQLSREKANVKWYRNGREI--KEGKKYKFEKDGSIHRLIIKDCRLDDEC 6585

Query: 524  HYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKE 583
             YA      ++ A L V+E  +E+ +   D++       VF  E++ + V   WL+N   
Sbjct: 6586 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 6645

Query: 584  LVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE 643
            +V   + ++   G++H+L I D+ P D+ +Y F+         AK      K++      
Sbjct: 6646 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI---------AKDKEARAKLELA---A 6693

Query: 644  PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PKI           +VV  G  L + VP    P     W K                  
Sbjct: 6694 APKIK-----TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKE----------------- 6731

Query: 704  DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
                      ++ L  +T     ++TT +++ F +  A+K D+G Y + ++N  G+ +  
Sbjct: 6732 ----------NEPLSTKT-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGF 6776

Query: 764  LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF 823
            + +KVIDVP      +++   +   ++ WE P  DGG  I+GY++ER+  K   W+ L  
Sbjct: 6777 INLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWV-LAT 6835

Query: 824  DLIQELSHEARRMIE-GVVYEMRVYAVNAIGMSRPSPASQPF---MPIGPPSEPTHLAVE 879
            D  +        + + GV Y  RV A N +G   P     P         P  P ++ + 
Sbjct: 6836 DRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTIT 6895

Query: 880  DVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
            DV+   VSL W PPE  G   +  Y +E   +    W  A+    E  S  V D+  G  
Sbjct: 6896 DVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQE 6955

Query: 940  LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
              FRVRA N  G G P   T  V V + ++RP                  PVNL    Q 
Sbjct: 6956 YSFRVRAQNRIGVGKPSAATPFVKVADPIERP----------------SPPVNLTSSDQT 6999

Query: 1000 KPRPQVTWTKE----GQPLAG 1016
            +   Q+ W       G P+ G
Sbjct: 7000 QSSVQLKWEPPLKDGGSPILG 7020



 Score =  236 bits (601), Expect = 1e-61
 Identities = 159/530 (30%), Positives = 248/530 (46%), Gaps = 48/530 (9%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R EPP+I LD   R    +V+ A   LRL V I G P P V W+KA              
Sbjct: 18796 RIEPPEIELDADLR--KVVVLRASATLRLFVTIKGRPEPEVKWEKA-------------- 18839

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                           + +L +   R ++E T   ++  ++   + D G Y +T++N  G  
Sbjct: 18840 --------------EGILTD---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSK 18882

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSYRW 818
                + V+V+D P AP    I  V +DS T+ WEPP  DGG  I  YI+E+++  +K+Y  
Sbjct: 18883 TAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYAT 18942

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAV 878
             +  N     + +     + EG  Y  RV A N  G+  P+  ++P     PP  P  + +
Sbjct: 18943 ITNN---CTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTL 18999

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
              DV+  T ++KW  PE  G   + GY VE   +G  +W    Q  T   +I    L  G 
Sbjct: 19000 VDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATI--SGLTAGE 19057

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
               +FRV A N  G   P     PV  ++I  +P ++LP H   T   K  E + + +PF+
Sbjct: 19058 EYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFK 19114

Query: 999   GKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             G+P+  V W K+GQ L     V++ +S T T L I+ A +   GTY++ V          
Sbjct: 19115 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 19174

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
             + + V+D+P PP  +R+ +    ++ + W PP+  G  ++  Y V+K +  +  W  V +
Sbjct: 19175 ITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ 19234

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVG---FSDRAATTKEPVFIPRPG 1164
                RT   +  L  G+ Y FRV ++N  G   +S+ +A   E  F P PG
Sbjct: 19235 AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSP-PG 19283



 Score =  234 bits (596), Expect = 5e-61
 Identities = 179/608 (29%), Positives = 272/608 (44%), Gaps = 59/608 (9%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W   G +L    R+ V    +V KLTI + T  D  +Y+   +      S       +K+
Sbjct: 23467 WFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSET-----IKV 23521

Query: 637   DFVPRQEPPK--IHLDCPGRIPDTIVVVAGNKLRLD--VPISGDPAPTVIWQKAITQGNK 692
               + +  PP   I +D    I  T + ++     LD   P+SG     V+ Q+       
Sbjct: 23522 IILDKPGPPTGPIKID---EIDATSITISWEPPELDGGAPLSG----YVVEQR------- 23567

Query: 693   APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                    DA                     G + V  +  RS F      + +E V+ V 
Sbjct: 23568 -------DA------------------HRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVA 23602

Query: 753   VKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYI 807
               N  G     + +V      I +P  P   +I +V  D  T+ W PP  DGG  + GYI
Sbjct: 23603 ATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYI 23662

Query: 808   LERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM-- 865
             +ERK+ ++ RW+R+N   +    + +  + EG+ YE RV A+NA G  +PS  S+P +  
Sbjct: 23663 VERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAM 23722

Query: 866   -PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLT 924
              PI PP +P +  V D + T+VSL W  PE  G   + GY +E       EW       T
Sbjct: 23723 DPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPT 23782

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
             +     +  LP GA   FRV A N  GPG P      V V E+L+ P  +L    ++ I 
Sbjct: 23783 KIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIF 23842

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
              + G  + L IP +GKP P   WTKEGQ ++ +   I  S T T L I+ A R  SGTY 
Sbjct: 23843 VRQGGVIRLTIPIKGKPFPICKWTKEGQDIS-KRAMIATSETHTELVIKEADRGDSGTYD 23901

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             + +  +  +    + ++V+  P+ P+  L   D    +V + W+PP D G  ++ GY ++
Sbjct: 23902 LVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILE 23961

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             + +     W+T+    R T  VV  L     Y+FRV ++N  G S +   ++EPV    P
Sbjct: 23962 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS-KPLKSEEPVTPKTP 24020

Query: 1164  GITYEPPN 1171
                 EPP+
Sbjct: 24021 LNPPEPPS 24028



 Score =  232 bits (591), Expect = 2e-60
 Identities = 155/508 (30%), Positives = 236/508 (46%), Gaps = 43/508 (8%)

Query: 702   PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG- 758
             P+D G S    +V +K+     +  V V +      +T+    +  E V+ +  +N  G 
Sbjct: 9936  PKDDGGSKITNYVIEKRE-ANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGI 9994

Query: 759   ----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
                 + +      +  VP AP  P +S+V  +S TV WE P YDGG P+ GY LE K   
Sbjct: 9995  GEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTT 10054

Query: 815   SYRWMRLNFDLIQEL----SHEARRMIEGVVYEMRVYAVNAIGM------SRPSPASQPF 864
             S RW R+N D I+ +    S++   +IEG  Y+ RVYA+NA G+      S P+ A  P 
Sbjct: 10055 SKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI 10114

Query: 865   MPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLT 924
              P GPP       V D + ++  L+W PP + G   + GY VEY  EG  EW        
Sbjct: 10115 APPGPPFPK----VTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEV 10170

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
               T ++V  L  GA   FRVRA N+AG G P   T+ + +++ L  P LQL   +R  I 
Sbjct: 10171 RGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIV 10230

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
                G  + ++    GKP P VTW    + L  +E +I  +   + + I+  +R H G Y 
Sbjct: 10231 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLP-QEATIETTAISSSMVIKNCQRSHQGVYS 10289

Query: 1045  VTVRIENMEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             +  + E  E K T+++ V+D P P        +    +  L W  P+D G + +  Y ++
Sbjct: 10290 LLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIE 10349

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF-----SDRAATTKEPV 1158
             K +     W  V     R +  V  LI G  Y+FR+ ++N +G      +  A   +EP+
Sbjct: 10350 KRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPI 10409

Query: 1159  FIP-RP-------------GITYEPPNY 1172
              +P RP              +T+ PP Y
Sbjct: 10410 TVPERPEDLEVKEVTKNTVTLTWNPPKY 10437



 Score =  232 bits (591), Expect = 2e-60
 Identities = 161/590 (27%), Positives = 263/590 (44%), Gaps = 48/590 (8%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P++ LD    +   IVV AG   R+ +P  G P P + W +                 
Sbjct: 17715 EAPELDLD--SELRKGIVVRAGGSARIHIPFKGRPTPEITWSR----------------- 17755

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                   +E  F  K        V++E   + +  +++  ++ D G Y + ++N  G    
Sbjct: 17756 ------EEGEFTDK--------VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSA 17801

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
              +TVKV+D P  P    +  V +DS  + WEPP  DGG  +  Y++++++     +  ++
Sbjct: 17802 FVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVS 17861

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVS 882
                  + S +   + EG +Y  RV A N  G+  P           PPS P  + + DVS
Sbjct: 17862 -SKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVS 17920

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
              T+ SL W  PE  G   + GY VE  P+G  +W  ++   ++  + +V  L +G    F
Sbjct: 17921 QTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKW--SIVAESKVCNAVVTGLSSGQEYQF 17978

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV+A+N  G   P     PV  +++  +P L+LP +   T   + GE + + IP  G+PR
Sbjct: 17979 RVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPR 18035

Query: 1003  PQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQ 1061
             P ++W K+G+PL     V++  + T T+L I+   +   G Y VT           L + 
Sbjct: 18036 PNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVI 18095

Query: 1062  VVDKPSPP-QDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             V++KP PP   +R  +     V + W+PP   G  ++  Y V+K D  T  W  V     
Sbjct: 18096 VLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA 18155

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
             RT   + +L  G  Y FR+F++N  G S  A    + V +  P   ++ P      F  +
Sbjct: 18156 RTTIKITKLKTGTEYQFRIFAENRYGKS--APLDSKAVIVQYP---FKEPGPPGTPFVTS 18210

Query: 1181  PSFTQPLV--NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFR 1228
              S  Q LV  +  V  G T ++   +    K  I W K      +D +F+
Sbjct: 18211 ISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18260



 Score =  231 bits (588), Expect = 4e-60
 Identities = 175/602 (29%), Positives = 273/602 (45%), Gaps = 99/602 (16%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW------------------- 683
             EPP++ +D   R  D IVV AG  L+++  I+G P P + W                   
Sbjct: 19480 EPPRVMMDVKFR--DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTD 19537

Query: 684   ----------------QKAITQGNKAPAR-----------PAPDA--------------- 701
                             Q  +T  N A  R           P P A               
Sbjct: 19538 NHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSL 19597

Query: 702   ----PEDTG--DSDEWVFDKK-------LLCETEGRVRVETTKDRSIFTVEGAEKEDEGV 748
                 P++ G  D D ++ +K+        +CE  G +++ + K   +       K +E +
Sbjct: 19598 SWGRPQEDGGADIDYYIVEKRETSHLAWTICE--GELQMTSCKVTKLL------KGNEYI 19649

Query: 749   YTVTVKNP--VGEDQVNLTVKVID---VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI 803
             + VT  N   VGE   ++ +K +D   VP  P + +I++V ++S T+ W  P  DGG  I
Sbjct: 19650 FRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEI 19709

Query: 804   LGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQP 863
              GYI+ER++K S RW+R+N   + +L  ++  + EG  YE RVYA NA G+S PS  S  
Sbjct: 19710 SGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPL 19769

Query: 864   FM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAAL 920
                  P+  PS P+   + D   TT+++ W  P   G   + GY+VEY     ++W  ++
Sbjct: 19770 IRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSI 19829

Query: 921   QGL--TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
             Q L  TE+T   +  L TGA  +FRV++ N  G   P  +++P   +E  + P   +   
Sbjct: 19830 QSLRGTEYT---ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSE 19886

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRV 1038
             +R+T+  K G    + +PF+G+P P V W+K    L      +  + + T L I  A R 
Sbjct: 19887 MRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLR-TRAYVDTTDSRTSLTIENANRN 19945

Query: 1039  HSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
              SG Y +T++        TLV++V+D P PP ++ V D    +  L W  P++ G   + 
Sbjct: 19946 DSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVK 20005

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
              Y ++K +     W +V  +  R    V  L  G  YYFRV  +N  G     A TKE V
Sbjct: 20006 NYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVG-IPAETKEGV 20064

Query: 1159  FI 1160
              I
Sbjct: 20065 KI 20066



 Score =  230 bits (587), Expect = 6e-60
 Identities = 151/532 (28%), Positives = 240/532 (45%), Gaps = 42/532 (7%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R+E P   +D   R   T++V AG    + VP  G P P V+W K             PD
Sbjct: 19875 REEEPLFDIDSEMR--KTLIVKAGASFTMTVPFRGRPVPNVLWSK-------------PD 19919

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                 T                  R  V+TT  R+  T+E A + D G YT+T++N +   
Sbjct: 19920 TDLRT------------------RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 19961

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMR 820
              + L VKV+D P  P    + +V ++S  + W+ P  DGG P+  Y +E+++     W+ 
Sbjct: 19962 SLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVS 20021

Query: 821   LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVED 880
             +  +    LS++   + EG +Y  RV   N  G+  P+   +       PS P  L V  
Sbjct: 20022 VTNNC-NRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEKPSPPEKLGVTS 20080

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL 940
             +S  +VSL W  PE  G   +  Y VE   +G   WV     + + T  +V  L   +  
Sbjct: 20081 ISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEY 20138

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FRV A N AG   P     PV ++E L+ P + +      T+  + G  + + IP  GK
Sbjct: 20139 FFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGK 20198

Query: 1001  PRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLV 1059
             P P+VT +++G PL A    +   +  +  + ++ +    +G Y++T    +   KA + 
Sbjct: 20199 PLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFIN 20258

Query: 1060  LQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEH 1118
             + V+D+P PP   + ++D    +V L+W+PP+  G +++  Y + K +  T  W  V   
Sbjct: 20259 IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT 20318

Query: 1119  YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR----AATTKEPVFIPRPGIT 1166
               RT   V +L  G  Y FR+ ++N  G SD       T K P   P P  T
Sbjct: 20319 VARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPST 20370



 Score =  229 bits (585), Expect = 1e-59
 Identities = 167/615 (27%), Positives = 275/615 (44%), Gaps = 63/615 (10%)

Query: 565  KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
            +CE   +N    W++   +LVP+   KV+ + + +K  +  V+  ++A  S  P      
Sbjct: 7025 RCEEGKDN----WIRCNMKLVPELTYKVTGLEKGNKY-LYRVSAENKAGVSD-PSEILGP 7078

Query: 625  LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQ 684
            L+A   F+E  +D                   D + V+  N + + VP +G P PT  W 
Sbjct: 7079 LTADDAFVEPTMDL--------------SAFKDGLEVIVPNPITILVPSTGYPRPTATW- 7123

Query: 685  KAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKE 744
                                        F  K+L ET  RV+++T    +   +  +E+ 
Sbjct: 7124 ---------------------------CFGDKVL-ETGDRVKMKTLSAYAELVISPSERS 7155

Query: 745  DEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL 804
            D+G+YT+ ++N V      + V VI  P AP   K  ++ +DS  + WEPP  DGG P+ 
Sbjct: 7156 DKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLT 7215

Query: 805  GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPF 864
            GY++E+++     W ++  D + +L      +++G  Y  +V A N  G   P+   +P 
Sbjct: 7216 GYVVEKREVSRKTWTKV-MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPV 7274

Query: 865  ---MPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQ 921
                P   P  P ++   D +  ++ L W PP+  G   + GY VE CP G  +WVA  +
Sbjct: 7275 NMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE 7334

Query: 922  GLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQ 981
             + E T + V  L  G    +RV+A N  G   P   TE +   +  + P + L   L  
Sbjct: 7335 PVAE-TKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLA 7393

Query: 982  TIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIRAARRVHS 1040
             +  K G  + L     GKP P++TWTK    L  ++ ++I N P  + + I  ++R  +
Sbjct: 7394 GLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDT 7453

Query: 1041 GTYQVTVRIENMEDKATLVLQ--VVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
            GTY   +   N+  +AT V++  V+DKP PP    +TD    +  L W PP+D G +++ 
Sbjct: 7454 GTY--IIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKIT 7511

Query: 1099 GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD----RAATT 1154
             Y V++    +  W  +    + T+    +LI    Y FRV ++NM G  +       T 
Sbjct: 7512 NYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITA 7571

Query: 1155 KEPVFIPRPGITYEP 1169
            K     P P    EP
Sbjct: 7572 KYQFDPPGPPTRLEP 7586



 Score =  225 bits (574), Expect = 2e-58
 Identities = 166/609 (27%), Positives = 271/609 (44%), Gaps = 60/609 (9%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P I LD   R    I + AG  LRL VPI G P P V W K                 
Sbjct: 16633 EAPDIDLDLELR--KIINIRAGGSLRLFVPIKGRPTPEVKWGKV---------------- 16674

Query: 703   EDTGDSDEWVFDKKLLCETEGRVR----VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG 758
                                +G +R    ++ T   +   ++   + D G YT+T++N  G
Sbjct: 16675 -------------------DGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSG 16715

Query: 759   EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSY 816
                  +TV+V+D P  P   K++ + +DS ++ WEPP  DGG  I  YI+E+++  +KSY
Sbjct: 16716 TKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSY 16775

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHL 876
               +  N     + S +  ++ EG  Y  RV A N  G+  P+  + P      P  P  +
Sbjct: 16776 AAVVTN---CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 16832

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V+DV+  +VSL W  PE  G   +  Y VE   +   +W    +   +    ++ +L  
Sbjct: 16833 TVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQ 16890

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G   LFRV A N  G   P +   P+  ++++  P ++ P     ++Q  VG+ + + +P
Sbjct: 16891 GEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVK-PAFSSYSVQ--VGQDLKIEVP 16947

Query: 997   FQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDK 1055
               G+P+P +TWTK+G PL     +++ +S   T L I+   +   G Y +TV     +  
Sbjct: 16948 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 17007

Query: 1056  ATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFT 1114
             A++ +  +DKP PP+  ++  D    ++ L W PP   G  ++  Y VQK D  T  W  
Sbjct: 17008 ASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDV 17067

Query: 1115  VLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKA 1174
             V     RT   V +L  G  Y FR+F++N  G S   A   +P+    P   Y+ P    
Sbjct: 17068 VSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS--FALESDPIVAQYP---YKEPGPPG 17122

Query: 1175  LDFSEAPSFTQPLV--NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSK 1232
               F+ A S    ++  +  V  G + ++   +    +  I W K    +  D +F+  + 
Sbjct: 17123 TPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNL 17182

Query: 1233  QGVLTLEIR 1241
             +  +  E R
Sbjct: 17183 EEGIEYEFR 17191



 Score =  224 bits (571), Expect = 4e-58
 Identities = 156/532 (29%), Positives = 231/532 (43%), Gaps = 44/532 (8%)

Query: 622   ACNLSAKLHFME--VKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAP 679
             A N+     + E   +I+ V R E P + L     +  T+ + AG  LRL V +SG P P
Sbjct: 23114 AVNVKGMSEYSESIAEIEPVERIEIPDLEL--ADDLKKTVTIRAGASLRLMVSVSGRPPP 23171

Query: 680   TVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE 739
              + W K   QG                             +   R  ++TT+  S+  V+
Sbjct: 23172 VITWSK---QG----------------------------IDLASRAIIDTTESYSLLIVD 23200

Query: 740   GAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDG 799
                + D G YT+  +N  G+    + VKV D P    + K+  V  DS T+ WE P  DG
Sbjct: 23201 KVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDG 23260

Query: 800   GQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP 859
             G P+  YI+E K++ + R  +       +  +    ++EG +Y  RV   N  G+  P  
Sbjct: 23261 GAPVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE 23319

Query: 860   ASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW--- 916
              S   +    P  P  L V DV+ +TV+L W  P   G   L GY +E C  G   W   
Sbjct: 23320 TSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKV 23379

Query: 917   VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLP 976
             V     + EHT   V  L  G + LFR+RA N  G   P  T   VTVQ++   P + L 
Sbjct: 23380 VTLKPTVLEHT---VTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLS 23436

Query: 977   RHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAA 1035
                ++TI    G PV L+IP  G+P P  +W   G  L   E V++        L IR  
Sbjct: 23437 TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRET 23496

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGN 1094
                 +G Y + ++        T+ + ++DKP PP   +++ +    ++ + W+PP+  G 
Sbjct: 23497 TIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGG 23556

Query: 1095  TELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
               L GY V++ D     W  V E   R+      L  GN Y FRV + N  G
Sbjct: 23557 APLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG 23608



 Score =  220 bits (561), Expect = 6e-57
 Identities = 171/617 (27%), Positives = 257/617 (41%), Gaps = 63/617 (10%)

Query: 575   GVWLKNGKELVPDSRIKVSHI--GRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFM 632
             G W K   E    +R  V+ +  G  +K  +  +  A + D        +C ++      
Sbjct: 21993 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGD--------SCEVTGT---- 22040

Query: 633   EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNK 692
                I  V R   P++ +D       T VV AG  +RL +   G P PT +W K       
Sbjct: 22041 ---IKAVDRLTAPELDIDA--NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSK------- 22088

Query: 693   APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                   PD+                      R  + TT   S  TVE   + D G YT+T
Sbjct: 22089 ------PDS------------------NLSLRADIHTTDSFSTLTVENCNRNDAGKYTLT 22124

Query: 753   VKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             V+N  G   +  TVKV+D P  P      +V   S T+ W+ P  DGG  I  Y++E+++
Sbjct: 22125 VENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKRE 22184

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSE 872
                  W  ++    +++  +   + EGV Y  RV AVN  G+  P    +P +    P+ 
Sbjct: 22185 ASRRSWQVISEKCTRQI-FKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAP 22243

Query: 873   PTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVK 932
             P  L V D S ++  L W  P+  G   + GY +E   +G   WV A  G T+  +  V+
Sbjct: 22244 PRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA--GHTKQLTFTVE 22301

Query: 933   DLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN 992
              L       FRV+A N AG   P      V ++E    P   L     Q I  K G P  
Sbjct: 22302 RLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFT 22361

Query: 993   LLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
             + +P  G+P P+VTW  E   L   + VSI  +   T L ++ + R  SG Y +T+    
Sbjct: 22362 IDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTA 22421

Query: 1052  MEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTM 1110
                  ++ + V+ +P P    + V+     +  L W  P+D G TE+  Y V+K +  T 
Sbjct: 22422 GVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTT 22481

Query: 1111  EWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS---DRAATTKEPVFIP-----R 1162
              W  V    +RT   V  L     Y FRV S+N  G S   + A    E  F+P     R
Sbjct: 22482 AWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTR 22541

Query: 1163  PGITYEPPNYKALDFSE 1179
             P + +   N  ++ + E
Sbjct: 22542 PEVYHVSANAMSIRWEE 22558



 Score =  219 bits (559), Expect = 1e-56
 Identities = 172/604 (28%), Positives = 278/604 (46%), Gaps = 64/604 (10%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W+K  +EL   +R+++        L++ D    D  +Y    +  A   S  ++   VK+
Sbjct: 16272 WIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVN---VKV 16328

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                         LD PG  P+  VV++G        ++ +   T+ W+  +  G      
Sbjct: 16329 ------------LDRPGP-PEGPVVISG--------VTAEKC-TLAWKPPLQDGGS---- 16362

Query: 697   PAPDAPEDTGDSDEWVFDKK---LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
                       D   ++ +++    L  T     V+T   +    +EG    +E  + +  
Sbjct: 16363 ----------DIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEG----NEYTFRIMA 16408

Query: 754   KNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYIL 808
              N  G     E +  +      VPDAP AP+++ V +DS  V WE PA DGG  ILGY+L
Sbjct: 16409 VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVL 16468

Query: 809   ERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPAS---QPFM 865
             E++ K+  RW R +  LI EL      +IE   YE RV A NA G+S PSP S   +   
Sbjct: 16469 EKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD 16528

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAAL--QGL 923
             PI  P  P +  V D++ ++V L W  P   G   + GY VE C     EW       G+
Sbjct: 16529 PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGI 16588

Query: 924   TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
              + T+I V+ L       FR+ A N AG G       P+ V+E L+ P + L   LR+ I
Sbjct: 16589 NK-TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKII 16647

Query: 984   QKKVGEPVNLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
               + G  + L +P +G+P P+V W K +G+      + + +S T  +L      R  SG 
Sbjct: 16648 NIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVL--DNVNRYDSGK 16705

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
             Y +T+   +    A + ++V+D PSPP +L+VT+    +V++ W+PP   G +++  Y V
Sbjct: 16706 YTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIV 16765

Query: 1103  QKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV---F 1159
             +K +     +  V+ +  +    + +L  G  YYFRV ++N  G     A T +P+    
Sbjct: 16766 EKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIG-LPAQTADPIKVAE 16824

Query: 1160  IPRP 1163
             +P+P
Sbjct: 16825 VPQP 16828



 Score =  219 bits (557), Expect = 2e-56
 Identities = 152/493 (30%), Positives = 234/493 (47%), Gaps = 38/493 (7%)

Query: 700   DAPEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFT----VEGAEKEDEGVYTVTV 753
             D PED G  +   ++ +K   CET+  V   +T   ++ T    V    + +E ++ V  
Sbjct: 12013 DPPEDDGGCEIQNYILEK---CETKRMVW--STYSATVLTPGTTVTRLIEGNEYIFRVRA 12067

Query: 754   KNPVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYIL 808
             +N +G      +  VI     D P  P  P+++ V ++  TV W PP YDGG+ I GY L
Sbjct: 12068 ENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFL 12127

Query: 809   ERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM--- 865
             E+K+K S RW+ +N   I E   + + ++    Y+ RV A N IG+  PS  S+P +   
Sbjct: 12128 EKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKD 12187

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP--------EGCSEWV 917
             PI PP  PT+  V D +  +++L W  P   G   + GY VE  P        EG     
Sbjct: 12188 PIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCN 12247

Query: 918   AALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPR 977
             AA Q + +     V  L       FRV A N  G G P    E +  +EIL+ P + L  
Sbjct: 12248 AAAQLVRK--EFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDA 12305

Query: 978   HLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
              +R+ +  + G P+ L    +G+P P+VTW K G      +  +    T   L I  + R
Sbjct: 12306 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTR 12365

Query: 1038  VHSGTYQVTVRIENMEDKATLV-LQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               SG Y +T+ +    +KA  V ++V+D P P  DL+V+D    +  + W PP++ G ++
Sbjct: 12366 DDSGKYSLTL-VNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQ 12424

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKE 1156
             +  Y V+K +     W TV    ++T   V  L+ GN YYFRV + N  G          
Sbjct: 12425 VTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYG-------PGV 12477

Query: 1157  PVFIPRPGITYEP 1169
             P  +P+P +  +P
Sbjct: 12478 PTDVPKPVLASDP 12490



 Score =  218 bits (554), Expect = 4e-56
 Identities = 174/627 (27%), Positives = 269/627 (42%), Gaps = 72/627 (11%)

Query: 573   VRGV------WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLS 626
             +RGV      W  +G E+  D    V        LTI +    D  +Y       A + +
Sbjct: 11229 IRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKT 11288

Query: 627   AKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKA 686
               +H                  LD PG     I +       LDV        T+ WQ  
Sbjct: 11289 VAVHLTV---------------LDVPGPPTGPINI-------LDVT---PEHMTISWQP- 11322

Query: 687   ITQGNKAPARPAPDAPEDTGDSD--EWVFDKK-LLCETEGRVRVETTKDRSIFTVEGAEK 743
                            P+D G S    ++ +K+    +T G V   ++K +    +   +K
Sbjct: 11323 ---------------PKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK--LKIPHLQK 11365

Query: 744   EDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD 798
               E V+ V  +N +G     +    +       P  P  P ++++ E++ TV W  P  D
Sbjct: 11366 GCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSD 11425

Query: 799   GGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPS 858
             GG PI GY +ER++    +W+R+N   I +L      + EG  YE RV+A N  G+S+PS
Sbjct: 11426 GGSPITGYYMERREVTG-KWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPS 11484

Query: 859   PASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSE 915
             P+S P     PI PP  P +  ++D S  T  L W  P   G   + GY VE    G ++
Sbjct: 11485 PSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQ 11544

Query: 916   WVAALQG-LTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQ 974
             W    +  L    +  V  L  G    FR++A N+ G G P    E V  ++IL  P ++
Sbjct: 11545 WNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE 11604

Query: 975   LPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIR 1033
             L    R  I  +VG+ + +L   +G+P P +TWTKEG+ L  E+ V +        L I+
Sbjct: 11605 LDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIK 11664

Query: 1034  AARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
              A R   G Y ++ +  +   + + ++ V+D+P P Q+L+VT+    N  + W+ P D G
Sbjct: 11665 EAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNG 11724

Query: 1094  NTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
              +E+  + V+        W  V     +   +   L+  N YYFRV ++N VG       
Sbjct: 11725 GSEITNFIVEYRKPNQKGWSIVASDVTK-RLIKANLLANNEYYFRVCAENKVGVGP-TIE 11782

Query: 1154  TKEPVF----IPRPGITYEPPNYKALD 1176
             TK P+     I RPG   EP N    D
Sbjct: 11783 TKTPILAINPIDRPG---EPENLHIAD 11806



 Score =  218 bits (554), Expect = 4e-56
 Identities = 153/548 (27%), Positives = 243/548 (44%), Gaps = 49/548 (8%)

Query: 633   EVKIDFVPRQ--EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQG 690
             E+K    P++  EPP+I LD   R    ++V AG  +RL   + G PAP V W+K    G
Sbjct: 12285 ELKEAIKPKEILEPPEIDLDASMR--KLVIVRAGCPIRLFAIVRGRPAPKVTWRKV---G 12339

Query: 691   NKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYT 750
                  R                             +V+     +   +  + ++D G Y+
Sbjct: 12340 IDNVVRKG---------------------------QVDLVDTMAFLVIPNSTRDDSGKYS 12372

Query: 751   VTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
             +T+ NP GE  V + V+V+D P   +  K+S+V + SC V W PP  DGG  +  YI+E+
Sbjct: 12373 LTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK 12432

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PI 867
             ++     W  +  + +++ S     ++ G  Y  RV AVN  G   P+   +P +   P+
Sbjct: 12433 READRKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPL 12491

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG--CSEWVAALQGLTE 925
               P  P  L V +++  + +L W PP R G   +DGY   Y  E      W      + +
Sbjct: 12492 SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTE--YSVVK 12549

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
               S++V  L  G +  FRV A N  G   P         +E L  P++ +P    + I  
Sbjct: 12550 DLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP----EQITI 12605

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
             K G+ + +     GKP P   W K E + +    +++  + + +IL I+   R  SG Y 
Sbjct: 12606 KAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYS 12665

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             +T    +  D   + + V+D P PPQ    ++D      +L W  P + G + +  Y V+
Sbjct: 12666 LTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVE 12725

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             K D    +W T L    +T C V +LI G  Y FRV ++N  G S+   + K     P  
Sbjct: 12726 KCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPF- 12784

Query: 1164  GITYEPPN 1171
             G+  EP N
Sbjct: 12785 GVPSEPKN 12792



 Score =  217 bits (552), Expect = 7e-56
 Identities = 151/520 (29%), Positives = 234/520 (45%), Gaps = 42/520 (8%)

Query: 636   IDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPA 695
             I+   R   P + LD   R  D IVV AG  +R+   +SG P PTV W            
Sbjct: 10208 IEMKDRLVSPDLQLDASVR--DRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--------E 10257

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
             R  P                           +ETT   S   ++  ++  +GVY++  KN
Sbjct: 10258 RTLPQ-----------------------EATIETTAISSSMVIKNCQRSHQGVYSLLAKN 10294

Query: 756   PVGEDQVNLTVKVIDVPDAPAAPKIS-NVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
               GE +  + V V+DVP     P ++ N+  +SC + W  P  DGG PI  Y++E+++  
Sbjct: 10295 EAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESD 10354

Query: 815   SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPS 871
                W  + + + ++ +   + +I+G  Y  R+ A N+IGM      S+  +   PI  P 
Sbjct: 10355 RRAWTPVTYTVTRQ-NATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPE 10413

Query: 872   EPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILV 931
              P  L V++V+  TV+L W PP+  G   +  Y +E    G  ++              V
Sbjct: 10414 RPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTV 10473

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
             K L  G    +RV A N+ G G P   T+P+T ++ L  P L L    + TI  +VGE  
Sbjct: 10474 KGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTI--RVGEAF 10531

Query: 992   NLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE 1050
              L   + GKP+P+V+W K E   L  +   I+ +P    L    A+R  SG Y V V   
Sbjct: 10532 ALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENS 10591

Query: 1051  NMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
                 K    + VVD+P PP   +   +     + + WKPP D G +++  Y ++K +   
Sbjct: 10592 TGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGK 10651

Query: 1110  MEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
               W  V     +T C V +L+ G  Y FR+ ++N+ G SD
Sbjct: 10652 DVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISD 10691



 Score =  214 bits (546), Expect = 3e-55
 Identities = 169/608 (27%), Positives = 283/608 (46%), Gaps = 58/608 (9%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P+I LD   R   +++  AG  +++ +P  G P PTV W+K                 
Sbjct: 20962 EAPEIDLDVALRT--SVIAKAGEDVQVLIPFKGRPPPTVTWRK----------------- 21002

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D+K L  ++ R  +E T   S+ T+    + D G Y +T++N VGE + 
Sbjct: 21003 -----------DEKNL-GSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKS 21050

Query: 763   N-LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
             + ++VKV+D P A    ++ +V   + T+ W+PP  DGG PI+ Y++E++      W  +
Sbjct: 21051 STVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVV 21110

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
             +       S +   + E   +  RV A N IG+  P   ++P      P+    L+++D 
Sbjct: 21111 SHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDS 21169

Query: 882   SDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLL 941
             + T+V L W  P+  G   +  Y VE   +G   W  A  G+++   I V  L   + L 
Sbjct: 21170 TKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA--GISKTCEIEVSQLKEQSVLE 21227

Query: 942   FRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKP 1001
             FRV A N  G   PVT   P+TV+E++  P + L       +  ++G  V+L +P++GKP
Sbjct: 21228 FRVFAKNEKGLSDPVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKP 21286

Query: 1002  RPQVTWTKEGQPLAGEEVSIRNSPTDT--ILFIRAARRVHSGTYQVTVRIENMEDKATLV 1059
             +P ++W K+G PL   E  +R S T+    L I+ A++ H G Y  TV ++N   +  + 
Sbjct: 21287 KPSISWLKDGLPLKESEF-VRFSKTENKITLSIKNAKKEHGGKY--TVILDNAVCRIAVP 21343

Query: 1060  LQVV--DKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
             + V+    PS P+  +R  +    +V L W  P+D G  E+  Y+++K +     W  V 
Sbjct: 21344 ITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVC 21403

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATT----KEPVFIPRPGITYEPPNY 1172
                 RT   VP L+    Y FRV ++N  G S    ++    K    IP P    +P  Y
Sbjct: 21404 SSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGP--PGKPVIY 21461

Query: 1173  KALDFSEAPSFTQPLVN-RSVIAGY-------TAMLCCAVRGSPKPKISWFKNGLDLGED 1224
                    + ++  P+ +  S + G+        ++L   V  SP     +   GL  G D
Sbjct: 21462 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLD 21521

Query: 1225  ARFRMFSK 1232
              +FR++++
Sbjct: 21522 YQFRVYAE 21529



 Score =  213 bits (543), Expect = 7e-55
 Identities = 137/438 (31%), Positives = 210/438 (47%), Gaps = 12/438 (2%)

Query: 732   DRSIFTVEGAEKEDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGED 786
             +  I T     K +E ++ V   N  G     E    +       P  P  P+++ + ++
Sbjct: 20716 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKN 20775

Query: 787   SCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRV 846
             S TV W  P  DGG  I GY LE++ KKS  W ++  + I++   +   + E   Y+ RV
Sbjct: 20776 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRV 20835

Query: 847   YAVNAIGM---SRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDG 903
              AVNA G    S PS   +   PI PP  P  + + D + ++++L W  P   G   + G
Sbjct: 20836 CAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTG 20895

Query: 904   YSVEYCPEGCSEWVA-ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPV 962
             Y VE       EW   + +G    T  +V +L  G    FRV A N AG G P+   EPV
Sbjct: 20896 YVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPV 20955

Query: 963   TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSI 1021
               ++IL+ P + L   LR ++  K GE V +LIPF+G+P P VTW K+ + L  +   SI
Sbjct: 20956 QAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSI 21015

Query: 1022  RNSPTDTILFIRAARRVHSGTYQVTVRIENMEDK-ATLVLQVVDKPSPPQDLRVTDAWGL 1080
              N+ + ++L I    R  +G Y +T+     E K +T+ ++V+D P+  Q L+V      
Sbjct: 21016 ENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRG 21075

Query: 1081  NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF 1140
              V L W PP   G + +  Y ++K D     W  V      T   + +L     ++FRV 
Sbjct: 21076 TVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVL 21135

Query: 1141  SQNMVGFSDRAATTKEPV 1158
             ++N +G  +   TT EPV
Sbjct: 21136 AENEIGIGEPCETT-EPV 21152



 Score =  212 bits (540), Expect = 2e-54
 Identities = 170/605 (28%), Positives = 264/605 (43%), Gaps = 59/605 (9%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R  PP+I LD   R    + + A   LRL VPI G PAP V W +               
Sbjct: 15549 RMLPPEIELDADLR--KVVTIRACCTLRLFVPIKGRPAPEVKWAR--------------- 15591

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                D G+S +             +  +E+T   ++  V    + D G Y +TV+N  G  
Sbjct: 15592 ---DHGESLD-------------KASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSK 15635

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSYRW 818
                + V+V+D P  P   K+  V + S T+ W+PP  DGG  I  YI+E+++  +K+Y  
Sbjct: 15636 SAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYST 15695

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAV 878
             +  N     + S +  ++ EG  Y  RV A N  G+  P+  ++       P  P  + +
Sbjct: 15696 VATN---CHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITL 15752

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
              DV+  +VSL W  PE  G   + GY VE   +G  +W  A     + T   +  L  G 
Sbjct: 15753 MDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKW--ATCATVKVTEATITGLIQGE 15810

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
                FRV A N  G   P   + PV  ++++  P  +L   L  T     GE + + +PF 
Sbjct: 15811 EYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFI 15867

Query: 999   GKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             G+P P VTW K+  PL     V+  ++  +++L I+ A R   G Y V +     E   T
Sbjct: 15868 GRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIET 15927

Query: 1058  LVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
             L + V+DKP PP   +++ +    ++ L W PP+  G + +  Y V+K D  T  W  V 
Sbjct: 15928 LNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS 15987

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALD 1176
                 RT      L  G  Y FR+ ++N  G S       EP     P     PP    + 
Sbjct: 15988 ATVARTTIKACRLKTGCEYQFRIAAENRYGKS--TYLNSEPTVAQYPFKVPGPPGTPVVT 16045

Query: 1177  FSEAPS----FTQPLVN-RSVIAGY-------TAMLCCAVRGSPKPKISWFKNGLDLGED 1224
              S   S    + +P+ +  S + GY        ++L   +  +P P+  +   GL+ G +
Sbjct: 16046 LSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVE 16105

Query: 1225  ARFRM 1229
               FR+
Sbjct: 16106 YEFRV 16110



 Score =  211 bits (537), Expect = 4e-54
 Identities = 158/561 (28%), Positives = 244/561 (43%), Gaps = 48/561 (8%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP+  LD   R   T+++ AG  +RL VP+ G P P + W K           P  +  +
Sbjct: 13385 PPEGELDADLR--KTLILRAGVTMRLYVPVKGRPPPKITWSK-----------PNVNLRD 13431

Query: 704   DTG-DSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
               G D     FD  L C                   E   K D G Y +T++N  G+ + 
Sbjct: 13432 RIGLDIKSTDFDTFLRC-------------------ENVNKYDAGKYILTLENSCGKKEY 13472

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
              + VKV+D P  P    +  + +DS  V WEPP  DGG PI+ Y+++++  +   W  + 
Sbjct: 13473 TIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVT 13532

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVS 882
              +   + S     + EG  Y  RV+A N  G+  P            P     L V  VS
Sbjct: 13533 TE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVS 13591

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
              ++ S+ W+ P   G   + GY V++  E  ++W   ++ L+   S   KDL  G    F
Sbjct: 13592 KSSCSIGWKKPHSDGGSRIIGYVVDFLTEE-NKWQRVMKSLSLQYS--AKDLTEGKEYTF 13648

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV A N  G G P   T  V  ++ +  P L L          K      L IP +GKP 
Sbjct: 13649 RVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPA 13706

Query: 1003  PQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQ 1061
             P V+W K   PLA +  VS+ +S  +T L +   ++  +G Y +T++      + T+ ++
Sbjct: 13707 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIK 13766

Query: 1062  VVDKPS-PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             VV KP  P   ++  +     + L+W PP+D G +E+  Y ++K D    +W T     +
Sbjct: 13767 VVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQ 13826

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP-GITYEPPNYKALDF-- 1177
             +T   V  L  G  Y FRV ++N  G  +      EP+    P  +   PP    +D   
Sbjct: 13827 KTTFRVTRLHEGMEYTFRVSAENKYGVGE--GLKSEPIVARHPFDVPDAPPPPNIVDVRH 13884

Query: 1178  -SEAPSFTQP-LVNRSVIAGY 1196
              S + ++T P     S I GY
Sbjct: 13885 DSVSLTWTDPKKTGGSPITGY 13905



 Score =  211 bits (537), Expect = 4e-54
 Identities = 149/517 (28%), Positives = 234/517 (45%), Gaps = 47/517 (9%)

Query: 636   IDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPA 695
             ++ V R+  P   LD   R   T+VV AG  +R+ VPI G PAP V W K          
Sbjct: 14460 VEIVEREMAPDFELDAELR--RTLVVRAGLSIRIFVPIKGRPAPEVTWTK---------- 14507

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
                        D+             + R  +E T+  ++  +    + D G + +T++N
Sbjct: 14508 -----------DN----------INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIEN 14546

Query: 756   PVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--K 813
             P G+    + V+V+D P      + +++ +DS T+ W+ P  DGG  I  YI+E+++  +
Sbjct: 14547 PAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATR 14606

Query: 814   KSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEP 873
             KSY           + +++   + EG  Y  RV A N  G+  P+  ++P      PS P
Sbjct: 14607 KSYSTATTK---CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPP 14663

Query: 874   THLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW--VAALQGLTEHTSILV 931
               L + D++ +TVSL W  P+  G   + GY +E   +G  +W  +  ++GL      +V
Sbjct: 14664 DSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGL----ECVV 14719

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
             ++L  G    F+V A N AG  AP   + PV V+E    P L L    ++ +  K G+ +
Sbjct: 14720 RNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNI 14778

Query: 992   NLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE 1050
              + IP  G+P+P VTW K  Q L   + V+   + T TIL I    R  SG Y +T R  
Sbjct: 14779 KVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNI 14838

Query: 1051  NMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
               E    + +QV D P PP   ++  +     V   W PP++ G   +  Y V+     +
Sbjct: 14839 VGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDS 14898

Query: 1110  MEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
               W  +     RT      L  G  Y FRV +QN  G
Sbjct: 14899 TTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYG 14935



 Score =  209 bits (531), Expect = 2e-53
 Identities = 164/608 (26%), Positives = 257/608 (42%), Gaps = 65/608 (10%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K   E+V  S + V        L I DVT  D   YS   E      S+     ++K+
Sbjct: 12627 WKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAEN-----SSGTDTQKIKV 12681

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKA-ITQGNKAPA 695
               +    PP+   D    I D           + +   G      I +K  +++G     
Sbjct: 12682 VVMDAPGPPQPPFD----ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRG----- 12732

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
                           +WV     + +T  RV            + G E     ++ V  +N
Sbjct: 12733 --------------DWVTALASVTKTSCRVGK---------LIPGQEY----IFRVRAEN 12765

Query: 756   PVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
               G  +   + K++      VP  P   +++ V +D   V W+ P  DGG PI+GY++ER
Sbjct: 12766 RFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIER 12825

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ---PFMPI 867
             K++ S  W++ N  L++   +    ++EG+ Y  R+YA+N  G S PS  ++     MP+
Sbjct: 12826 KERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPV 12885

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE-- 925
              PP +P    V DV+ +TVSL W  P+  G   + GY VE C     +WV       +  
Sbjct: 12886 DPPGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIP 12942

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
                     L   A+  FR  A        P   ++PVT+      PR+ L   ++  +  
Sbjct: 12943 QEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTV 13002

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTKEG---QPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
             K G  V L     GKP P V+W K+G   +P  G +++++ +     LF  +  R  SG 
Sbjct: 13003 KAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELF--SVNRKDSGD 13060

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
             Y +T    +    AT+ L+V+DKP PP  +++   +     L W+PP + G +E+  Y V
Sbjct: 13061 YTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIV 13120

Query: 1103  QKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPR 1162
              K +     W  V      T C V +LI G+ Y FR+ ++N  G  D   T  EP     
Sbjct: 13121 DKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFT--EPAIAKN 13178

Query: 1163  PGITYEPP 1170
             P   Y+PP
Sbjct: 13179 P---YDPP 13183



 Score =  207 bits (526), Expect = 7e-53
 Identities = 139/404 (34%), Positives = 194/404 (48%), Gaps = 13/404 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VPDAP  P ++ V +DS  V W  P +DGG+PI  YILE+++  S RW R+  D I   +
Sbjct: 10706 VPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYT 10764

Query: 831   H-EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTV 886
                   ++EG  YE RV A N IG+  PSP S+P     PI  PS P +    D +  +V
Sbjct: 10765 KFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 10824

Query: 887   SLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA--LQGLTEHTSILVKDLPTGARLLFRV 944
              L W+PP   G   + GY VEY   G  EW  A         T   V  L  G    FRV
Sbjct: 10825 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRV 10884

Query: 945   RAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
              A N AG   P    EPV V++ L+ P L L  ++ +    KVG+ + L    +G P P+
Sbjct: 10885 LAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPK 10944

Query: 1005  VTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVD 1064
             VTW KE +  A  +  I  +P  + L IR A     G Y +TV         ++ + V+D
Sbjct: 10945 VTWKKEDRD-APTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 11003

Query: 1065  KPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             KP PP+DL V++    +  L WK P D G + +  Y V++ D  + +W  +    ++   
Sbjct: 11004 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSH 11063

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPVFIPRP 1163
                 L  GN Y FRV ++N  G      T K     +P+  P P
Sbjct: 11064 FAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGP 11107



 Score =  206 bits (524), Expect = 1e-52
 Identities = 169/608 (27%), Positives = 260/608 (42%), Gaps = 74/608 (12%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV---PEGFACNLSAKLHFME 633
             W K+GKEL   +++++        L   D T  D   Y+     P GFA       H   
Sbjct: 15190 WSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFA------KHIFN 15243

Query: 634   VKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKA 693
             VK+            LD PG                  P  G  A T +  +      K 
Sbjct: 15244 VKV------------LDRPG------------------PPEGPLAVTEVTSE------KC 15267

Query: 694   PARPAPDAPEDTGDSDEWVFDKK---LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYT 750
                  P   +     D ++  K+    L  T     V+ TK +    ++G    +E ++ 
Sbjct: 15268 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKG----NEYIFR 15323

Query: 751   VTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILG 805
             V   N  G     E +  L V     PD P  P+++ + +DS  V W  P  DGG  I+ 
Sbjct: 15324 VMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIIN 15383

Query: 806   YILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM 865
             YI+ER+ K   RW++ N   + +L ++   + EG  YE R+ A NA G+S PSP S PF 
Sbjct: 15384 YIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTS-PFY 15442

Query: 866   PI-------GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW-- 916
                      GPP  P    V D S +++S+ W  P   G   + GY VE       EW  
Sbjct: 15443 KACDTVFKPGPPGNP---RVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQI 15499

Query: 917   VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLP 976
             V    GL + TS  +  L        R+ A N  G G P         ++ +  P ++L 
Sbjct: 15500 VTPPAGL-KATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELD 15558

Query: 977   RHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE-GQPLAGEEVSIRNSPTDTILFIRAA 1035
               LR+ +  +    + L +P +G+P P+V W ++ G+ L  ++ SI ++ + T+L +   
Sbjct: 15559 ADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL--DKASIESTSSYTLLIVGNV 15616

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
              R  SG Y +TV   +    A + ++V+D P PPQDL+V +    +V L W PP   G +
Sbjct: 15617 NRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGS 15676

Query: 1096  ELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK 1155
             ++  Y V+K +     + TV  +  +T   V +L  G  YYFRV ++N  G    A T +
Sbjct: 15677 KIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAE 15736

Query: 1156  EPVFIPRP 1163
                   RP
Sbjct: 15737 SVKASERP 15744



 Score =  205 bits (522), Expect = 2e-52
 Identities = 166/590 (28%), Positives = 260/590 (44%), Gaps = 57/590 (9%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K+G  L P   IK++    +  L +  V   D  DY+   E  + + SA +   ++K+
Sbjct: 13024 WKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI---KLKV 13080

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                         LD PG  P   V +  NK+  D  +       + W+  +  G      
Sbjct: 13081 ------------LDKPG--PPASVKI--NKMYSDRAM-------LSWEPPLEDGGS---- 13113

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNP 756
                       +   ++ DK+         +V  T   +  +VE   +  E  + +  +N 
Sbjct: 13114 ----------EITNYIVDKRETSRPNW-AQVSATVPITSCSVEKLIEGHEYQFRICAENK 13162

Query: 757   VGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERK 811
              G      T   I     D P     P ISN+ +D  TV W+PPA DGG PI GY+LE++
Sbjct: 13163 YGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKR 13222

Query: 812   KKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ------PFM 865
             + ++  W ++N   I E + +A  + EG  YE RV A+N  G  +PS AS+      P  
Sbjct: 13223 ETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 13282

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA-LQGLT 924
             P GPP+ P    V D + ++VSL W  P   G   + GY VE        WV   L    
Sbjct: 13283 PPGPPAFP---KVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNL 13339

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
             + T   V  L    +  FRV A N  G   P    +    ++IL  P  +L   LR+T+ 
Sbjct: 13340 QKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLI 13399

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTY 1043
              + G  + L +P +G+P P++TW+K    L     + I+++  DT L      +  +G Y
Sbjct: 13400 LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKY 13459

Query: 1044  QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
              +T+     + + T+V++V+D P PP ++ V +    +  + W+PP   G + +  Y VQ
Sbjct: 13460 ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ 13519

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
             K D +   W TV     +T   V  L  G  Y+FRVF++N  G  D   T
Sbjct: 13520 KRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGET 13569



 Score =  204 bits (519), Expect = 4e-52
 Identities = 155/574 (27%), Positives = 256/574 (44%), Gaps = 43/574 (7%)

Query: 632  MEVKIDFVPRQEPPKIHLDCPGRIPD---TIVVVAGNKL-----RLDVPISGDPAPTVIW 683
            +++  + V R E  K  L  P  + +   T  V A N+L      + V +   P+P    
Sbjct: 9141 LQITKEEVSRSEA-KTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPR-- 9197

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSD--EWVFDKKLLCETEGR-VRVETTKDRSIFTVEG 740
              A+T           DAP D G S+   +V DK+     +     V  T     + +  
Sbjct: 9198 NLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWK 9257

Query: 741  AEKEDEGVYTVTVKNPVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPP 795
                 +  + V   N  G      + KV+      +P  P  PK+    + S  V W PP
Sbjct: 9258 LIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPP 9317

Query: 796  AYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS-----HEARRMIEGVVYEMRVYAVN 850
              +GG PI GY LE++++ S  W R++   I ++          R++EGV Y+ R  A+N
Sbjct: 9318 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 9377

Query: 851  AIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVE 907
            A G+  PS  S P +   PI PP  P+   V+D + +++SL W+PP + G   + GY VE
Sbjct: 9378 AAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVE 9437

Query: 908  YCPEGCSEW--VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
               EG ++W  V     L      +V +L    +  FRV+A N AG   P  TT  +   
Sbjct: 9438 MQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPAT 9497

Query: 966  EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP 1025
            +I + P + +    +  +  K G  + +    +G+P P+ +W  +G+     +  + + P
Sbjct: 9498 DIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIP 9557

Query: 1026 TD---------TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTD 1076
             D         +++ I   +R H+G Y +T + +  +  A   ++V+D P PP+DL+V+D
Sbjct: 9558 EDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSD 9617

Query: 1077 AWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYY 1136
                +  L WK P D G   + GY ++K       W  V      T  VVP+L+    Y+
Sbjct: 9618 ITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYF 9677

Query: 1137 FRVFSQNMVGFSD-----RAATTKEPVFIPRPGI 1165
            FRV ++N  G        +  T ++P++ P P I
Sbjct: 9678 FRVRAENRFGIGPPVETIQRTTARDPIYPPDPPI 9711



 Score =  203 bits (516), Expect = 1e-51
 Identities = 156/577 (27%), Positives = 241/577 (41%), Gaps = 75/577 (12%)

Query: 659  IVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLL 718
            I+V+ G KL + VP    P PTV W K                     D  E        
Sbjct: 8091 IIVIEGEKLSIPVPFRAVPVPTVSWHK---------------------DGKE-------- 8121

Query: 719  CETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP 778
             +   R+ ++     +   V  + + D G+YT+T++N +G    ++ VKVI +P      
Sbjct: 8122 VKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDI 8181

Query: 779  KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIE 838
            K S++ + SC + WEPP +DGG PIL Y+LER++     ++ +      +LS   + +I 
Sbjct: 8182 KASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPV-MSGENKLSWTVKDLIP 8240

Query: 839  GVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPER 895
               Y  RV AVN +G         P +   P  PP  P  + V + +   +++ W+PP  
Sbjct: 8241 NGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLY 8300

Query: 896  VGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAP 955
             G   + GY +E   +G   W    + L    +   K L  G    FRVRA N AG   P
Sbjct: 8301 DGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEP 8360

Query: 956  VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
               T P    + +  P++ L    R +++ K G+ + L     G P P +TW K+   + 
Sbjct: 8361 SRATPPTKAVDPIDAPKVIL----RTSLEVKRGDEIALDASISGSPYPTITWIKDENVIV 8416

Query: 1016 GEEVSIRNSPT------------------------------DTILFIRAARRVHSGTYQV 1045
             EE+  R +P                               ++ L +R + R   G Y +
Sbjct: 8417 PEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMI 8476

Query: 1046 TVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKA 1105
             V  ++   KA   + V+D P PP +    D    +V  +W+PP D G +E+  YT++K 
Sbjct: 8477 KVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKK 8536

Query: 1106 D--KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG----FSDRAATTKEPVF 1159
            D  K   EW  V    R     V +LI G  Y FRV ++N  G       +    K+P F
Sbjct: 8537 DKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDP-F 8595

Query: 1160 IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGY 1196
             P P    +P        S    + +P  N S I GY
Sbjct: 8596 GP-PDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGY 8631



 Score =  202 bits (514), Expect = 2e-51
 Identities = 143/504 (28%), Positives = 223/504 (44%), Gaps = 23/504 (4%)

Query: 727   VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE----DQVNLTVKV-IDVPDAPAAPKIS 781
             V  T  R++  V      +E  + +  +N  G     D   +TVK+    P  P+ P ++
Sbjct: 20315 VSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVT 20374

Query: 782   NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
             NV  +S TV W  P  +GG  ++GY LE K + S  W + N  +I+    +   +  G++
Sbjct: 20375 NVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLI 20434

Query: 842   YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGL 901
             YE RVYA NA G+ +PS  S+P + I     P ++ + D+S  +VSL W+ P   G   +
Sbjct: 20435 YEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKI 20494

Query: 902   DGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGP-GAPVTTTE 960
              GY VE        W  A       T  ++  L   ++  FRV A N  G    P     
Sbjct: 20495 TGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVG 20554

Query: 961   PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEV 1019
             P+T  +    P + LP    + ++ + G  V L     GKP P + W K+ + L     V
Sbjct: 20555 PITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALV 20614

Query: 1020  SIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPP-QDLRVTDAW 1078
              + N+     + I+ A R++SG Y++ +R       AT+ +Q++DKP PP   +      
Sbjct: 20615 CVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVT 20674

Query: 1079  GLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFR 1138
                + L W+PP D G  ++  Y V+K +   + W  V EH         ++I GN Y FR
Sbjct: 20675 AEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFR 20734

Query: 1139  VFSQNMVGF-----SDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVN-RSV 1192
             V + N  G      SD        V    PGI   P   K    S    +++P+ +  S 
Sbjct: 20735 VRAVNKYGIGEPLESDSVVAKNAFVTPGPPGI---PEVTKITKNSMTVVWSRPIADGGSD 20791

Query: 1193  IAGYTAMLCCAVRGSPKPKISWFK 1216
             I+GY       +    K  + WFK
Sbjct: 20792 ISGY------FLEKRDKKSLGWFK 20809



 Score =  202 bits (513), Expect = 2e-51
 Identities = 144/471 (30%), Positives = 207/471 (43%), Gaps = 23/471 (4%)

Query: 683  WQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAE 742
            W+  +  G         +  + T    EW+     L   +  V         +F V    
Sbjct: 8517 WEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAEN 8576

Query: 743  KEDEGVYTVT----VKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD 798
            +   G   V+     K+P G             PDAP  P + +V  +S  V+W  P  D
Sbjct: 8577 RFGPGPPCVSKPLVAKDPFGP------------PDAPDKPIVEDVTSNSMLVKWNEPK-D 8623

Query: 799  GGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPS 858
             G PILGY LE+++  S  W R+N  L+  L      ++EG+ Y  RV A NA G  + S
Sbjct: 8624 NGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFS 8683

Query: 859  PASQP---FMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSE 915
            P S P     PI PP  P    V D S TT+ L+W PP   G G + GY V+    G +E
Sbjct: 8684 PPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNE 8742

Query: 916  WVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQL 975
            W    + + +     VK++  GA    RV A N AG G P   T+PVTV E  + P ++L
Sbjct: 8743 WSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPP-GETQPVTVAEPQEPPAVEL 8801

Query: 976  PRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAA 1035
               ++  IQ   G+ + +     G+P P   WTKE   L  + V I N  T + L I+ A
Sbjct: 8802 DVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDA 8861

Query: 1036 RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
             R   G Y +T         A   ++V D P P  DL+          L W  P+D G +
Sbjct: 8862 LRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGS 8921

Query: 1096 ELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
            E+ G+ +++ D K   W   +E   R+ C +  L+ G  Y FRV ++N  G
Sbjct: 8922 EITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEGQEYKFRVIAKNKFG 8971



 Score =  201 bits (512), Expect = 3e-51
 Identities = 169/574 (29%), Positives = 245/574 (42%), Gaps = 58/574 (10%)

Query: 642  QEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDA 701
            QEPP + LD    +   I ++AG  LR+   ++G P PT +W K                
Sbjct: 8794 QEPPAVELDVS--VKGGIQIMAGKTLRIPAVVTGRPVPTKVWTK---------------- 8835

Query: 702  PEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQ 761
                   +E   DK        RV ++    +S   ++ A ++D G Y +T  N  G   
Sbjct: 8836 -------EEGELDKD-------RVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKF 8881

Query: 762  VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                V+V DVP      K        C + W  P  DGG  I G+I+ERK  K + W + 
Sbjct: 8882 AAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ- 8940

Query: 822  NFDLIQELSH-EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLA 877
               +  E S  +   ++EG  Y+ RV A N  G   P     P +   P+GPP+ P  L 
Sbjct: 8941 --PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIG-PILAVDPLGPPTSPERLT 8997

Query: 878  VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
              + + +T++L W+ P   G   + GY +E       ++    + L   TS LV++L   
Sbjct: 8998 YTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEH 9057

Query: 938  ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLR-QTIQKKVGEPVNLLIP 996
                FRV+A N  G   P      V +Q+    P ++L   +R  TI+ K GEPV++   
Sbjct: 9058 QMYEFRVKAVNEIGESEPSLPLN-VVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPAD 9116

Query: 997  FQGKPRPQVTWTK---------EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
              G P P++ W+K         +   +  EEVS   S   T L I  A R   GTY VT 
Sbjct: 9117 VTGLPMPKIEWSKNETVIEKPTDALQITKEEVS--RSEAKTELSIPKAVREDKGTYTVTA 9174

Query: 1048 RIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD- 1106
                      + ++V D+PSPP++L VTD    +  L W  P D G +E+  Y + K D 
Sbjct: 9175 SNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDA 9234

Query: 1107 -KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP--RP 1163
             +K  EW  V          + +LI    Y FRV + N  G SD   + K  +  P   P
Sbjct: 9235 SRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLP 9294

Query: 1164 GITYEPPNYKALDFSEAPSFTQPLVN-RSVIAGY 1196
            G   +P        S   S+T PL N  S I GY
Sbjct: 9295 GPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGY 9328



 Score =  201 bits (511), Expect = 4e-51
 Identities = 166/600 (27%), Positives = 260/600 (43%), Gaps = 71/600 (11%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K GK++ P    +++       LTI   T  D  +Y+            K+  ++V +
Sbjct: 14108 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATN---PFGTKVEHVKVTV 14164

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                                             LDVP  G P P  I   +     KA   
Sbjct: 14165 --------------------------------LDVP--GPPGPVEI---SNVSAEKATLT 14187

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKD----RSIFT--VEGAEKEDEGVYT 750
               P   +       ++ +K+   ET   +    ++D    R + T  ++G    +E ++ 
Sbjct: 14188 WTPPLEDGGSPIKSYILEKR---ETSRLLWTVVSEDIQSCRHVATKLIQG----NEYIFR 14240

Query: 751   VTVKNPVGEDQV--NLTVKVID---VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILG 805
             V+  N  G+ +   +  VK++D    P  P  P++SNV +++ TV W+ P  DGG  I G
Sbjct: 14241 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 14300

Query: 806   YILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM 865
             Y +ER++KKS RW+R     + +L  +   + EG  YE RV A N  G+  PS AS   +
Sbjct: 14301 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 14360

Query: 866   ------PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA 919
                   P GPPS P    V D +  + SL W  P   G   + GY VE+   G   W+  
Sbjct: 14361 MKDAAYPPGPPSNP---HVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 14417

Query: 920   LQGLT-EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
               G     T  +V DL T  +  FR+ A N AG G P    + V + E    P  +L   
Sbjct: 14418 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPD-VEIVEREMAPDFELDAE 14476

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRV 1038
             LR+T+  + G  + + +P +G+P P+VTWTK+   L     +I N+ + T+L I    R 
Sbjct: 14477 LRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLK-NRANIENTESFTLLIIPECNRY 14535

Query: 1039  HSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
              +G + +T+     +    + ++V+D P P  +LR TD    +V L W  P   G + + 
Sbjct: 14536 DTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRIT 14595

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
              Y V+K +     + T      +    V  L  G  Y+FRV ++N  G  +   TT EPV
Sbjct: 14596 NYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETT-EPV 14654



 Score =  200 bits (508), Expect = 8e-51
 Identities = 169/607 (27%), Positives = 252/607 (41%), Gaps = 59/607 (9%)

Query: 574   RGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFME 633
             R  W K+G E+     ++++ +     L + D T      Y+   +  + +  A++   +
Sbjct: 21684 RVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEI---K 21740

Query: 634   VKIDFVPRQEPPKIHLDCPGRI--PDTIVVVAGNKLRL--DVPISGDPAPTV--IWQKAI 687
             VK+             D PG++  P     + G K+ L  D P++   AP    I +K  
Sbjct: 21741 VKVQ------------DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRE 21788

Query: 688   TQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEG 747
             T      +R A    ED  ++  +   K L+   E + RV                    
Sbjct: 21789 T------SRLAWALIEDKCEAQSYTAIK-LINGNEYQFRVSA------------------ 21823

Query: 748   VYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYI 807
             V    V  P+  D V   ++   VPDAP  P+ SN+  +S T+ W  P  DGG  I  YI
Sbjct: 21824 VNKFGVGRPLDSDPVVAQIQYT-VPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYI 21882

Query: 808   LERKKKKSYRWMR-LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM- 865
             LER++KKS RW++ ++   I E   +   + EG  YE  V A NA G+   S  S+    
Sbjct: 21883 LERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKC 21942

Query: 866   --PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGL 923
               P+ PP  PT + V D S TTVSL+W  P   G   + GY +E C     +W       
Sbjct: 21943 REPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEA 22002

Query: 924   TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
                T   V DL  G    FRV A N AG G     T  +   + L  P L +  + +QT 
Sbjct: 22003 CVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTH 22062

Query: 984   QKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTY 1043
               + G  + L I +QG+P P   W+K    L+     I  + + + L +    R  +G Y
Sbjct: 22063 VVRAGASIRLFIAYQGRPTPTAVWSKPDSNLS-LRADIHTTDSFSTLTVENCNRNDAGKY 22121

Query: 1044  QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
              +TV   +     T  ++V+D P PP  +   D    +  L W  P   G   +  Y V+
Sbjct: 22122 TLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVE 22181

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             K +     W  + E   R    V +L  G  YYFRV + N  G         EP  +P P
Sbjct: 22182 KREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVG-------EPYEMPEP 22234

Query: 1164  GITYEPP 1170
              +  E P
Sbjct: 22235 IVATEQP 22241



 Score =  199 bits (507), Expect = 1e-50
 Identities = 128/407 (31%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VP  P  P+++ V +DS T+ W  P  DGG PILGY +ERK++    W  ++  L+    
Sbjct: 14953 VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNI 15012

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
              ++  + +G+ YE RV A N  G S+PS  S+P +   PI PP +P  L   +++  TV+
Sbjct: 15013 FKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPL---NITRHTVT 15069

Query: 888   LKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAH 947
             LKW  PE  G   +  Y VE        W+ A           V  L   A   FRV A 
Sbjct: 15070 LKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAK 15129

Query: 948   NMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
             N AG    P   ++ +T ++ ++ P++++    + T+  K GE   L     G+P P + 
Sbjct: 15130 NAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTME 15189

Query: 1007  WTKEGQPLAG-EEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             W+K+G+ L G  ++ I+ +   T L  + + R  SG Y +T        K    ++V+D+
Sbjct: 15190 WSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDR 15249

Query: 1066  PSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             P PP+  L VT+       L W PP D G  ++  Y VQK +   + W  V    + T  
Sbjct: 15250 PGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKL 15309

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPN 1171
              V +L+ GN Y FRV + N  G  +      EPV    P   Y PP+
Sbjct: 15310 KVTKLLKGNEYIFRVMAVNKYGVGE--PLESEPVLAVNP---YGPPD 15351



 Score =  199 bits (506), Expect = 1e-50
 Identities = 156/565 (27%), Positives = 253/565 (44%), Gaps = 26/565 (4%)

Query: 702   PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
             P+D G S+   ++ +K+     +  V   +   ++ F V    +  E  + V+ +N  G 
Sbjct: 13795 PKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGV 13853

Query: 760   DQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
              +   +  ++     DVPDAP  P I +V  DS ++ W  P   GG PI GY LE K++ 
Sbjct: 13854 GEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERN 13913

Query: 815   SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPT 874
             S  W R N   I+    +   + EG+ YE RV A+N  G+ +PS  S+P + + P   P 
Sbjct: 13914 SLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPG 13973

Query: 875   HLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDL 934
                V +++  +V+L W  P+  G   L GY VE        W+ A        +  V DL
Sbjct: 13974 KPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDL 14033

Query: 935   PTGARLLFRVRAHNMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNL 993
               G +  FR+RA N AG   AP  +TE +  ++  + P + L   ++  +  K G+ + L
Sbjct: 14034 VEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVL 14093

Query: 994   -LIPFQGKPRPQVTWTKEGQPLAGEEVS-IRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
               I   GKP P+ +W+K G+ +   +++ I ++PT ++L I+ A R  +G Y +T     
Sbjct: 14094 NAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPF 14153

Query: 1052  MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTME 1111
                   + + V+D P PP  + +++       L W PP + G + +  Y ++K +   + 
Sbjct: 14154 GTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLL 14213

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV-----FIPRPGIT 1166
             W  V E  +    V  +LI GN Y FRV + N  G  +      EPV     F P PG  
Sbjct: 14214 WTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE--PVQSEPVKMVDRFGP-PGPP 14270

Query: 1167  YEPPNYKALDFSEAPSFTQPLVN-RSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA 1225
              +P        +   S+ +P+ +  S I GY       V    K  + W +       D 
Sbjct: 14271 EKPEVSNVTKNTATVSWKRPVDDGGSEITGY------HVERREKKSLRWVRAIKTPVSDL 14324

Query: 1226  RFRMFSKQGVLTLEIRKPCPFDGGI 1250
             R ++   Q   T E R       GI
Sbjct: 14325 RCKVTGLQEGSTYEFRVSAENRAGI 14349



 Score =  197 bits (500), Expect = 7e-50
 Identities = 147/509 (28%), Positives = 216/509 (42%), Gaps = 42/509 (8%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP++ LD   R  D I V  G  +R+   + G P P + W K                  
Sbjct: 11600 PPEVELDVTCR--DVITVRVGQTIRILARVKGRPEPDITWTK------------------ 11639

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
                       + K+L   E RV +     R    ++ A + D G Y ++ KN  G  Q +
Sbjct: 11640 ----------EGKVLVR-EKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGS 11688

Query: 764   LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF 823
               V V+D P      K++NV +++CT+ WE P  +GG  I  +I+E +K     W  +  
Sbjct: 11689 AIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVAS 11748

Query: 824   DLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGP---PSEPTHLAVED 880
             D+ + L      ++    Y  RV A N +G+        P + I P   P EP +L + D
Sbjct: 11749 DVTKRLIKA--NLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIAD 11806

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL 940
                T V LKWR P+  G      Y VE   +G  +W    +G  + T  +V         
Sbjct: 11807 KGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIY 11866

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FRV+  N  G    V T E V V+E LQ+P L L   L   +  K G+ + L    +GK
Sbjct: 11867 EFRVQTKNEGGESDWVKTEE-VVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGK 11923

Query: 1001  PRPQVTWTKEGQPL---AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             P P+V WTK+           V I      +   +  A+R   G Y VT         A 
Sbjct: 11924 PFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAY 11983

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
               + V+DKP P ++L++ D       + W PP+D G  E+  Y ++K + K M W T   
Sbjct: 11984 ATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSA 12043

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
                     V  LI GN Y FRV ++N +G
Sbjct: 12044 TVLTPGTTVTRLIEGNEYIFRVRAENKIG 12072



 Score =  196 bits (498), Expect = 1e-49
 Identities = 146/539 (27%), Positives = 227/539 (42%), Gaps = 73/539 (13%)

Query: 635  KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAP 694
            +I  V  QE P+I LD   ++   + V AG K+ L   ++G P P + W KA        
Sbjct: 7373 EIQAVDTQEAPEIFLDV--KLLAGLTVKAGTKIELPATVTGKPEPKITWTKA-------- 7422

Query: 695  ARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVK 754
                                  ++ + + R+ +E    +S  T+  +++ D G Y +   
Sbjct: 7423 ---------------------DMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV 7461

Query: 755  NPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
            N  G     + V V+D P  PAA  I++V  +SC + W PP  DGG  I  Y++ER+   
Sbjct: 7462 NVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATD 7521

Query: 815  SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRP---SPASQPFMPIGPPS 871
            S  W +L+   +++ + +A ++I    Y  RV A N  G+  P   SP +  +    PP 
Sbjct: 7522 SEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQ-FDPPG 7579

Query: 872  EPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILV 931
             PT L   D++   V+L W  P+  G   + GY VE       +WV   +   + T+  V
Sbjct: 7580 PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRV 7639

Query: 932  KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
            K L    +  FRV A N+AGPG P  +TEP+ +++ +  P                  P 
Sbjct: 7640 KGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPP----------------WPPG 7683

Query: 992  NLLIPFQGKPRPQVTWTKEGQPLAG--EEVSIRNSPTDTILFIRAARRV----------- 1038
               +   GK   ++ WTK         E   I    T T  ++R A  V           
Sbjct: 7684 KPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLM 7743

Query: 1039 HSGTYQVTVRIENMEDKA--------TLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQ 1090
                Y   VR  N   ++         L  + +  PSPP+ L V +       L+W  P+
Sbjct: 7744 EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPE 7803

Query: 1091 DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
              G + +  Y V+K D +   W TV    + T C V  L  G+ Y FRV ++N +G SD
Sbjct: 7804 KDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD 7862



 Score =  196 bits (498), Expect = 1e-49
 Identities = 162/633 (25%), Positives = 260/633 (41%), Gaps = 83/633 (13%)

Query: 642   QEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDA 701
             QE P++ +D   +  D +V  AG+++R+   I G P P   W+    +  KA      D 
Sbjct: 9500  QEEPEVFIDIGAQ--DCLVCKAGSQIRIPAVIKGRPTPKSSWEFD-GKAKKAMKDGVHDI 9556

Query: 702   PEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQ 761
             PED                     ++ET ++ S+  +   ++   G Y++T KN  G+  
Sbjct: 9557  PEDA--------------------QLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKT 9596

Query: 762   VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              N  VKV+DVP  P   K+S++   SC + W+ P  DGG  I GY++E++      W ++
Sbjct: 9597  ANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKV 9656

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAV 878
             N D     +     ++    Y  RV A N  G+  P    Q      PI PP  P  L +
Sbjct: 9657  NPDC-GSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKI 9715

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVE---YCPEGCSE--WVAALQGLTEHTSILVKD 933
               ++  TV L W+PP+  G   +  Y VE   + P G  +  W    +   E     V+D
Sbjct: 9716  GLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVED 9775

Query: 934   LPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNL 993
             L  G    FRV+A N AG   P  T  P   Q    RP +     L++ ++ + G  VN+
Sbjct: 9776  LVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQ----RPDMPPSIDLKEFMEVEEGTNVNI 9831

Query: 994   LIPFQGKPRPQVTWTK-------EGQPLAGEEVSIRNSPTDTI-LFIRAARRVHSGTYQV 1045
             +   +G P P +TW K         +P+  +    +    DT  L I  +RR  +G Y +
Sbjct: 9832  VAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTI 9891

Query: 1046  TVRIENMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK 1104
             T           + L V+ +P PP   ++        + L W PP+D G +++  Y ++K
Sbjct: 9892  TAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEK 9951

Query: 1105  ADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV--FIPR 1162
              +     W  V    +     +P+L+ G+ Y FR+ +QN  G  +   +  E        
Sbjct: 9952  REANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV 10011

Query: 1163  PG----------------ITYEPPNYKA--------LDFSEAPSFTQPLVNRSVIAGYTA 1198
             PG                + +E P Y          L+  +  S     VNR  I   T 
Sbjct: 10012 PGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTL 10071

Query: 1199  MLCCAVRGSPKPKISWFKNGLDLGEDARFRMFS 1231
                          +S+   GL  G D +FR+++
Sbjct: 10072 ------------GVSYKVTGLIEGSDYQFRVYA 10092



 Score =  195 bits (495), Expect = 3e-49
 Identities = 127/403 (31%), Positives = 185/403 (45%), Gaps = 20/403 (4%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P+ P++S + +DS  V W  P  DGG  I GYILE++ K+  RW + N   + +L  
Sbjct: 18597 PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRL 18656

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSP------ASQPFMPIGPPSEPTHLAVEDVSDTT 885
                 + EG  YE RV A NA G+  PS       A     P GPPS P    V D S ++
Sbjct: 18657 RVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP---KVTDTSRSS 18713

Query: 886   VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWV-----AALQGLTEHTSILVKDLPTGARL 940
             VSL W  P   G   + GY VE       EW        LQG        V  L      
Sbjct: 18714 VSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQG----KQFTVTKLKENTEY 18769

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FR+ A N  G G P T    V  QE ++ P ++L   LR+ +  +    + L +  +G+
Sbjct: 18770 NFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGR 18829

Query: 1001  PRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVL 1060
             P P+V W K  + +  +   I  + + T+L I    R  SG Y +T+   +    A + +
Sbjct: 18830 PEPEVKWEK-AEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNV 18888

Query: 1061  QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             +V+D PS P +L + +    +V L W+PP   G  ++  Y V+K +     + T+  +  
Sbjct: 18889 RVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCT 18948

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             +T   +  L  G  YYFRV + N  G    A TT EPV +  P
Sbjct: 18949 KTTFRIENLQEGCSYYFRVLASNEYGIGLPAETT-EPVKVSEP 18990



 Score =  191 bits (485), Expect = 4e-48
 Identities = 129/467 (27%), Positives = 213/467 (45%), Gaps = 18/467 (3%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P  P  + + +DS  +QW  P  +GG P++GY LERK++ S  W ++N  +I +   
Sbjct: 17118 PGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQF 17177

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSL 888
             +A+ + EG+ YE RVYA N +G+ + S  S+ ++   P  PP  P  + V+      ++L
Sbjct: 17178 KAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVK---RNEITL 17234

Query: 889   KWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
             +W  P   G   + GY VE        W+ A       T   V  L    R  FRV A N
Sbjct: 17235 QWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKN 17294

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTW 1007
              AG    P  +T P+T ++ ++ PR+ +    R TI    GE   L     GKP P + W
Sbjct: 17295 AAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEW 17354

Query: 1008  TKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT--LVLQVVD 1064
              +  + +       I+N+    +L ++ A R+  G Y   +R  N+    +  + ++V+D
Sbjct: 17355 LRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQY--ILRASNVAGSKSFPVNVKVLD 17412

Query: 1065  KPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTH 1123
             +P PP+  ++VT       +L W PP   G +++  Y V+K +   + W  V        
Sbjct: 17413 RPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS 17472

Query: 1124  CVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSF 1183
               V +L+ GN Y FR+ + N  G  +   +   PV +  P +   PP  K+L+ +     
Sbjct: 17473 LKVTKLLEGNEYVFRIMAVNKYGVGEPLESA--PVLMKNPFVLPGPP--KSLEVTNIAKD 17528

Query: 1184  TQPLV-NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRM 1229
             +  +  NR    G + ++   V    +  I W K       D R R+
Sbjct: 17529 SMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 17575



 Score =  189 bits (480), Expect = 1e-47
 Identities = 125/408 (30%), Positives = 194/408 (47%), Gaps = 15/408 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VP  P  P ++    DS  VQW  P  DGG  ++GY LERK++ S  W++LN   I +  
Sbjct: 16035 VPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTK 16094

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
              +   + EGV YE RV A N +G+ +PS  S+ ++   P  PP  P  +    V+  +V+
Sbjct: 16095 FKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAII---VTRNSVT 16151

Query: 888   LKWRPPERVGAGGLDGYSVE--YCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVR 945
             L+W+ P   G   + GY VE    PEG   W+ A       T   V  L    R  FRV 
Sbjct: 16152 LQWKKPTYDGGSKITGYIVEKKELPEG--RWMKASFTNIIDTHFEVTGLVEDHRYEFRVI 16209

Query: 946   AHNMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
             A N AG    P  +T  +T ++ +  PR+ +    + TI    GE   +     GKP P 
Sbjct: 16210 ARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPT 16269

Query: 1005  VTWTKEGQPLAG-EEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVV 1063
             + W K  Q L+    + I+++   T L ++ A RV SG Y +  +    E   T+ ++V+
Sbjct: 16270 IQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVL 16329

Query: 1064  DKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRT 1122
             D+P PP+  + ++        L WKPP   G +++  Y V++ +   + W  V  + +  
Sbjct: 16330 DRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTL 16389

Query: 1123  HCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPP 1170
              C V +L+ GN Y FR+ + N  G  +      EPV    P +  + P
Sbjct: 16390 SCKVTKLLEGNEYTFRIMAVNKYGVGE--PLESEPVVAKNPFVVPDAP 16435



 Score =  189 bits (479), Expect = 2e-47
 Identities = 129/478 (26%), Positives = 224/478 (46%), Gaps = 24/478 (5%)

Query: 743   KEDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAY 797
             K +E ++ V   N  G     E +  +      +P  P  P+    G++   +QW  P  
Sbjct: 22901 KNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPES 22960

Query: 798   DGGQPILGYILERKKKKSYRWMRLNFD-LIQELSHEARRMIEGVVYEMRVYAVNAIGMSR 856
             DGG  I  Y++++++KKS RW R+N D ++ +   +   ++EG  Y+ RV AVNA G S 
Sbjct: 22961 DGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSE 23020

Query: 857   PSPAS------QPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
             PS AS      +P    GPPS P    V D +  ++SL W  P   G   + GY +E   
Sbjct: 23021 PSEASNFISCREPSYTPGPPSAPR---VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQE 23077

Query: 911   EGCSEWVAALQGLT-EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQ 969
             +   +W       T  +T   V DL  G +  FRV A N+ G      +   +   E ++
Sbjct: 23078 KDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIE 23137

Query: 970   RPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTI 1029
              P L+L   L++T+  + G  + L++   G+P P +TW+K+G  LA   + I  + + ++
Sbjct: 23138 IPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSL 23196

Query: 1030  LFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
             L +    R  +G Y +    ++ +  AT++++V D P P   ++V +    +V + W+ P
Sbjct: 23197 LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 23256

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
                G   +  Y V+K +     + TV     +T   +  L+ G  YYFRV  +N+ G  +
Sbjct: 23257 TIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE 23316

Query: 1150  RAATTKEPVFIPRPGITYEPPNYKALDFSEAP---SFTQPLVN-RSVIAGYTAMLCCA 1203
                T+   +    P +   P   + +D +++    ++ +PL +  S + GY    C A
Sbjct: 23317 PCETSDAVLVSEVPLV---PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKA 23371



 Score =  188 bits (477), Expect = 3e-47
 Identities = 139/490 (28%), Positives = 224/490 (45%), Gaps = 24/490 (4%)

Query: 700   DAPEDTGDSDEWVF--DKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPV 757
             D PED G  +   +  +K+   +T  ++ V ++  R+ F V    K+ E  + V  +N  
Sbjct: 21374 DVPEDNGGGEITCYSIEKRETSQTNWKM-VCSSVARTTFKVPNLVKDAEYQFRVRAENRY 21432

Query: 758   GEDQVNLTVKVID-----VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             G  Q  ++  ++      +P  P  P I NV  D  ++ W+ P YDGG  + G+ +E+K+
Sbjct: 21433 GVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKE 21492

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ---PFMPIGP 869
             + S  W ++N   I    + A  ++EG+ Y+ RVYA N+ G+S PS  S+      P+ P
Sbjct: 21493 RNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDP 21552

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P ++   DV+  T++LKW PP R G   + GYS+E   +G   WV            
Sbjct: 21553 PGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEK-RQGNERWVRCNFTDVSECQY 21608

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTV-QEILQRPRLQLPRHLRQTIQKKVG 988
              V  L  G R  FR+ A N  G  +P + +  + + ++    P ++        +  K G
Sbjct: 21609 TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSG 21668

Query: 989   EPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
             E + +    QG+P P+VTW K+G  +     + I +    T LF+R A R H G Y V  
Sbjct: 21669 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEA 21728

Query: 1048  RIENMEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD 1106
             +  +   KA + ++V D P      +R T+  G  + L W  P + G   +  Y ++K +
Sbjct: 21729 KNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRE 21788

Query: 1107  KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF-----SDRAATTKEPVFIP 1161
                + W  + +          +LI GN Y FRV + N  G      SD      +     
Sbjct: 21789 TSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPD 21848

Query: 1162  RPGITYEPPN 1171
              PGI  EP N
Sbjct: 21849 APGIP-EPSN 21857



 Score =  185 bits (469), Expect = 3e-46
 Identities = 224/932 (24%), Positives = 347/932 (37%), Gaps = 158/932 (16%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            +V +  ++    E+    A+ KW +N + I    SKYI        TL I    L D A 
Sbjct: 6345 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAI-FDSSKYIILQKDLVYTLRIRDAHLDDQAN 6403

Query: 434  YQCVVGGE-----KCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLK 488
            Y   +        K +  L V+E  + I  PL+D   M  + V F C+V+     +KW K
Sbjct: 6404 YNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTK 6463

Query: 489  DGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVY 548
            +G E+  +    YR  K   +H L I +    D G Y +     +++AEL++ E   E  
Sbjct: 6464 NGEEVPFDNRVSYRVDK--YKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFV 6521

Query: 549  QSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTP 608
            + + D  V   D AVF C++S E     W +NG+E+    + K    G +H+L I D   
Sbjct: 6522 EHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRL 6581

Query: 609  ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLR 668
             DE +Y+   E       A+L   E+ ++ +    PP+  L+ PG   D + +   NK +
Sbjct: 6582 DDECEYACGVEDRKSR--ARLFVEEIPVEII---RPPQDILEAPGA--DVVFLAELNKDK 6634

Query: 669  LDVPISGDPAPTVIWQK---AITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRV 725
            ++V           W +    + QG+K                 E    +  +C+ + R 
Sbjct: 6635 VEVQ----------WLRNNMVVVQGDKHQMM------------SEGKIHRLQICDIKPR- 6671

Query: 726  RVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGE 785
                               D+G Y    K+     ++ L           AAPKI    +
Sbjct: 6672 -------------------DQGEYRFIAKDKEARAKLELA----------AAPKIKTADQ 6702

Query: 786  DSCTVQWEPPAYDGGQPILGYI-LERKKKKSYRWMRLNFDLIQEL-----SHEARRMIEG 839
            D           D G+P+   +  +   K    W + N  L  +         + R++E 
Sbjct: 6703 DLVV--------DVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEA 6754

Query: 840  VVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAG 899
               +   Y +        +        I  P    +L V +  D  VSL W  P   G  
Sbjct: 6755 KKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGS 6814

Query: 900  GLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA-RLLFRVRAHNMAGPGAPVTT 958
             + GY VE        WV A     E     V  L  G    LFRV A N  G G PV T
Sbjct: 6815 KIIGYVVERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVET 6873

Query: 959  TEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPL 1014
              PV       R +  +P           G P+N+ I    +    +TW       G  +
Sbjct: 6874 DNPVEA-----RSKYDVP-----------GPPLNVTITDVNRFGVSLTWEPPEYDGGAEI 6917

Query: 1015 AGEEVSIRNSPT---DTILFIRAARR-------VHSGTYQVTVRIENM-----EDKATLV 1059
                + +R+  +   DT + +RA          V    Y   VR +N         AT  
Sbjct: 6918 TNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPF 6977

Query: 1060 LQVVD---KPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
            ++V D   +PSPP +L  +D    +V L+W+PP   G + + GY +++ ++    W    
Sbjct: 6978 VKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI--- 7034

Query: 1117 EHYRRTHCVVPELII-------GNGYYFRVFSQNMVGFSDRAAT----TKEPVFIPRPGI 1165
               R    +VPEL         GN Y +RV ++N  G SD +      T +  F+     
Sbjct: 7035 ---RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFV----- 7086

Query: 1166 TYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA 1225
              EP     +D S   +F   L    VI      +     G P+P  +W      L    
Sbjct: 7087 --EP----TMDLS---AFKDGL---EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGD 7134

Query: 1226 RFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
            R +M +      L I      D GIY  +  N
Sbjct: 7135 RVKMKTLSAYAELVISPSERSDKGIYTLKLEN 7166



 Score =  184 bits (467), Expect = 5e-46
 Identities = 128/483 (26%), Positives = 224/483 (46%), Gaps = 20/483 (4%)

Query: 702  PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG- 758
            PE  G S    ++ +K+ +   +G   V+TT   +  TV    +    V+ V  +N +G 
Sbjct: 7802 PEKDGGSPITNYIVEKRDV-RRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQ 7860

Query: 759  ------EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
                  ED V L       P  P A  + +V +    ++WEPP  DGG+PI  Y++E+K+
Sbjct: 7861 SDYTEIEDSV-LAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKE 7919

Query: 813  KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGP 869
            +   RW++       + +     +IEG   + +V A N  G+  PS  ++      P  P
Sbjct: 7920 RLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP 7979

Query: 870  PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
            PS P  L V D     +++ W+PPE+ G   + GY VE CP G  +W+       +    
Sbjct: 7980 PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKF 8039

Query: 930  LVKD-LPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVG 988
             V++ +      + RVRA N  G   P   +E V  ++   +P + L  H    I+   G
Sbjct: 8040 KVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIE---G 8096

Query: 989  EPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
            E +++ +PF+  P P V+W K+G+ + A + ++++N      L +  + R  +G Y +T+
Sbjct: 8097 EKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITL 8156

Query: 1048 RIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADK 1107
              +     A++ ++V+  P P +D++ +D    +  L W+PP+  G T +  Y +++ + 
Sbjct: 8157 ENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA 8216

Query: 1108 KTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITY 1167
                +  V+    +    V +LI    Y+FRV + N VG        K PV    P    
Sbjct: 8217 GRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVG-GGEYIELKNPVIAQDPKQPP 8275

Query: 1168 EPP 1170
            +PP
Sbjct: 8276 DPP 8278



 Score =  183 bits (465), Expect = 8e-46
 Identities = 119/406 (29%), Positives = 184/406 (45%), Gaps = 15/406 (3%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P  P ++++ +D   VQW  P  DGG  I+GY LE+K+K S  W++LN   IQ+   
Sbjct: 18200 PGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKF 18259

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSL 888
             +   + EG+ YE +V A N +G+ +PS  S+ F+   P  PP  P  +    ++   V+L
Sbjct: 18260 KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIV---ITRNNVTL 18316

Query: 889   KWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
             KW+ P   G   + GY VE        W+ A       T   V  L    R  FRV A N
Sbjct: 18317 KWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARN 18376

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTW 1007
              AG    P  ++  +T ++ +  P   L    +  I    GE   L    +GKP P V W
Sbjct: 18377 AAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVW 18436

Query: 1008  TKEGQPL--AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             +K+G+ L      + I+++   T L ++   R   G Y + +          + ++V+D+
Sbjct: 18437 SKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDR 18496

Query: 1066  PSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             P PP+  L+VT        L W PP   G   +  Y ++K +   + W  V    +  + 
Sbjct: 18497 PGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNY 18556

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPP 1170
              V +L+ GN Y FRV + N  G  +       PV    P   Y+PP
Sbjct: 18557 KVTKLLPGNEYIFRVMAVNKYGIGE--PLESGPVTACNP---YKPP 18597



 Score =  183 bits (465), Expect = 8e-46
 Identities = 149/599 (24%), Positives = 245/599 (40%), Gaps = 43/599 (7%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K+G+ L   +R+ VS    V  L+I + +  D   Y       A +++     + + I
Sbjct: 19123 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSIT-----VPITI 19177

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
               + R  PP                     +R+D  +S D   T+ W      G    + 
Sbjct: 19178 IVLDRPGPP-------------------GPIRID-EVSCDSI-TISWNPPEYDGGCQISN 19216

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNP 756
                +  E T  S  W    + +  T  ++   TT     F V    +  +  Y+      
Sbjct: 19217 YIVEKKETT--STTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYS------ 19268

Query: 757   VGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSY 816
               E    +       P  P  PK+ +  + +  V W+ P  DGG  ++GY LE K++ S 
Sbjct: 19269 --ESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSI 19326

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHL 876
              W + N  LI +   +   + EG++YE RVYA N  G+ + S + +P     P   P   
Sbjct: 19327 LWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQP 19386

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V +++  +VSLKW  P   G   + GY VE        W+       + T   V +L  
Sbjct: 19387 EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTE 19446

Query: 937   GARLLFRVRAHNMA-GPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI 995
               R  FRV A N A     P  +T P+ V++ ++ PR+ +    R  I  K GE + +  
Sbjct: 19447 DQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINA 19506

Query: 996   PFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMED 1054
                G+P P ++W K+G  +       I ++   T+L ++   R  +G Y +T++      
Sbjct: 19507 DIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTR 19566

Query: 1055  KATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWF 1113
                +  +V+DKP PP   L +        +L W  PQ+ G  ++  Y V+K +   + W 
Sbjct: 19567 SVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT 19626

Query: 1114  TVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR----AATTKEPVFIPRPGITYE 1168
                   + T C V +L+ GN Y FRV   N  G  +     A    +P  +P P  + E
Sbjct: 19627 ICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLE 19685



 Score =  182 bits (462), Expect = 2e-45
 Identities = 114/380 (30%), Positives = 178/380 (46%), Gaps = 5/380 (1%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             +P  P + +++N+ +DS TV W  P  DGG  I+GYI+E++ +   RW++ N   I +L 
Sbjct: 17513 LPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLR 17572

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
                  + E   YE RV A NA G+  PSPA+  +    P+  P  PT+  + D +  +++
Sbjct: 17573 LRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSIT 17632

Query: 888   LKWRPPERVGAGGLDGYSVEYCPEGCSEW-VAALQGLTEHTSILVKDLPTGARLLFRVRA 946
             L W  P   G   + GY VE C     EW +   Q     T   +  L        RV A
Sbjct: 17633 LAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCA 17692

Query: 947   HNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
              N  G G   +    V  ++ L+ P L L   LR+ I  + G    + IPF+G+P P++T
Sbjct: 17693 LNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEIT 17752

Query: 1007  WTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKP 1066
             W++E      ++V I      T L I    R  +G Y + +   +    A + ++V+D P
Sbjct: 17753 WSREEGEFT-DKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTP 17811

Query: 1067  SPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVV 1126
              PPQ+L V +    +  L W+PP   G  ++  Y + K +     +  V     +T   V
Sbjct: 17812 GPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKV 17871

Query: 1127  PELIIGNGYYFRVFSQNMVG 1146
               L  G  YYFRV ++N  G
Sbjct: 17872 ENLTEGAIYYFRVMAENEFG 17891



 Score =  180 bits (456), Expect = 9e-45
 Identities = 116/381 (30%), Positives = 183/381 (48%), Gaps = 6/381 (1%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P AP  P++ +V  ++ +++WE P +DGG  I+GY +E+K++ +  W++ N     E ++
Sbjct: 22536 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 22595

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWR 891
             +   ++EG+ Y+ R YA+NA G+S+ S AS+P M   P   P    V DV+ +TVSL W 
Sbjct: 22596 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 22655

Query: 892   PPERVGAGGLDGYSVEYCP---EGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
              P   G   + GY +E  P    G   W+     +       V  L  G    FRV A N
Sbjct: 22656 APAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKN 22715

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLR-QTIQKKVGEPVNLLIPFQGKPRPQVT 1006
              AG       +T PVT ++    P+ +L   L    +  + G  + L     GKP P++ 
Sbjct: 22716 AAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKII 22775

Query: 1007  WTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             WTK  + L   E+VS++ +       I+   R  SG Y +TV+  +     +++++V+D 
Sbjct: 22776 WTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDS 22835

Query: 1066  PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCV 1125
             P P   L V+        L W  PQ+ G  E+  Y V++ +   + W  V         V
Sbjct: 22836 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYV 22895

Query: 1126  VPELIIGNGYYFRVFSQNMVG 1146
             V  LI  N Y FRV + N  G
Sbjct: 22896 VTRLIKNNEYIFRVRAVNKYG 22916



 Score =  171 bits (432), Expect = 5e-42
 Identities = 157/594 (26%), Positives = 238/594 (40%), Gaps = 72/594 (12%)

Query: 707  DSDEWVFDKKL-LCETEGRVRVETTKDRSIFTV-----EGAEKEDEGVYTVTVKNPVGED 760
            D+D+WV   K+ + +T  RV+  T K +  F V      G  K  +    + +K+P    
Sbjct: 7620 DTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDP---- 7675

Query: 761  QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMR 820
                    ID P  P  P + +VG+ S  + W  P +DGG  I  Y++E  K  +  W+R
Sbjct: 7676 --------IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVR 7727

Query: 821  LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLA 877
            +  + +    H    ++EG  Y  RV AVN  G S PS  S P +    + PPS P  L 
Sbjct: 7728 VA-EGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLE 7786

Query: 878  VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
            V +++  T  LKW  PE+ G   +  Y VE        W   +    + T   V  L  G
Sbjct: 7787 VINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW-QTVDTTVKDTKCTVTPLTEG 7845

Query: 938  ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV---------- 987
            +  +FRV A N  G        + V  ++    P       +    ++ V          
Sbjct: 7846 SLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKND 7905

Query: 988  -GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP----TDTILFIRAARRVHSGT 1042
             G P+   +  + K R    W K G+  AG + + R +     T+    +RA      G 
Sbjct: 7906 GGRPIQRYV-IEKKERLGTRWVKAGKT-AGPDCNFRVTDVIEGTEVQFQVRAENEAGVGH 7963

Query: 1043 YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
                  I ++ED  +        PSPP DL VTDA   ++A+ WKPP+  G + + GY V
Sbjct: 7964 PSEPTEILSIEDPTS-------PPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHV 8016

Query: 1103 QKADKKTMEWFTVLEH------YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKE 1156
            +     T +W  V         ++    VVP+      Y  RV + N +G S       E
Sbjct: 8017 EMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPD----KEYVLRVRAVNAIGVS-------E 8065

Query: 1157 PVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216
            P  I    +  +P     +D       T  ++   VI G    +    R  P P +SW K
Sbjct: 8066 PSEISENVVAKDPDCKPTIDLE-----THDII---VIEGEKLSIPVPFRAVPVPTVSWHK 8117

Query: 1217 NGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
            +G ++    R  M +      LE+ K    D GIY     N  G A     ++V
Sbjct: 8118 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 8171



 Score =  151 bits (381), Expect = 4e-36
 Identities = 127/445 (28%), Positives = 198/445 (44%), Gaps = 36/445 (8%)

Query: 750   TVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILE 809
             T  + +P+    V +     + P AP  P I+ V +DSC V W+PPA DGG  I  Y LE
Sbjct: 24498 TFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLE 24557

Query: 810   RKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPF----- 864
             +++KK  +W+ +  + I+E     + +IEG+ YE RV   N  G S  S  S+P      
Sbjct: 24558 KREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSD 24617

Query: 865   MPIGPP---SEPTHLAVEDVSDTTVSLK-WRPPERVGAGGLDGYSVEYCPEGCSEWVAAL 920
             +PI  P    E  +L V   S+ T+  K    P+ +      G   E   +G    +   
Sbjct: 24618 VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQG--KEIIADGLKYRIQEF 24675

Query: 921   QGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLR 980
             +G   +  +++  +      +++VRA N  G      +       E+    ++ LP+ L 
Sbjct: 24676 KG--GYHQLIIASVTDDDATVYQVRATNQGG------SVSGTASLEVEVPAKIHLPKTLE 24727

Query: 981   --QTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE----EVSIRNSPTDTILFIRA 1034
                 +    GE V++ IPF GKP P +TW K GQ L       +V +  S T +++F   
Sbjct: 24728 GMGAVHALRGEVVSIKIPFSGKPDPVITWQK-GQDLIDNNGHYQVIVTRSFT-SLVFPNG 24785

Query: 1035  ARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGN 1094
               R  +G Y V  +     D+ T+ L V D P PP+ ++V+D    +V L W  P   G 
Sbjct: 24786 VERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGG 24845

Query: 1095  TELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATT 1154
             +++  Y V+K       W  V    R T   V  L     Y FRV ++N  G S      
Sbjct: 24846 SKITNYIVEKCATTAERWLRV-GQARETRYTVINLFGKTSYQFRVIAENKFGLS------ 24898

Query: 1155  KEPVFIPRPGITYEPPNYKALDFSE 1179
              +P     P IT E    +A+++ E
Sbjct: 24899 -KPSEPSEPTITKEDKT-RAMNYDE 24921



 Score =  144 bits (364), Expect = 4e-34
 Identities = 106/366 (28%), Positives = 162/366 (44%), Gaps = 48/366 (13%)

Query: 640   PRQEPPKI--------HLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGN 691
             PR+  P I         LD  G     ++  AG+ +++++P+ G P PTV W+K      
Sbjct: 14743 PRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKK------ 14796

Query: 692   KAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTV 751
                           GD        ++L +T+ RV  ETT   +I  +    + D G Y +
Sbjct: 14797 --------------GD--------QILKQTQ-RVNFETTATSTILNINECVRSDSGPYPL 14833

Query: 752   TVKNPVGEDQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
             T +N VGE    +T++V D+P  P  P K   V  D  T  W+PP  DGG PI  Y++E 
Sbjct: 14834 TARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEM 14893

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFM 865
             ++  S  W+ L   +I+  +++A R+  G+ Y+ RV A N  G+     S    A+ PF 
Sbjct: 14894 RQTDSTTWVELATTVIRT-TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFK 14952

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
               GPP  P    V  V+  ++++ W  P   G   + GY VE        W    + L  
Sbjct: 14953 VPGPPGTPQ---VTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVP 15009

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHL-RQTIQ 984
                     L  G    FRV A NMAG   P   +EP+   + +  P   +P ++ R T+ 
Sbjct: 15010 GNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVT 15069

Query: 985   KKVGEP 990
              K  +P
Sbjct: 15070 LKWAKP 15075



 Score =  142 bits (357), Expect = 3e-33
 Identities = 105/345 (30%), Positives = 153/345 (44%), Gaps = 43/345 (12%)

Query: 635   KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNK-LRLDVPISGDPAPTVIWQKAITQGNKA 693
             +I  V R +     LD  G +PD   +   N   RL +PI G PAP+V W+K        
Sbjct: 13663 EITVVARDDVVAPDLDLKG-LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG------- 13714

Query: 694   PARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
                      ED                T+ RV VE++   +   V   +K D G YT+T+
Sbjct: 13715 ---------EDP-------------LATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITL 13752

Query: 754   KNPVGEDQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             KN  G  +  +++KV+  P  P  P K   V  ++ T++W PP  DGG  I  YILE++ 
Sbjct: 13753 KNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRD 13812

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPF-MP 866
               + +W+      +Q+ +    R+ EG+ Y  RV A N  G+     S P  A  PF +P
Sbjct: 13813 SVNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 13871

Query: 867   IGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH 926
               PP  P ++   DV   +VSL W  P++ G   + GY +E+       W  A +     
Sbjct: 13872 DAPP--PPNIV--DVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRM 13927

Query: 927   TSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
                 V  L  G    FRV A N+AG G P   +EPV   + +  P
Sbjct: 13928 RDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 13972



 Score =  140 bits (352), Expect = 1e-32
 Identities = 120/428 (28%), Positives = 177/428 (41%), Gaps = 58/428 (13%)

Query: 375  VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY 434
            V+ G       EL+  D  V+W   G++++ S  K +  S G   TLT+    L D    
Sbjct: 5902 VTAGETATFDCELSYEDIPVEWYLKGKKLEPS-DKVVPRSEGKVHTLTLRDVKLEDAGEV 5960

Query: 435  QCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELT 494
            Q      K    LFVKEPPV  T+PLEDQ V  G     ECEVS E A+VKW K+G E+ 
Sbjct: 5961 QLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEIL 6020

Query: 495  REETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADL 554
            + +  KY    DG+   L+I++   ED   Y       +    L V    +E  + + DL
Sbjct: 6021 KSK--KYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDL 6078

Query: 555  MVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
             V  K+ A F+CE+S EN +  W K+G E+    +  +   G V  L I+     DEA+Y
Sbjct: 6079 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6138

Query: 615  SFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPIS 674
            S   E      S  L  +E +  F                    I V   + ++L   +S
Sbjct: 6139 SC--EVRTARTSGMLTVLEEEAVFTKNLA--------------NIEVSETDTIKLVCEVS 6182

Query: 675  GDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRS 734
              P   VIW K                    GD +        + ET GR  + T   + 
Sbjct: 6183 -KPGAEVIWYK--------------------GDEE--------IIET-GRYEILTEGRKR 6212

Query: 735  IFTVEGAEKEDEGVYTVTVKNPVGEDQV---NLTVKVIDVP------DAPAAPKISNVGE 785
            I  ++ A  ED G Y   + +   + +V    L  + I  P      +   A  + ++ +
Sbjct: 6213 ILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISK 6272

Query: 786  DSCTVQWE 793
            +S  VQW+
Sbjct: 6273 ESFPVQWK 6280



 Score =  137 bits (345), Expect = 7e-32
 Identities = 127/511 (24%), Positives = 201/511 (39%), Gaps = 87/511 (17%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             + P   LD   +  D IVV AG    L+  I G P P V+W K                 
Sbjct: 18398 DAPNASLD--PKYKDVIVVHAGETFVLEADIRGKPIPDVVWSK----------------- 18438

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D K L ET  R+ +++T  ++   V+   + D G Y + + N  G   +
Sbjct: 18439 -----------DGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSI 18487

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              +TVKV+D P  P  P K++ V  + C + W PP  DGG  I  YI+E+++     W ++
Sbjct: 18488 PITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQV 18547

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFMPIGPPSEPTHL 876
             + + +Q L+++  +++ G  Y  RV AVN  G+     S P  A  P+ P GPPS P   
Sbjct: 18548 STE-VQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTP--- 18603

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V  ++  ++ + W  P   G   ++GY +E   +    W    +       + V  L  
Sbjct: 18604 EVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTE 18663

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G    FRV A N AG G P   +      + L  P                G P N  + 
Sbjct: 18664 GHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP----------------GPPSNPKVT 18707

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM 1052
                +    + W+K     G P+ G  V ++ +  D          +    + VT   EN 
Sbjct: 18708 DTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENT 18767

Query: 1053  E--------------DKATLVLQVV--DKPSPPQ-----------DLRVTDAWGLNVALE 1085
             E              + ATL   VV  ++  PP+            LR +    L V ++
Sbjct: 18768 EYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIK 18827

Query: 1086  WKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
              +P  +V   +  G    +A  +    FT+L
Sbjct: 18828 GRPEPEVKWEKAEGILTDRAQIEVTSSFTML 18858



 Score =  135 bits (340), Expect = 2e-31
 Identities = 215/933 (23%), Positives = 349/933 (37%), Gaps = 118/933 (12%)

Query: 378  GHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV 437
            G  +    EL     EV+WL+N   + + G K+   S G    L I      D   Y+ +
Sbjct: 6621 GADVVFLAELNKDKVEVQWLRNNMVV-VQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI 6679

Query: 438  VGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSE-EGAQVKWLKDGVELTRE 496
               ++   +L +   P + T   +D +V VG+ +           A+ +W K+   L+ +
Sbjct: 6680 AKDKEARAKLELAAAPKIKTAD-QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK 6738

Query: 497  ETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMV 556
                       ++    I EA   D G Y +        AE  +  K ++V   + +L V
Sbjct: 6739 T-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEV 6793

Query: 557  GAKDQAVFKCEVSDENVRGVW---LKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
                      E  D  V   W   L +G   +    ++   I R   +   D   + E  
Sbjct: 6794 ---------TETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFT 6844

Query: 614  YSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPI 673
             + + +G       +  F     + V   EP  +  D P        V A +K   DVP 
Sbjct: 6845 VTGLQKG-----GVEYLFRVSARNRVGTGEP--VETDNP--------VEARSKY--DVP- 6886

Query: 674  SGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSD--EWVFDKK----LLCETEGRVRV 727
             G P    I     T  N+       + PE  G ++   +V + +    +  +T   VR 
Sbjct: 6887 -GPPLNVTI-----TDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRA 6940

Query: 728  ETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLT---VKVIDVPDAPAAP---KIS 781
            E         VEG E      + V  +N +G  + +     VKV D  + P+ P     S
Sbjct: 6941 EDLSATVTDVVEGQEYS----FRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSS 6996

Query: 782  NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
            +  + S  ++WEPP  DGG PILGYI+ER ++    W+R N  L+ EL+++   + +G  
Sbjct: 6997 DQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNK 7056

Query: 842  YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGA-GG 900
            Y  RV A N  G+S PS    P        EPT     D+S     L+   P  +     
Sbjct: 7057 YLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM----DLSAFKDGLEVIVPNPITILVP 7112

Query: 901  LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960
              GY     P   + W    + L     + +K L   A L+      +  G         
Sbjct: 7113 STGY-----PRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENR 7167

Query: 961  PVTVQ-----EILQRPRLQLPRHLR-------------QTIQKKVGEPVNLLIPFQGKPR 1002
              T+       ++ RP    P+ L+             +      G P+   +  + +  
Sbjct: 7168 VKTISGEIDVNVIARP--SAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYV-VEKREV 7224

Query: 1003 PQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE--NMEDKATLVL 1060
             + TWTK    +   E ++ +         +   R   G  +     E  NM   AT+  
Sbjct: 7225 SRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATV-- 7282

Query: 1061 QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
                 P PP++++  D    ++ L W PP++ G + + GY V++  + + +W    E   
Sbjct: 7283 -----PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVA 7337

Query: 1121 RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
             T   V  L  G  Y +RV + N  G S  +  T+E                +A+D  EA
Sbjct: 7338 ETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE---------------IQAVDTQEA 7382

Query: 1181 PSF---TQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
            P      + L   +V AG    L   V G P+PKI+W K  + L +D R  + +     T
Sbjct: 7383 PEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST 7442

Query: 1238 LEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
            + I      D G Y+  A N+ G A     + V
Sbjct: 7443 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score =  134 bits (338), Expect = 4e-31
 Identities = 121/458 (26%), Positives = 200/458 (43%), Gaps = 38/458 (8%)

Query: 708   SDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVK 767
             +D+WV   K         ++ TT    ++TV G   + E  + +  +N VG  + +   +
Sbjct: 24068 TDKWVRHNK--------TQITTT----MYTVTGLVPDAEYQFRIIAQNDVGLSETSPASE 24115

Query: 768   VI------DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              +      D P  P   +I ++ +DS T+QWE P  DGG+ ILGY +E ++     W + 
Sbjct: 24116 PVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKS 24175

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
             N + I++       ++E   YE RV+A N  G+SRP   +          E   +  E +
Sbjct: 24176 NKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKE-M 24234

Query: 882   SDTTVSLKWRPPERVGAGGLDGYSVEYCPEG-----CSEWVAALQGLTEHTSILVKDLPT 936
              D T  L           G     +++   G       ++  +  G T   +++ ++   
Sbjct: 24235 KDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQED 24294

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
                 ++   A N  G    V T+  + +Q     P+      L++     VG  + L + 
Sbjct: 24295 EG--VYTCIATNEVGE---VETSSKLLLQAT---PQFHPGYPLKEKYYGAVGSTLRLHVM 24346

Query: 997   FQGKPRPQVTWTKEGQPLA--GEEVSIRNSPTDTILFIR-AARRVHSGTYQVTVRIENME 1053
             + G+P P +TW   GQ L    E ++I N+   T L ++   R+ H+G Y+V +      
Sbjct: 24347 YIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGT 24405

Query: 1054  DKATLVLQVVDKPSPPQDLRVTDAWGLNVA-LEWKPPQDVGNTELWGYTVQKAD-KKTME 1111
               A L +++ DKP  P    V +A   N A + WKPP D G + +  Y V+K + K+  E
Sbjct: 24406 VDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAE 24465

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             W  V      T C +  L    GYYFRV +QN  G SD
Sbjct: 24466 WQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD 24503



 Score =  134 bits (337), Expect = 6e-31
 Identities = 115/412 (27%), Positives = 167/412 (40%), Gaps = 57/412 (13%)

Query: 654   RIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVF 713
             ++   + V AG+ +RL+  + G P P V W K              DA + T        
Sbjct: 11901 KLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKD------------KDATDLTRSP----- 11943

Query: 714   DKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPD 773
                       RV+++T  D S F++  A++ D G Y VT  N  G      TV V+D P 
Sbjct: 11944 ----------RVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPG 11993

Query: 774   APAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEA 833
                  KI +V  D CTV W+PP  DGG  I  YILE+ + K   W   +  ++       
Sbjct: 11994 PVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTP-GTTV 12052

Query: 834   RRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKW 890
              R+IEG  Y  RV A N IG   P+  S+P +       P  P    V  VS   +++ W
Sbjct: 12053 TRLIEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVW 12111

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
              PPE  G   + GY +E   +  + WV   +       + V++L       FRV+A N  
Sbjct: 12112 NPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEI 12171

Query: 951   GPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE 1010
             G G P   + PV  ++ ++ P                G P N  +    K    + W K 
Sbjct: 12172 GIGEPSLPSRPVVAKDPIEPP----------------GPPTNFRVVDTTKHSITLGWGKP 12215

Query: 1011  ----GQPLAGEEVSIR-----NSPTDTILFIRAARRVHSGTYQVTVRIENME 1053
                 G P+ G  V +R      SP +      AA ++    + VT   EN E
Sbjct: 12216 VYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQE 12267



 Score =  132 bits (333), Expect = 2e-30
 Identities = 101/340 (29%), Positives = 154/340 (45%), Gaps = 19/340 (5%)

Query: 649  LDCPGRIPDT-IVVVAGNKLRLDVPISGDPAPTVIWQKA--ITQGNKAPARPAPDAPEDT 705
            +D P  I  T + V  G+++ LD  ISG P PT+ W K   +    +   R AP      
Sbjct: 8373 IDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRK 8432

Query: 706  GDSDEWVFDKKLLCETEGRVRVETTKD-RSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNL 764
            G+  E   ++  +     R+ ++ +K   S   V  + + D G+Y + V+N  G  +   
Sbjct: 8433 GEVQE---EEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPC 8489

Query: 765  TVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER--KKKKSYRWMRLN 822
            TV V+D P  P      ++ + S   +WEPP  DGG  I+ Y LE+  K K    W+ + 
Sbjct: 8490 TVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT 8549

Query: 823  FDLIQELSHEARRMIEGVVYEMRVYAVNAIG-----MSRPSPASQPFMPIGPPSEPTHLA 877
               ++   +   ++IEG  Y  RV A N  G     +S+P  A  PF   GPP  P    
Sbjct: 8550 -STLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPF---GPPDAPDKPI 8605

Query: 878  VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
            VEDV+  ++ +KW  P+  G+  L GY +E      + W    + L       V  L  G
Sbjct: 8606 VEDVTSNSMLVKWNEPKDNGSPIL-GYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEG 8664

Query: 938  ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPR 977
               +FRV A N AGPG     ++P T  + +  P   +PR
Sbjct: 8665 LTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPR 8704



 Score =  132 bits (331), Expect = 3e-30
 Identities = 116/487 (23%), Positives = 193/487 (39%), Gaps = 56/487 (11%)

Query: 547   VYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDD 605
             + + + D+     + A   C++    +  + W + GKEL+   + K+S  GR H LT+  
Sbjct: 24230 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 24289

Query: 606   VTPADEADYSFVP--EGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVA 663
                 DE  Y+ +   E      S+KL            Q  P+ H   P  + +      
Sbjct: 24290 EEQEDEGVYTCIATNEVGEVETSSKLLL----------QATPQFHPGYP--LKEKYYGAV 24337

Query: 664   GNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEG 723
             G+ LRL V   G P P + W                             F  + L +   
Sbjct: 24338 GSTLRLHVMYIGRPVPAMTW-----------------------------FHGQKLLQNSE 24368

Query: 724   RVRVETTKDRSIFTVEGAEKEDE-GVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP-KIS 781
              + +E T+  +   ++  +++   G Y V + N  G     L V++ D PD P  P  I 
Sbjct: 24369 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIE 24428

Query: 782   NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
              + ++S  + W+PPA DGG  I  Y++E+ + K     +L    I   +     + E   
Sbjct: 24429 ALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAG 24488

Query: 842   YEMRVYAVNAIGMSRPSPAS------QPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPER 895
             Y  RV A N  G+S P   S       PF   G P +PT  AV    D+ V + W+PP  
Sbjct: 24489 YYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAV--TKDSCV-VAWKPPAS 24545

Query: 896   VGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAP 955
              G   +  Y +E   +  ++W++        T   VK+L  G    FRV+  N+ G    
Sbjct: 24546 DGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEW 24605

Query: 956   VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
                +EP+T +  +          LR  +  +      L+    G P+P V W ++G+ + 
Sbjct: 24606 SEISEPITPKSDVPIQAPHFKEELR-NLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII 24664

Query: 1016  GEEVSIR 1022
              + +  R
Sbjct: 24665 ADGLKYR 24671



 Score =  131 bits (329), Expect = 5e-30
 Identities = 95/310 (30%), Positives = 133/310 (42%), Gaps = 39/310 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             +T  V+AG  L++DVP  G P P V W K                            D  
Sbjct: 15850 NTFTVLAGEDLKVDVPFIGRPTPAVTWHK----------------------------DNV 15881

Query: 717   LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPA 776
              L +T  RV  E+T++ S+ T++ A +ED G Y V + N  GE    L V V+D P  P 
Sbjct: 15882 PLKQTT-RVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPT 15940

Query: 777   AP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
              P K+  V  DS T+ W PP YDGG  I  YI+E++   +  W  ++   +   + +A R
Sbjct: 15941 GPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSAT-VARTTIKACR 15999

Query: 836   MIEGVVYEMRVYAVNAIGMS-----RPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKW 890
             +  G  Y+ R+ A N  G S      P+ A  PF   GPP  P    V   S  ++ ++W
Sbjct: 16000 LKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPV---VTLSSRDSMEVQW 16056

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
               P   G   + GY +E        WV   +     T      L  G    FRV A N+ 
Sbjct: 16057 NEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIV 16116

Query: 951   GPGAPVTTTE 960
             G G P   +E
Sbjct: 16117 GIGKPSKVSE 16126



 Score =  130 bits (328), Expect = 6e-30
 Identities = 94/317 (29%), Positives = 141/317 (44%), Gaps = 37/317 (11%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             +PP+I +D   +  DTIVV AG   ++D  I G P PT+ W K                 
Sbjct: 16234 DPPRISMD--PKYKDTIVVHAGESFKVDADIYGKPIPTIQWIK----------------- 16274

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                GD +              R+ +++T   +  +V+ A + D G Y +  KN  GE  V
Sbjct: 16275 ---GDQE---------LSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSV 16322

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              + VKV+D P  P  P  IS V  + CT+ W+PP  DGG  I+ YI+ER++     W  +
Sbjct: 16323 TVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV 16382

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGP---PSEPTHLAV 878
             + + +Q LS +  +++EG  Y  R+ AVN  G+  P   S+P +   P   P  P    V
Sbjct: 16383 DAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPL-ESEPVVAKNPFVVPDAPKAPEV 16440

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
               V+  ++ + W  P   G   + GY +E   +    W    + L     + V  L    
Sbjct: 16441 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 16500

Query: 939   RLLFRVRAHNMAGPGAP 955
                FRV A N AG   P
Sbjct: 16501 DYEFRVSAENAAGLSEP 16517



 Score =  128 bits (321), Expect = 4e-29
 Identities = 99/421 (23%), Positives = 172/421 (40%), Gaps = 64/421 (15%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP+I L     +   + V AG  + LD  + G P PTV W+K                  
Sbjct: 12987 PPRIDLSVA--MKSLLTVKAGTNVCLDATVFGKPMPTVSWKK------------------ 13026

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE--GAEKEDEGVYTVTVKNPVGEDQ 761
                       D  LL   EG   ++    R++ T+E     ++D G YT+T +N  G   
Sbjct: 13027 ----------DGTLLKPAEG---IKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKS 13073

Query: 762   VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
               + +KV+D P  PA+ KI+ +  D   + WEPP  DGG  I  YI+++++     W ++
Sbjct: 13074 ATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQV 13133

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFMPIGPPSEPTHL 876
             +   +   S    ++IEG  Y+ R+ A N  G+     + P+ A  P+ P G    P   
Sbjct: 13134 S-ATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPP--- 13189

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              + +++   +++ W+PP   G   + GY +E        W    +      ++    L  
Sbjct: 13190 VISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQE 13249

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G    FRV A N AGPG P   ++    ++    P                G P    + 
Sbjct: 13250 GTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP----------------GPPAFPKVY 13293

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM 1052
                +    ++W K     G P+ G  V ++ + +D  +     + +    ++VT  +E+ 
Sbjct: 13294 DTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDT 13353

Query: 1053  E 1053
             +
Sbjct: 13354 Q 13354



 Score =  127 bits (320), Expect = 5e-29
 Identities = 107/389 (27%), Positives = 163/389 (41%), Gaps = 50/389 (12%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
            F K LE    V +G    L  E++  +A+VKW KNG EI +   KY   + G  R L I 
Sbjct: 5982 FTKPLEDQ-TVEEGATAVLECEVSRENAKVKWFKNGTEI-LKSKKYEIVADGRVRKLVIH 6039

Query: 425  QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
             C+  D   Y C     K S  L V  P V   RPL D  V   +   FECE+S E A+V
Sbjct: 6040 DCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKV 6099

Query: 485  KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
            KW KDG E+ + +  KY     G    L+IN+ +L+D   Y+      +    L V E++
Sbjct: 6100 KWFKDGAEIKKGK--KYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEE 6157

Query: 545  LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
                +++A++ V   D     CEVS      +W K  +E++   R ++   GR   L I 
Sbjct: 6158 AVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQ 6217

Query: 605  DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAG 664
            +    D  +Y+        +   K+H  E+  +F+ +              P  + ++ G
Sbjct: 6218 NAHLEDAGNYNCRLPSSRTDGKVKVH--ELAAEFISK--------------PQNLEILEG 6261

Query: 665  NKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGR 724
             K      IS +  P V W++              D   ++GD  + + D        G+
Sbjct: 6262 EKAEFVCSISKESFP-VQWKR-------------DDKTLESGDKYDVIAD--------GK 6299

Query: 725  VRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
             RV   KD ++        +D G Y V V
Sbjct: 6300 KRVLVVKDATL--------QDMGTYVVMV 6320



 Score =  127 bits (318), Expect = 9e-29
 Identities = 91/356 (25%), Positives = 152/356 (42%), Gaps = 39/356 (10%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P+I +D   R  DTIVV AG   RL+  + G P PT+ W +                 
Sbjct: 17316 ELPRISMDPKFR--DTIVVNAGETFRLEADVHGKPLPTIEWLRG---------------- 17357

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        DK++  E   R  ++ T  +++  V+ A + D G Y +   N  G    
Sbjct: 17358 -----------DKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSF 17404

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              + VKV+D P  P  P +++ V  + C++ W PP  DGG  I  Y++E+++     W  +
Sbjct: 17405 PVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVV 17464

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM--PIGPPSEPTHLAVE 879
               +++   S +  +++EG  Y  R+ AVN  G+  P  ++   M  P   P  P  L V 
Sbjct: 17465 ASEVVTN-SLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVT 17523

Query: 880   DVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
             +++  ++++ W  P+  G   + GY VE        W+   +       + V  L     
Sbjct: 17524 NIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHE 17583

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV----GEPV 991
               FRV A N AG G P   T      + + +P      H+  T +  +    G+P+
Sbjct: 17584 YEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPI 17639



 Score =  127 bits (318), Expect = 9e-29
 Identities = 97/336 (28%), Positives = 144/336 (42%), Gaps = 38/336 (11%)

Query: 640   PRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAP 699
             P+ EP     D  G     I   AG+   +DVPISG PAP V W+               
Sbjct: 22336 PQIEPTA---DLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK--------------- 22377

Query: 700   DAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
                           ++  L ET+ RV + TTKDR+  TV+ + + D G Y +T++N  G 
Sbjct: 22378 -------------LEEMRLKETD-RVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGV 22423

Query: 760   DQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRW 818
                ++TV VI  P     P ++S+V  +SC + W  P   GG  I  YI+E+++  +  W
Sbjct: 22424 KTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAW 22483

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTH 875
               +N   ++    +   + + + Y  RV + N  G+S+P   S P +   P  PPS PT 
Sbjct: 22484 QLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPFVPPSAPTR 22541

Query: 876   LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLP 935
               V  VS   +S++W  P   G   + GY VE        WV   +      +  V  L 
Sbjct: 22542 PEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLV 22601

Query: 936   TGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
              G    FR  A N AG       + P+  Q  +  P
Sbjct: 22602 EGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAP 22637



 Score =  124 bits (312), Expect = 4e-28
 Identities = 103/421 (24%), Positives = 167/421 (39%), Gaps = 57/421 (13%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E PKI +D   +  DT+++ AG   RL+  +SG P PT+ W K                 
Sbjct: 15152 EAPKIKVDV--KFKDTVILKAGEAFRLEADVSGRPPPTMEWSK----------------- 15192

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D K L E   ++ ++     +    + + + D G YT+T  NP G  + 
Sbjct: 15193 -----------DGKEL-EGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKH 15240

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                VKV+D P  P  P  ++ V  + C + W PP  DGG  I  YI+++++     W  +
Sbjct: 15241 IFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV 15300

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAV 878
               + +Q    +  ++++G  Y  RV AVN  G+  P   S+P +   P GPP  P +  V
Sbjct: 15301 ASE-VQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPL-ESEPVLAVNPYGPPDPPKNPEV 15358

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
               ++  ++ + W  P+  G   +  Y VE   +    W+   +         V  L  G 
Sbjct: 15359 TTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGH 15418

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
                FR+ A N AG  AP  T+      + + +P                G P N  +   
Sbjct: 15419 EYEFRIMAENAAGISAPSPTSPFYKACDTVFKP----------------GPPGNPRVLDT 15462

Query: 999   GKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMED 1054
              +    + W K     G  + G  V I     D    +     + + +Y +T   EN E 
Sbjct: 15463 SRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEY 15522

Query: 1055  K 1055
             K
Sbjct: 15523 K 15523



 Score =  123 bits (309), Expect = 1e-27
 Identities = 133/548 (24%), Positives = 211/548 (38%), Gaps = 60/548 (10%)

Query: 739   EGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID------VPDAPAAPKISNVGEDSCTVQW 792
             EG E E    Y V  +N  G    + T  +I       +P  P+ PKI + G+ + T+ W
Sbjct: 19744 EGCEYE----YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAW 19799

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
               P +DGG PI GY +E KK     W + +   ++   +    +  G  Y  RV +VN +
Sbjct: 19800 VKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKV 19858

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDT-----------TVSLKWRPPERV--GAG 899
             G S PS +S P +      EP      ++  T           TV  + RP   V     
Sbjct: 19859 GASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKP 19918

Query: 900   GLDGYSVEYCPEGCSEWVAALQGLTEHTS----ILVKDLPTGARLLFRVRAHNMAGPGAP 955
               D  +  Y     S     ++    + S    + ++++ + A L   V+  +  GP   
Sbjct: 19919 DTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTN 19978

Query: 956   VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
             +T  +      +L      +P       +   G PV      + +   +  W        
Sbjct: 19979 ITVQDVTKESAVLS---WDVP-------ENDGGAPVKNY-HIEKREASKKAWVSVTNNCN 20027

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVT 1075
                  + N     I + R +     G   V +  E  E      +++ +KPSPP+ L VT
Sbjct: 20028 RLSYKVTNLQEGAIYYFRVSGENEFG---VGIPAETKEG-----VKITEKPSPPEKLGVT 20079

Query: 1076  DAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGY 1135
                  +V+L W  P+  G + +  Y V+  +K    W       + TH VV  L   + Y
Sbjct: 20080 SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVA-KSTHHVVSGLRENSEY 20138

Query: 1136  YFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAG 1195
             +FRVF++N  G SD       PV I       EPP    +D    PS T       V AG
Sbjct: 20139 FFRVFAENQAGLSDPRELLL-PVLIKEQ---LEPPE---IDMKNFPSHTV-----YVRAG 20186

Query: 1196  YTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRA 1255
                 +   + G P PK++  ++G+ L    RF        LT+ +++    D G Y   A
Sbjct: 20187 SNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITA 20246

Query: 1256  TNLQGEAR 1263
              N  G  +
Sbjct: 20247 ANSSGTTK 20254



 Score =  121 bits (304), Expect = 4e-27
 Identities = 84/310 (27%), Positives = 131/310 (42%), Gaps = 39/310 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             +T  + AG  L++++P+ G P P + W K                            D +
Sbjct: 18014 NTYSIQAGEDLKIEIPVIGRPRPNISWVK----------------------------DGE 18045

Query: 717   LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPA 776
              L +T  RV VE T   ++  ++   K+D G YTVT  N  G    NL+V V++ P  P 
Sbjct: 18046 PLKQTT-RVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPV 18104

Query: 777   AP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
              P +   V  D   + WEPPAY GG  I  YI+E++   +  W  ++   +   + +  +
Sbjct: 18105 GPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSAT-VARTTIKITK 18163

Query: 836   MIEGVVYEMRVYAVNAIGMSRPSPASQ-----PFMPIGPPSEPTHLAVEDVSDTTVSLKW 890
             +  G  Y+ R++A N  G S P  +       PF   GPP  P    V  +S   + ++W
Sbjct: 18164 LKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPF---VTSISKDQMLVQW 18220

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
               P   G   + GY +E   +    WV   +   + T      L  G    F+V A N+ 
Sbjct: 18221 HEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIV 18280

Query: 951   GPGAPVTTTE 960
             G G P   +E
Sbjct: 18281 GIGKPSKVSE 18290



 Score =  121 bits (304), Expect = 4e-27
 Identities = 89/349 (25%), Positives = 156/349 (44%), Gaps = 15/349 (4%)

Query: 738   VEGAEKEDEGVYTVTVKNPVG-----EDQVNLTVKV-IDVPDAPA-APKISNVGEDSCTV 790
             V+G ++  E  + V+ +N  G     + +  +T K  ++ P+ P+  P++ +V + S ++
Sbjct: 23984 VKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSL 24043

Query: 791   QWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVN 850
              W  P  DGG  + GY +ERK+  + +W+R N   I    +    ++    Y+ R+ A N
Sbjct: 24044 SWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQN 24103

Query: 851   AIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVE 907
              +G+S  SPAS+P +   P   PS+P  L +  +S  +V+L+W  PE  G   + GY VE
Sbjct: 24104 DVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVE 24163

Query: 908   YCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEI 967
             Y   G S W  + +   +     +  L       FRV A N  G   P  T   ++++  
Sbjct: 24164 YRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTA--MSIKTK 24221

Query: 968   LQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPT 1026
             L        R   + +  K+GE   L     G+P P + W + G+ L    +  + +   
Sbjct: 24222 LTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGR 24281

Query: 1027  DTILFIRAARRVHSGTYQ--VTVRIENMEDKATLVLQVVDKPSPPQDLR 1073
                L +    +   G Y    T  +  +E  + L+LQ   +  P   L+
Sbjct: 24282 THTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLK 24330



 Score =  121 bits (303), Expect = 5e-27
 Identities = 99/388 (25%), Positives = 160/388 (41%), Gaps = 45/388 (11%)

Query: 480   EGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELI 539
             E  Q KW+    E  RE  F  +   +G  +   +    L     ++  +      +++ 
Sbjct: 24560 EKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVP 24619

Query: 540   VQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDS-RIKVSHI-G 596
             +Q    +  + + +L V  +  A   C+V+      V W + GKE++ D  + ++    G
Sbjct: 24620 IQAPHFK--EELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKG 24677

Query: 597   RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIP 656
               H+L I  VT  D   Y         ++S     +EV++       P KIHL       
Sbjct: 24678 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTAS-LEVEV-------PAKIHLPKTLEGM 24729

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
               +  + G  + + +P SG P P + WQK                              +
Sbjct: 24730 GAVHALRGEVVSIKIPFSGKPDPVITWQKG-----------------------------Q 24760

Query: 717   LLCETEGRVRVETTKD-RSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAP 775
              L +  G  +V  T+   S+    G E++D G Y V  KN  G DQ  + + V DVPD P
Sbjct: 24761 DLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 24820

Query: 776   AAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
                K+S+V  DS  + W  PA DGG  I  YI+E+    + RW+R+     +E  +    
Sbjct: 24821 RGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVG--QARETRYTVIN 24878

Query: 836   MIEGVVYEMRVYAVNAIGMSRPSPASQP 863
             +     Y+ RV A N  G+S+PS  S+P
Sbjct: 24879 LFGKTSYQFRVIAENKFGLSKPSEPSEP 24906



 Score =  120 bits (301), Expect = 8e-27
 Identities = 173/702 (24%), Positives = 278/702 (39%), Gaps = 103/702 (14%)

Query: 395  KWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPV 454
            KWLKNG EI+ S  K    +     +L I      D A Y  V G    +  L+V+   +
Sbjct: 2954 KWLKNGVEIK-STDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHI 3012

Query: 455  LITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLII 514
               + ++D  V+  +R  FECEVSE    V+W+KD  EL  + T + + +K+   H L+I
Sbjct: 3013 EFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRIKIQKEKYVHRLLI 3070

Query: 515  NEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVR 574
                + DAG Y +   G  + A+L V+ + + +     ++ V  K +AV + EV++++V 
Sbjct: 3071 PSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVD 3130

Query: 575  GVWLKNGKEL--VPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFM 632
              W K+G E+      R K     R+H++ I +   +D  +Y+FV      +++      
Sbjct: 3131 AHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL----- 3185

Query: 633  EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNK 692
                 +V   EPP++  +        + V +G   R    ISG P P + W K       
Sbjct: 3186 -----YVNAPEPPQVLQEL-----QPVTVQSGKPARFCAVISGRPQPKISWYK------- 3228

Query: 693  APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                            +E +      C+      +   ++ ++  +E A  ED  VYT  
Sbjct: 3229 ----------------EEQLLSTGFKCKF-----LHDGQEYTLLLIE-AFPEDAAVYTCE 3266

Query: 753  VKNPVG--EDQVNLTVKVIDV--PDAPA---APKISNVGEDSCTVQWEPPAY----DGGQ 801
             KN  G      +L+V+V +V  PD       P I    +D+ T + +P  +     G  
Sbjct: 3267 AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3326

Query: 802  PILGYILERKKKKSYRWMRLN--FDLIQELSHEARRMIEGVVYEMRVYAVNAIG-MSRPS 858
              + +  + KK K  R+ R+    D  Q    EA    EG        A NA+G +S  +
Sbjct: 3327 LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGT---YTFVASNAVGQVSSTA 3383

Query: 859  PASQPFMPIGPPSEPTHL-------AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPE 911
              S     +   S    +       AV D S T    K    E        G S EY   
Sbjct: 3384 NLSLEVQALDRQSSGKDVRESAKSQAVADSSFTKEESKISQKE---IKSFQGSSYEY--- 3437

Query: 912  GCSEWVAALQGLTE---HTSILVKD--LPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
                 V   + +++   HT+  V+D  L   A L     +  ++   A  +T E      
Sbjct: 3438 ----EVQVFESVSQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGE------ 3487

Query: 967  ILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPT 1026
                P++ L  HL Q +  K G+    L   +      VTWT EG  +  E   ++ S  
Sbjct: 3488 ---APKIFL--HL-QDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIE-ESERLKQSQN 3540

Query: 1027 DTILFIRA--ARRVHSGTYQVTVRIENMEDKATLVLQVVDKP 1066
              I F+     + V  G Y   V  +  E   + VL V   P
Sbjct: 3541 GNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAP 3582



 Score =  120 bits (301), Expect = 8e-27
 Identities = 94/330 (28%), Positives = 139/330 (42%), Gaps = 42/330 (12%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PPK  LD      D + + AG+ L LD  + G P P +IW K                  
Sbjct: 22738 PPKAELDARLH-GDLVTIRAGSDLVLDAAVGGKPEPKIIWTKG----------------- 22779

Query: 704   DTGDSDEWVFDKKL-LCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                       DK+L LCE   +V ++ T  R+   ++  ++ D G YT+TVKN  G   V
Sbjct: 22780 ----------DKELDLCE---KVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAV 22826

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
             ++ VKV+D P       +S V ++ CT+ W  P  DGG  I  YI+ER++     W+ + 
Sbjct: 22827 SVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVE 22886

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIG-----MSRPSPASQPFMPIGPPSEPTHLA 877
              +    LS+   R+I+   Y  RV AVN  G      S P  A   F    PP  P  + 
Sbjct: 22887 GE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVG 22945

Query: 878   VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH-TSILVKDLPT 936
                     + ++W  PE  G   +  Y V+   +    W    +    + T + V  L  
Sbjct: 22946 ---TGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 23002

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             G    FRV A N AG   P   +  ++ +E
Sbjct: 23003 GCDYQFRVTAVNAAGNSEPSEASNFISCRE 23032



 Score =  119 bits (298), Expect = 2e-26
 Identities = 80/274 (29%), Positives = 134/274 (48%), Gaps = 6/274 (2%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
            F  KL+    V K   I L  E++  DA VKW K+G+EI+ S +  I ++ G KR L + 
Sbjct: 5715 FTGKLQDYTGVEKDEVI-LQCEISKADAPVKWFKDGKEIKPSKNAVI-KADGKKRMLILK 5772

Query: 425  QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
            +   +D   Y C  G +K S +L +++  + + RPL    VM  +   FE E+SE+    
Sbjct: 5773 KALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHA 5832

Query: 485  KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
             W   G  L   +T     K++G+ H L+++   L+  G      +  ++ A L V+ + 
Sbjct: 5833 NWKLKGEALL--QTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRV 5890

Query: 545  LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
            + + + + D+ V A + A F CE+S E++   W   GK+L P  ++     G+VH LT+ 
Sbjct: 5891 IGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLR 5950

Query: 605  DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDF 638
            DV   D  +     + F  +  A L   E  ++F
Sbjct: 5951 DVKLEDAGEVQLTAKDFKTH--ANLFVKEPPVEF 5982



 Score =  119 bits (297), Expect = 2e-26
 Identities = 81/306 (26%), Positives = 131/306 (42%), Gaps = 39/306 (12%)

Query: 661   VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE 720
             V  G  L+++VPISG P PT+ W K                            D   L +
Sbjct: 16936 VQVGQDLKIEVPISGRPKPTITWTK----------------------------DGLPLKQ 16967

Query: 721   TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP-K 779
             T  R+ V  + D +  +++   K+D G Y +TV N VG+   ++ +  +D PD P  P K
Sbjct: 16968 TT-RINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVK 17026

Query: 780   ISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEG 839
               +V  +S T+ W PP Y GG  I  YI++++   +  W  ++   +   + +  ++  G
Sbjct: 17027 FDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLKTG 17085

Query: 840   VVYEMRVYAVNAIGMS-----RPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPE 894
               Y+ R++A N  G S      P  A  P+   GPP  P   A+   S  ++ ++W  P 
Sbjct: 17086 TEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAI---SKDSMVIQWHEPV 17142

Query: 895   RVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGA 954
               G   + GY +E        W    + +   T    ++L  G    FRV A N+ G G 
Sbjct: 17143 NNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGK 17202

Query: 955   PVTTTE 960
                 +E
Sbjct: 17203 ASKNSE 17208



 Score =  118 bits (295), Expect = 4e-26
 Identities = 86/275 (31%), Positives = 130/275 (47%), Gaps = 7/275 (2%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
            F  KL     V K  +I L  E++  D  VKW K+G+EI  S  KY  ++ G +R L I 
Sbjct: 5360 FTVKLHDKTAVEKD-EITLKCEVSK-DVPVKWFKDGEEIVPS-PKYSIKADGLRRILKIK 5416

Query: 425  QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
            +  L D   Y C  G +K    + V+   + + +PL    V VG+   FE E+SE     
Sbjct: 5417 KADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHG 5476

Query: 485  KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
            +W   G  LT     +    +DG++H LI++   L   G  +   +  ++ A L V+E  
Sbjct: 5477 QWKLKGQPLTASPDCE--IIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELP 5534

Query: 545  LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
            L     ++D+ V  KD+A F+CEVS E     WLK  +E+  D R ++   G  H + I 
Sbjct: 5535 LIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIK 5594

Query: 605  DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFV 639
                 DEA Y F  E    + S KL    +++ F+
Sbjct: 5595 SAAFEDEAKYMFEAED--KHTSGKLIIEGIRLKFL 5627



 Score =  117 bits (294), Expect = 5e-26
 Identities = 82/248 (33%), Positives = 119/248 (47%), Gaps = 8/248 (3%)

Query: 386  ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCST 445
            E++  +    WLKNG EI+MS  K+     G    L I   S  D A Y  V G ++ S 
Sbjct: 2858 EVSHFNVPSMWLKNGVEIEMS-EKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSA 2916

Query: 446  ELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKK 505
             L V   P++IT  L+D        + FE  V+ EG   KWLK+GVE+   +  + R KK
Sbjct: 2917 TLTVT--PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK 2974

Query: 506  DGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFK 565
                H L I      DA  Y        + A L V+ + +E  + I D+ V  K +A+F+
Sbjct: 2975 --LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFE 3032

Query: 566  CEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNL 625
            CEVS+ ++   W+K+ +EL    RIK+     VH+L I     +D   Y+ V  G   N+
Sbjct: 3033 CEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG---NV 3089

Query: 626  SAKLHFME 633
            S    F+E
Sbjct: 3090 STAKLFVE 3097



 Score =  117 bits (294), Expect = 5e-26
 Identities = 76/266 (28%), Positives = 117/266 (43%), Gaps = 7/266 (2%)

Query: 370  EPAY--QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCS 427
            +P Y  +V  G      +EL++ D   +W   GQ +  S    I E  G K  L +  C 
Sbjct: 5450 KPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIED-GKKHILILHNCQ 5508

Query: 428  LADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWL 487
            L             K +  L VKE P++   PL D  V      +FECEVS E    +WL
Sbjct: 5509 LGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWL 5568

Query: 488  KDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEV 547
            K   E+T ++ F+    KDG +H ++I  A  ED   Y           +LI++  +L+ 
Sbjct: 5569 KGTQEITGDDRFE--LIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKF 5626

Query: 548  YQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVT 607
               + D+    K+ AVF  E+S +N+R  W KN + L     + +   G+ H +T  D++
Sbjct: 5627 LTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLS 5686

Query: 608  PADEADYSFVPEGFACNLSAKLHFME 633
              D +      E    +  AKL  +E
Sbjct: 5687 IDDTSQIRV--EAMGMSSEAKLTVLE 5710



 Score =  115 bits (289), Expect = 2e-25
 Identities = 84/310 (27%), Positives = 138/310 (44%), Gaps = 12/310 (3%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKR 419
            K+   F ++L+      K        E ++   +VKW K+G E+   G KY   S     
Sbjct: 2125 KQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVH-EGDKYRMHSDRKVH 2183

Query: 420  TLTISQCSLADDAAYQCVVGGE---KCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECE 476
             L+I     +D   Y CV+  +   K + +L V+   V   + L+D  V      E EC 
Sbjct: 2184 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 477  VSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALA 536
            VS E  + KW  + VEL  +   KY       R +L + +   ED G Y+    G +   
Sbjct: 2244 VSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTC 2301

Query: 537  ELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIG 596
            +L ++ + + + Q ++D  V   D    + +VS E+V GVW+K+G+E+ P  R+ +    
Sbjct: 2302 KLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDK 2361

Query: 597  RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQ-----EPPKIHLDC 651
            + H L I+D+T  D  +YSF       + S ++    V +   P +     E  K  L+C
Sbjct: 2362 QSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV-ITPLKDVNVIEGTKAVLEC 2420

Query: 652  PGRIPDTIVV 661
               +PD   V
Sbjct: 2421 KVSVPDVTSV 2430



 Score =  114 bits (285), Expect = 6e-25
 Identities = 99/408 (24%), Positives = 161/408 (39%), Gaps = 59/408 (14%)

Query: 649   LDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDS 708
             +D P    + +   AG  ++L   ISG PAPT+ W K                       
Sbjct: 20567 IDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKD---------------------- 20604

Query: 709   DEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
                  DK+L  +T   V VE T D +   ++ A++ + G Y + ++N +G     + V++
Sbjct: 20605 -----DKEL--QTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQI 20657

Query: 769   IDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQ 827
             +D P  P  P +   V  +  T+ W PPA DGG  I  YI+E+++     W  ++ + ++
Sbjct: 20658 LDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVS-EHLE 20716

Query: 828   ELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP-----ASQPFMPIGPPSEPTHLAVEDVS 882
             E      ++I+G  Y  RV AVN  G+  P       A   F+  GPP  P    V  ++
Sbjct: 20717 ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIP---EVTKIT 20773

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
               ++++ W  P   G   + GY +E   +    W   L+     T   V  L   +   +
Sbjct: 20774 KNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQY 20833

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV A N AG G     +E     + +  P                G P  + I    K  
Sbjct: 20834 RVCAVNAAGQGPFSEPSEFYKAADPIDPP----------------GPPAKIRIADSTKSS 20877

Query: 1003  PQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT 1046
               + W+K     G  + G  V IR    +    +     V +  Y V+
Sbjct: 20878 ITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVS 20925



 Score =  112 bits (281), Expect = 2e-24
 Identities = 106/428 (24%), Positives = 172/428 (40%), Gaps = 58/428 (13%)

Query: 867   IGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
             IG P+ P   L  +D+   +V + WRPP   G   + GY +E      + W   +     
Sbjct: 23920 IGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYT-IDSRVR 23978

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
              TS++VK L       FRV A N  G   P+ + EPVT +  L  P  + P +  + +  
Sbjct: 23979 GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPP--EPPSNPPEVLDV 24036

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAAR-RVHS 1040
                           K    ++W++     G  + G  +  + + TD   ++R  + ++ +
Sbjct: 24037 T-------------KSSVSLSWSRPKDDGGSRVTGYYIERKETSTDK--WVRHNKTQITT 24081

Query: 1041  GTYQVTVRIENMEDKATLVLQ-------------------VVDKPSPPQDLRVTDAWGLN 1081
               Y VT  + + E +  ++ Q                     DKPS P +L +      +
Sbjct: 24082 TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDS 24141

Query: 1082  VALEWKPPQDVGNTELWGYTVQKADKKTMEWF-TVLEHYRRTHCVVPELIIGNGYYFRVF 1140
             V L+W+ P+  G  E+ GY V+        W  +  E  +     +  L+    Y FRVF
Sbjct: 24142 VTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVF 24201

Query: 1141  SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200
             ++N  G S             RP  T      K L   EAP   + + + +   G  A L
Sbjct: 24202 AENETGLS-------------RPRRTAMSIKTK-LTSGEAPGIRKEMKDVTTKLGEAAQL 24247

Query: 1201  CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
              C + G P P I W++ G +L +  +++M S     TL +      D G+Y C ATN  G
Sbjct: 24248 SCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVG 24307

Query: 1261  EARCECRL 1268
             E     +L
Sbjct: 24308 EVETSSKL 24315



 Score =  112 bits (280), Expect = 2e-24
 Identities = 127/527 (24%), Positives = 203/527 (38%), Gaps = 79/527 (14%)

Query: 769   IDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFD-LIQ 827
             I  P  P  PK+ +   ++  + W  P  DGG PILGY++E +K  + +W R+N D LI+
Sbjct: 11496 IKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIR 11555

Query: 828   ELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPPSEPTHLAVEDVSDT 884
             + +     +IEG  Y  R+ A N +G   P   ++  +    + PP     +   DV   
Sbjct: 11556 QCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITV 11615

Query: 885   TVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI-LVKDLPTGARLLFR 943
              V    R   RV             PE    W    + L     + L++DLP   R+  +
Sbjct: 11616 RVGQTIRILARVKGR----------PEPDITWTKEGKVLVREKRVDLIQDLP---RVELQ 11662

Query: 944   VRAHNMAGPGAPVTTTEPVT-------VQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             ++    A  G  + + +  +       +  +L RP                G   NL + 
Sbjct: 11663 IKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRP----------------GPCQNLKVT 11706

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNS--------PTDTILFIRAARRVHSGTYQ 1044
                K    ++W       G  +    V  R           +D    +  A  + +  Y 
Sbjct: 11707 NVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYY 11766

Query: 1045  VTVRIEN-------MEDKAT-LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               V  EN       +E K   L +  +D+P  P++L + D     V L+W+ P   G + 
Sbjct: 11767 FRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSP 11826

Query: 1097  LWGYTVQKADKKTMEWFTVLE-HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK 1155
                Y V++  K + +W  V +   + TH +V   +    Y FRV ++N  G SD   T +
Sbjct: 11827 NLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEE 11886

Query: 1156  EPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWF 1215
                      +  E      LD   +   T       V AG T  L   VRG P P+++W 
Sbjct: 11887 V--------VVKEDLQKPVLDLKLSGVLT-------VKAGDTIRLEAGVRGKPFPEVAWT 11931

Query: 1216  --KNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
               K+  DL    R ++ ++       + K    DGG YV  ATN  G
Sbjct: 11932 KDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG 11978



 Score =  110 bits (274), Expect = 1e-23
 Identities = 148/625 (23%), Positives = 238/625 (38%), Gaps = 79/625 (12%)

Query: 684   QKAITQGNKAPARPAPDAPEDTGDS-DEWVFDKKLLCETEGRVRVETTKD--------RS 734
             Q  +T+  K  A    + P D G     ++ +K+   ET  +     TKD        R 
Sbjct: 10712 QPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR---ETMSKRWARVTKDPIHPYTKFRV 10768

Query: 735   IFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDV------PDAPAAPKISNVGEDSC 788
                +EG + E    + V+ +N +G    +   K +        P  P  P+  +   +S 
Sbjct: 10769 PDLLEGCQYE----FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 10824

Query: 789   TVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF--DLIQELSHEARRMIEGVVYEMRV 846
              + W+PP +DGG  ILGYI+E +K     W R N   +   E  ++   + +G  Y+ RV
Sbjct: 10825 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRV 10884

Query: 847   YAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSV 906
              AVNA G S P+   +P + +    EP  L ++        +K     R+ A       +
Sbjct: 10885 LAVNAAGESDPAHVPEPVL-VKDRLEPPELILDANMAREQHIKVGDTLRLSA------II 10937

Query: 907   EYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             +  P     W    +     T   +   P G++L  R  AH   G  + +T   P   + 
Sbjct: 10938 KGVPFPKVTW--KKEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYS-LTVENPAGSKT 10994

Query: 967   ILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIR 1022
             +           ++  +  K G P +L +    K    +TW +     G  +    V  R
Sbjct: 10995 V----------SVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERR 11044

Query: 1023  N------SPTDTILFIRA--ARRVHSGT-YQVTVRIENMEDKATLV--------LQVVDK 1065
             +      SP       ++  A+ ++ G  Y   V  EN   +   V        L  +  
Sbjct: 11045 DVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 11104

Query: 1066  PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCV 1125
             P PP+DL   D     V+L W  P   G + + GY V+  ++ T +W    +      CV
Sbjct: 11105 PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-FKTVTNLECV 11163

Query: 1126  VPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQ 1185
             V  L  G  Y FRV ++N+VG       T  P+      +   PP+ + LD        +
Sbjct: 11164 VTGLQQGKTYRFRVKAENIVGLG--LPDTTIPIECQEKLV---PPSVE-LDV----KLIE 11213

Query: 1186  PLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCP 1245
              LV   V AG T      +RG P P   W  +G ++  D  + + +      L I+    
Sbjct: 11214 GLV---VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 11270

Query: 1246  FDGGIYVCRATNLQGEARCECRLEV 1270
              D G Y    +N  G       L V
Sbjct: 11271 RDTGEYQITVSNAAGSKTVAVHLTV 11295



 Score =  109 bits (272), Expect = 2e-23
 Identities = 185/803 (23%), Positives = 284/803 (35%), Gaps = 153/803 (19%)

Query: 542   EKKLEVYQSIADLMVGAKDQAVFK-CEVSDENVRGVWLKN--GKELVPDSRIKVSHIGRV 598
             +K+L++ + ++    G +  AV K C+ SD     + +KN  G + V      +   G  
Sbjct: 22780 DKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC 22839

Query: 599   HKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIH-LDCPGRIPD 657
              KLT+  VT              A +L  +    E+    V R+E  +++ +   G  P 
Sbjct: 22840 GKLTVSRVTQEKCT--------LAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPT 22891

Query: 658   TIVVV--------------AGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
                VV              A NK    VP+  +P         I   N       P  PE
Sbjct: 22892 LSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEP---------IVARNSFTIPSPPGIPE 22942

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVET----------------TKDRSIFT--------VE 739
             + G   E +  +    E++G   +                   KD  ++         +E
Sbjct: 22943 EVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 23002

Query: 740   GAEKEDEGVYTVTVKNPVGEDQVNLTVKVID------VPDAPAAPKISNVGEDSCTVQWE 793
             G + +    + VT  N  G  + +     I        P  P+AP++ +  + S ++ W 
Sbjct: 23003 GCDYQ----FRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWT 23058

Query: 794   PPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYAVNAI 852
              P YDGG  I+GY+LE ++K + +W R++ +  I+        +  G  Y  RV AVN  
Sbjct: 23059 KPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVK 23118

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT-----------VSLKWRPPERVGAGGL 901
             GMS  S +     P+     P     +D+  T            VS+  RPP        
Sbjct: 23119 GMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPP------- 23171

Query: 902   DGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL-LFRVRAHNMAGPGAPVTTTE 960
                 + +  +G      A+   TE  S+L+ D         + + A N +G  +     +
Sbjct: 23172 ---VITWSKQGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 23228

Query: 961   PVTVQEILQRPRLQLPRHLRQTIQKKV-----GEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
                        +++       TI  ++     G PVN  I  +          +E    A
Sbjct: 23229 VYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEK----------REAAMRA 23278

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM--------EDKATLVLQVVDKPS 1067
              + V+ + S T      R +  V    Y   V  EN+           A LV +V   P 
Sbjct: 23279 FKTVTTKCSKT----LYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEV---PL 23331

Query: 1068  PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWF-------TVLEHYR 1120
              P  L V D     V L W+ P   G + L GY ++     T  W        TVLEH  
Sbjct: 23332 VPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEH-- 23389

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
                  V  L  G  Y FR+ +QN  G S+           PR  +T         D    
Sbjct: 23390 ----TVTSLNEGEQYLFRIRAQNEKGVSE-----------PRETVTA----VTVQDLRVL 23430

Query: 1181  PSF---TQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             P+    T P     V AG    L   + G P P  SWF  G  L E  R  + +   V  
Sbjct: 23431 PTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAK 23490

Query: 1238  LEIRKPCPFDGGIYVCRATNLQG 1260
             L IR+    D G Y     N+ G
Sbjct: 23491 LTIRETTIRDTGEYTLELKNVTG 23513



 Score =  108 bits (270), Expect = 3e-23
 Identities = 83/275 (30%), Positives = 134/275 (48%), Gaps = 11/275 (4%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            ++ +G K      ++     V+W ++ + ++ SG KY   + G KR L +   +L D   
Sbjct: 6257 EILEGEKAEFVCSISKESFPVQWKRDDKTLE-SGDKYDVIADGKKRVLVVKDATLQDMGT 6315

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
            Y  +VG  + +  L V E  + I  PL+D  V   Q V F CEV+ EGA+ KW ++  E 
Sbjct: 6316 YVVMVGAARAAAHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRN--EE 6372

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHY--ALCTSGGQ---ALAELIVQEKKLEVY 548
               ++ KY   +    + L I +A L+D  +Y  +L    G+   + A LIV+E+ L + 
Sbjct: 6373 AIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIV 6432

Query: 549  QSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTP 608
            + + D+    K    F C+V+  NV   W KNG+E+  D+R+        H LTI D   
Sbjct: 6433 EPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGF 6492

Query: 609  ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE 643
             DE +Y  V  G   ++ A+L  +E   +FV   E
Sbjct: 6493 PDEGEY-IVTAGQDKSV-AELLIIEAPTEFVEHLE 6525



 Score =  107 bits (268), Expect = 6e-23
 Identities = 72/235 (30%), Positives = 117/235 (49%), Gaps = 8/235 (3%)

Query: 384  TVELADHDAE-VKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEK 442
            TVEL   + + V+W+KNG  ++ S  KY     G   +L I  C++ D++ Y   +G   
Sbjct: 2681 TVELTHPNVKGVQWIKNGVVLE-SNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2739

Query: 443  CSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYR 502
             S  L V+   V I +  +D   +    V FE  VS +   VKW    VE+   +  K+R
Sbjct: 2740 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSD--KHR 2795

Query: 503  FKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQA 562
               + + H L++      DAG Y       +  A+L V+   L + +++ ++ V     A
Sbjct: 2796 LVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVET--LHITKTMKNIEVPETKTA 2853

Query: 563  VFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV 617
             F+CEVS  NV  +WLKNG E+    + K+   G++H+L I + +  D A+Y+FV
Sbjct: 2854 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV 2908



 Score =  107 bits (268), Expect = 6e-23
 Identities = 98/412 (23%), Positives = 161/412 (39%), Gaps = 41/412 (9%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P ++   DV+   +++ W+PP+  G   +  Y VE        W     G ++ T
Sbjct: 11300 GPPTGPINIL--DVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSK-T 11356

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
              + +  L  G   +FRVRA N  G G P+ +T  V       + +   P    + +   +
Sbjct: 11357 KLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVA------KHKFSPPSPPGKPVVTDI 11410

Query: 988   GE---PVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
              E    V+  +P      P   +  E + + G+ V +  +P   + F R        TY+
Sbjct: 11411 TENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKF-RVTGLYEGNTYE 11469

Query: 1045  VTVRIENM--------EDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               V  EN+                + +  P PP + ++ D       L W  P   G + 
Sbjct: 11470 FRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSP 11529

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCV--VPELIIGNGYYFRVFSQNMVGFSDRAATT 1154
             + GY V+     T +W  + +      C   VP LI GN Y FR+ + N+VG  +     
Sbjct: 11530 ILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELA 11589

Query: 1155  KEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIA---GYTAMLCCAVRGSPKPK 1211
             +  +               A D    P     +  R VI    G T  +   V+G P+P 
Sbjct: 11590 ESVI---------------AKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPD 11634

Query: 1212  ISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             I+W K G  L  + R  +      + L+I++    D G Y+  A N  G A+
Sbjct: 11635 ITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 11686



 Score =  106 bits (265), Expect = 1e-22
 Identities = 124/571 (21%), Positives = 216/571 (37%), Gaps = 99/571 (17%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLT---VKVIDV---PDAPAAPKISNVGEDSCT 789
             + V G  +  E  + +  +N  G    + T    K  D    P  P  P++ +    S +
Sbjct: 15409 YKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSIS 15468

Query: 790   VQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYA 848
             + W  P YDGG  I GY++E    +   W  +     ++  S+    + E   Y++R+YA
Sbjct: 15469 IAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYA 15528

Query: 849   VNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT----------------VSLKWRP 892
             +N+ G+  P+      +P  P +E   L  E   D                  V +K RP
Sbjct: 15529 MNSEGLGEPA-----LVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRP 15583

Query: 893   PERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGP 952
                V      G S++          A+++  + +T ++V ++       + +   N +G 
Sbjct: 15584 APEVKWARDHGESLDK---------ASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGS 15634

Query: 953   GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQ 1012
              +            +L  P                G P +L +    K    +TW     
Sbjct: 15635 KSAFVNVR------VLDTP----------------GPPQDLKVKEVTKTSVTLTWDP--- 15669

Query: 1013  PLAGEEVSIRNSPTDTILFIRAA-RRVHSGTYQVTVRIENMEDKATLVLQVV-------- 1063
             PL      I+N   +     R A   V +  ++ + +++ +++  +   +V+        
Sbjct: 15670 PLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIG 15729

Query: 1064  ------------DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTME 1111
                         ++P PP  + + D    +V+L W+ P+  G + + GY V+   K + +
Sbjct: 15730 LPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDK 15789

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPN 1171
             W T     + T   +  LI G  Y FRV +QN  G SD       P  +  P I      
Sbjct: 15790 WATCAT-VKVTEATITGLIQGEEYSFRVSAQNEKGISD-------PRQLSVPVI------ 15835

Query: 1172  YKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFS 1231
               A D    P+F       +V+AG    +     G P P ++W K+ + L +  R    S
Sbjct: 15836 --AKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAES 15893

Query: 1232  KQGVLTLEIRKPCPFDGGIYVCRATNLQGEA 1262
              +    L I+  C  D G YV + TN  GEA
Sbjct: 15894 TENNSLLTIKDACREDVGHYVVKLTNSAGEA 15924



 Score =  105 bits (263), Expect = 2e-22
 Identities = 87/330 (26%), Positives = 141/330 (42%), Gaps = 40/330 (12%)

Query: 644  PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
            PP I L    R  DTI V AG  + +   ++G P P + W K     N+       DA +
Sbjct: 9089 PPTIKLRLSVR-GDTIKVKAGEPVHIPADVTGLPMPKIEWSK-----NETVIEKPTDALQ 9142

Query: 704  DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
             T +                   V  ++ ++  ++  A +ED+G YTVT  N +G    N
Sbjct: 9143 ITKEE------------------VSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRN 9184

Query: 764  LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERK--KKKSYRWMRL 821
            + V+V D P  P    ++++  +SC + W+ P  +GG  I  Y+++++   +K   W  +
Sbjct: 9185 VHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEV 9244

Query: 822  NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ-----PFMPIGPPSEPTHL 876
                + E  +   ++I    YE RV AVN  G+S    + +     P+   GPP +P  L
Sbjct: 9245 TNTAV-EKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVL 9303

Query: 877  AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSIL-----V 931
            A    +  ++ + W PP   G   + GY +E   EG   W    +       +      V
Sbjct: 9304 A---RTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNV 9360

Query: 932  KDLPTGARLLFRVRAHNMAGPGAPVTTTEP 961
              L  G +  FR  A N AG G P   ++P
Sbjct: 9361 PRLLEGVKYQFRAMAINAAGIGPPSEPSDP 9390



 Score =  105 bits (263), Expect = 2e-22
 Identities = 85/322 (26%), Positives = 132/322 (40%), Gaps = 40/322 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             D +++ +G  LR+   + G P P V W K    G                          
Sbjct: 21661 DGLIIKSGESLRIKALVQGRPVPRVTWFK---DG-------------------------- 21691

Query: 717   LLCETEGRVRVETTK---DRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPD 773
                E E R+ +E T      S+F V  A ++  GVYTV  KN  G  +  + VKV D P 
Sbjct: 21692 --VEIEKRMNMEITDVLGSTSLF-VRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPG 21748

Query: 774   APAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHE 832
                 P + +N+  +  T+ W+ P  DG  PI  YI+E+++     W  +  D  +  S+ 
Sbjct: 21749 KVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYT 21807

Query: 833   ARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPI--GPPSEPTHLAVEDVSDTTVSLKW 890
             A ++I G  Y+ RV AVN  G+ RP  +      I    P  P      +++  +++L W
Sbjct: 21808 AIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTW 21867

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAAL-QGLTEHTSILVKDLPTGARLLFRVRAHNM 949
               PE  G   +  Y +E   +  + WV  + +     T   V  L  G    F V A N 
Sbjct: 21868 ARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENA 21927

Query: 950   AGPGAPVTTTEPVTVQEILQRP 971
             AG G     +  +  +E +  P
Sbjct: 21928 AGVGPASGISRLIKCREPVNPP 21949



 Score =  105 bits (261), Expect = 4e-22
 Identities = 130/548 (23%), Positives = 207/548 (37%), Gaps = 57/548 (10%)

Query: 738   VEGAEKEDEGVYTVTVKNPVGEDQ---VNLTVKVIDV---PDAPAAPKISNVGEDSCTVQ 791
             V G  ++ E  + V+ +N  G  +     +  K  D    P  P    I +  ++S T+ 
Sbjct: 17575 VTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLA 17634

Query: 792   WEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYAVN 850
             W  P YDGG  ILGY++E  K     W  +     ++    E  ++ E   Y++RV A+N
Sbjct: 17635 WGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALN 17694

Query: 851   AIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
              +G+   +       P      P         +  +  + R    V AGG     + +  
Sbjct: 17695 KVGLGEATSVPGTVKPEDKLEAP---------ELDLDSELRKGIVVRAGGSARIHIPFKG 17745

Query: 911   EGCSE--WVAALQGLTE---------HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTT 959
                 E  W       T+         +T + + +        + ++  N +G  +   T 
Sbjct: 17746 RPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVT- 17804

Query: 960   EPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEV 1019
               V V +    P+    + +R+     V EP   +I    K +  V   +E    A   V
Sbjct: 17805 --VKVLDTPGPPQNLAVKEVRKDSAFLVWEPP--IIDGGAKVKNYVIDKRESTRKAYANV 17860

Query: 1020  SIRNSPTDTILFIRAARRVHSGTYQVTVRIEN-----MEDKATLVLQVVDKPSPPQDLRV 1074
             S + S T      +         Y   V  EN     +  +    ++  + PSPP  + +
Sbjct: 17861 SSKCSKTS----FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTL 17916

Query: 1075  TDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNG 1134
             TD    + +L W+ P+  G + + GY V+   K T +W  V E  +  + VV  L  G  
Sbjct: 17917 TDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAVVTGLSSGQE 17975

Query: 1135  YYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIA 1194
             Y FRV + N  G SD       P  +  P I        A D +  PS   P    S+ A
Sbjct: 17976 YQFRVKAYNEKGKSD-------PRVLGVPVI--------AKDLTIQPSLKLPFNTYSIQA 18020

Query: 1195  GYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCR 1254
             G    +   V G P+P ISW K+G  L +  R  +        L I++    D G Y   
Sbjct: 18021 GEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVT 18080

Query: 1255  ATNLQGEA 1262
             ATN  G A
Sbjct: 18081 ATNSAGTA 18088



 Score =  104 bits (260), Expect = 5e-22
 Identities = 129/579 (22%), Positives = 235/579 (40%), Gaps = 81/579 (13%)

Query: 725   VRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVG 784
             + V   K++S+       K ++G+       P+   ++ +T +V D+ D P A     +G
Sbjct: 21215 IEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEV-DLSDIPGAQVTVRIG 21273

Query: 785   EDSCTVQWEPPAYDGGQPILGYI---LERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
              +   V  E P     +P + ++   L  K+ +  R+ +    +   + + A++   G  
Sbjct: 21274 HN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKN-AKKEHGGKY 21329

Query: 842   YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGG 900
               +   AV  I +    P +   + +GPPS+P   +  +++   +V L W  PE  G G 
Sbjct: 21330 TVILDNAVCRIAV----PIT--VITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGE 21383

Query: 901   LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960
             +  YS+E      + W      +   T+  V +L   A   FRVRA N  G       ++
Sbjct: 21384 ITCYSIEKRETSQTNWKMVCSSVAR-TTFKVPNLVKDAEYQFRVRAENRYG------VSQ 21436

Query: 961   PVTVQEILQRPRLQLPRHL-RQTIQKKVGEPVNLL--------------IPFQGKPRPQV 1005
             P+    I+ + + ++P    +  I     + ++L                  + K R  +
Sbjct: 21437 PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSI 21496

Query: 1006  TWTKEG-QPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENME--------DKA 1056
              W K    P++G E              RA   V    YQ  V  EN           K 
Sbjct: 21497 LWQKVNTSPISGREY-------------RATGLVEGLDYQFRVYAENSAGLSSPSDPSKF 21543

Query: 1057  TLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEW---- 1112
             TL +  VD P  P  + VT      + L+W PP   G +++ GY+++K       W    
Sbjct: 21544 TLAVSPVDPPGTPDYIDVTRE---TITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCN 21599

Query: 1113  FTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNY 1172
             FT +   + T   V  L  G+ Y FR+ ++N VG     + +   +      +   PP  
Sbjct: 21600 FTDVSECQYT---VTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENV---PP-- 21651

Query: 1173  KALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSK 1232
               ++F   P +   L+ +S   G +  +   V+G P P+++WFK+G+++ +     +   
Sbjct: 21652 -IVEFG--PEYFDGLIIKS---GESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDV 21705

Query: 1233  QGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
              G  +L +R       G+Y   A N  G A+ E +++V+
Sbjct: 21706 LGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21744



 Score =  103 bits (257), Expect = 1e-21
 Identities = 124/529 (23%), Positives = 187/529 (35%), Gaps = 95/529 (17%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  PA PK+ +    S ++ W  PAYDGG PI+GY++E K+  S  W+R N    +Q+  
Sbjct: 13284 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13343

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT----- 885
              E   ++E   Y+ RVYAVN IG S PS       P      P      D+  T      
Sbjct: 13344 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13403

Query: 886   ------VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
                   V +K RPP ++                   W      L +   + +K   T   
Sbjct: 13404 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKS--TDFD 13443

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV----GEPVNLLI 995
                R    N    G  + T E    ++               TI  KV    G PVN+ +
Sbjct: 13444 TFLRCENVNKYDAGKYILTLENSCGKK-------------EYTIVVKVLDTPGPPVNVTV 13490

Query: 996   PFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
                 K    VTW       G P+    V  R++        ++   V +   + + R+ N
Sbjct: 13491 KEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER------KSWSTVTTECSKTSFRVAN 13544

Query: 1052  MEDKATLVLQVVDK--------------------PSPPQDLRVTDAWGLNVALEWKPPQD 1091
             +E+  +   +V  +                    P P  DL+V      + ++ WK P  
Sbjct: 13545 LEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHS 13604

Query: 1092  VGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRA 1151
              G + + GY V    ++  +W  V++     +    +L  G  Y FRV ++N  G     
Sbjct: 13605 DGGSRIIGYVVDFLTEEN-KWQRVMKSLSLQYSA-KDLTEGKEYTFRVSAENENG----E 13658

Query: 1152  ATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPK 1211
              T  E   + R  +         LD    P         S        L   ++G P P 
Sbjct: 13659 GTPSEITVVARDDVVAPD-----LDLKGLPDLCYLAKENS-----NFRLKIPIKGKPAPS 13708

Query: 1212  ISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             +SW K    L  D R  + S     TL +      D G Y     N+ G
Sbjct: 13709 VSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 13757



 Score =  102 bits (255), Expect = 2e-21
 Identities = 114/505 (22%), Positives = 205/505 (40%), Gaps = 45/505 (8%)

Query: 704  DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
            D G   E    + L   T+  VRV      +   + G  +  E  + V   N  GE + +
Sbjct: 7705 DGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPS 7764

Query: 764  ------LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYR 817
                  L  + +  P  P   ++ N+ +++  ++W  P  DGG PI  YI+E++  +   
Sbjct: 7765 EPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKG 7824

Query: 818  WMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPPSEPT 874
            W  ++   +++       + EG +Y  RV A NAIG S  +      +       P  P 
Sbjct: 7825 WQTVD-TTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPY 7883

Query: 875  HLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDL 934
             LAV DV+   V LKW PP+  G   +  Y +E      + WV A +      +  V D+
Sbjct: 7884 ALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDV 7943

Query: 935  PTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLL 994
              G  + F+VRA N AG G P   TE +++++    P   L  H+    +K +   +   
Sbjct: 7944 IEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIA--IAWK 8001

Query: 995  IPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN-- 1051
             P +    P + +  E  P+  E+ + + + P   + F      V    Y + VR  N  
Sbjct: 8002 PPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAI 8061

Query: 1052 -MEDKATLVLQVVDKPS--------PPQDLRVTDAWGLNVALEWKP-PQDVGNTELWGYT 1101
             + + + +   VV K             D+ V +   L++ + ++  P    +    G  
Sbjct: 8062 GVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKE 8121

Query: 1102 VQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP 1161
            V+ +D+ TM+       +   H  VP+ +  +   + +  +N +G S  A+   + + +P
Sbjct: 8122 VKASDRLTMK-----NDHISAHLEVPKSVRADAGIYTITLENKLG-SATASINVKVIGLP 8175

Query: 1162 RP--------------GITYEPPNY 1172
             P               +T+EPP +
Sbjct: 8176 GPCKDIKASDITKSSCKLTWEPPEF 8200



 Score =  102 bits (255), Expect = 2e-21
 Identities = 86/332 (25%), Positives = 131/332 (39%), Gaps = 39/332 (11%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP +HLD      D + +  G    L    SG P P V W K                  
Sbjct: 10512 PPTLHLD----FRDKLTIRVGEAFALTGRYSGKPKPKVSWFK------------------ 10549

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
             D  D  E           + R  ++TT          A++ D G Y V V+N  G  +  
Sbjct: 10550 DEADVLE-----------DDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGF 10598

Query: 764   LTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
               V V+D P  P  P     V +D   + W+PP  DGG  I  YI+E+K+     WM + 
Sbjct: 10599 CQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVT 10658

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRP--SPASQPFMPIGPPSEPTHLAVED 880
                  + + +  +++EG  Y  R++A N  G+S P  S + +       P  P    V +
Sbjct: 10659 -SASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTE 10717

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQG-LTEHTSILVKDLPTGAR 939
             V+  +  + W  P   G   +  Y +E        W    +  +  +T   V DL  G +
Sbjct: 10718 VTKDSALVTWNKPHD-GGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQ 10776

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
               FRV A N  G G P   ++PV  ++ + +P
Sbjct: 10777 YEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 10808



 Score =  102 bits (253), Expect = 3e-21
 Identities = 150/635 (23%), Positives = 235/635 (37%), Gaps = 110/635 (17%)

Query: 680   TVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE 739
             TV+W           +RP  D   D         DKK L     +V  ET +D     V 
Sbjct: 20778 TVVW-----------SRPIADGGSDISGYFLEKRDKKSLGWF--KVLKETIRDTRQ-KVT 20823

Query: 740   GAEKEDEGVYTVTVKNPVGE------DQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWE 793
             G  +  +  Y V   N  G+       +       ID P  PA  +I++  + S T+ W 
Sbjct: 20824 GLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWS 20883

Query: 794   PPAYDGGQPILGYILERKKKKSYRWMRLNFD-LIQELSHEARRMIEGVVYEMRVYAVNAI 852
              P YDGG  + GY++E ++ +   W  ++    ++   +    +  GV Y  RV AVN  
Sbjct: 20884 KPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCA 20943

Query: 853   GMSRPSPASQPFMP---IGPPSEPTHLAV---------EDVSDTTVSLKWRPPERV---- 896
             G   P   ++P      +  P     +A+         EDV    +  K RPP  V    
Sbjct: 20944 GQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQ-VLIPFKGRPPPTVTWRK 21002

Query: 897   ---GAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSIL----VKDLPTGARLLFRVRAHNM 949
                  G    YS+E                T+ +S+L    V    TG  +L        
Sbjct: 21003 DEKNLGSDARYSIEN---------------TDSSSLLTIPQVTRNDTGKYILTIEN---- 21043

Query: 950   AGPGAPVTTTEPVTVQEILQRP----RLQLPRHLRQTIQKKVGEP--------VNLLIPF 997
              G G P ++T  V   ++L  P    +LQ+    R T+      P        +N +I  
Sbjct: 21044 -GVGEPKSSTVSV---KVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI-- 21097

Query: 998   QGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             + +   + TW+      +     + +    T  F R       G  +          + T
Sbjct: 21098 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPC--------ETT 21149

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
               ++  + P+P +DL + D+   +V L W  P   G + +  Y V++  K    W +   
Sbjct: 21150 EPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW-SHAG 21208

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDF 1177
               +     V +L   +   FRVF++N  G SD    T  P+ +    IT E      +D 
Sbjct: 21209 ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSD--PVTIGPITVKELIITPE------VDL 21260

Query: 1178  SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             S+ P         +V  G+   L    +G PKP ISW K+GL L E    R    +  +T
Sbjct: 21261 SDIPG-----AQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT 21315

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272
             L I+      GG Y     N        CR+ V +
Sbjct: 21316 LSIKNAKKEHGGKYTVILDN------AVCRIAVPI 21344



 Score =  101 bits (252), Expect = 4e-21
 Identities = 134/560 (23%), Positives = 208/560 (37%), Gaps = 74/560 (13%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPP 795
             +TV+G ++ D   Y V+  N VG+ + +   K I   D  A P +     D  T++    
Sbjct: 10471 YTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRV--- 10527

Query: 796   AYDGGQPILGYILERKKKKSYRWMRLNFDLIQE-LSH-------------EARRMIEG-- 839
                G    L      K K    W +   D++++  +H             +A+R   G  
Sbjct: 10528 ---GEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKY 10584

Query: 840   -VVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGA 898
              VV E    +    G  + +   +P  P+GP S       ++V+   + + W+PP   G 
Sbjct: 10585 CVVVENSTGSRK--GFCQVNVVDRPGPPVGPVS------FDEVTKDYMVISWKPPLDDGG 10636

Query: 899   GGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTT 958
               +  Y +E    G   W+       + T+  V  L  G   +FR+ A N+ G       
Sbjct: 10637 SKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGKDYIFRIHAENLYG------I 10689

Query: 959   TEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI---PFQG-KPRPQVTWTKEGQPL 1014
             ++P+    +  + R ++P    Q I  +V +   L+    P  G KP       K  + +
Sbjct: 10690 SDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR-ETM 10748

Query: 1015  AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM--------EDKATLVLQVVDKP 1066
             +     +   P       R    +    Y+  V  EN           K       + KP
Sbjct: 10749 SKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 10808

Query: 1067  SPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL---EHYRRTH 1123
             SPP +    D    +V L W+PP+  G +++ GY V+       EW       E    T 
Sbjct: 10809 SPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETK 10868

Query: 1124  CVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGIT---YEPPNYKALDFSEA 1180
               V  L  G  Y FRV + N  G SD       P  +P P +     EPP    LD + A
Sbjct: 10869 YKVTGLRDGQTYKFRVLAVNAAGESD-------PAHVPEPVLVKDRLEPPEL-ILDANMA 10920

Query: 1181  PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
                      + +  G T  L   ++G P PK++W K   D    AR  +        LEI
Sbjct: 10921 RE-------QHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEI 10971

Query: 1241  RKPCPFDGGIYVCRATNLQG 1260
             R     DGGIY     N  G
Sbjct: 10972 RNAAHEDGGIYSLTVENPAG 10991



 Score =  101 bits (251), Expect = 5e-21
 Identities = 79/286 (27%), Positives = 133/286 (46%), Gaps = 11/286 (3%)

Query: 359  EKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAK 418
            E+    F K LE    V KG  + L+ EL + + +V W K+G+ +     + +   IG  
Sbjct: 4903 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 4961

Query: 419  RTLTISQCSLADDAAYQCVVGGE---KCSTELFVKEPPVL---ITRPLEDQLVMVGQRVE 472
            R LTI+     D   Y   V      +CS+   VK   V+   + +P+ DQ V       
Sbjct: 4962 RALTINDADDTDAGTYTVTVENANNLECSS--CVKVVEVIRDWLVKPIRDQHVKPKGTAI 5019

Query: 473  FECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGG 532
            F C+++++   +KW K   E+  E   K    +DG   +L I  AM ED   YA+   G 
Sbjct: 5020 FACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGK 5079

Query: 533  QALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKV 592
            +  A+L + E+++E+ + I D+ +  K+ A F  E+S+ ++ G W   G+ L P    ++
Sbjct: 5080 RYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEI 5139

Query: 593  SHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDF 638
               G    LT+  V   D+A    + +      +A L   E+++DF
Sbjct: 5140 KAEGGKRFLTLHKV-KLDQAG-EVLYQALNAITTAILTVKEIELDF 5183



 Score =  101 bits (251), Expect = 5e-21
 Identities = 142/653 (21%), Positives = 242/653 (37%), Gaps = 78/653 (11%)

Query: 661   VVAGNKLRLDVPISGDP-----------APTVIWQKAITQGNKAPARPAPDAPEDTGDSD 709
             ++A NK  +  P+  +P           AP      ++T+ +       P+    +  + 
Sbjct: 9986  IMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG 10045

Query: 710   EWVFDKKLLCETEGRVRVETTKDRSI---FTVEGAEKEDEGVYTVTVKNPVGEDQVNL-- 764
              W+  K    +   RV  +  K  ++   + V G  +  +  + V   N  G    +L  
Sbjct: 10046 YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPS 10105

Query: 765   ---TVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                T +    P  P  PK+++  + S  ++W PP  DGG  + GYI+E K++    W + 
Sbjct: 10106 DPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKG 10165

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
                 ++        + EG  Y+ RV AVN  G+  P   +           P       V
Sbjct: 10166 KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASV 10225

Query: 882   SDTTVSLKWRPPERVGAGGLDGYS--VEYCPEGCSEW---------VAALQGLTEHTSIL 930
              D  V         V AGG+      V   P     W          A ++     +S++
Sbjct: 10226 RDRIV---------VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMV 10276

Query: 931   VKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV--- 987
             +K+     + ++ + A N AG        + + V   +  P L    +L     K     
Sbjct: 10277 IKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLA--HNLTNESCKLTWFS 10334

Query: 988   -----GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
                  G P+   +  + +   +  WT     +  +  +++        F R A     G 
Sbjct: 10335 PEDDGGSPITNYV-IEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGM 10393

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
                   +E  E  A ++ + +  P  P+DL V +     V L W PP+  G +E+  Y +
Sbjct: 10394 GPF---VETSE--ALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVL 10448

Query: 1103  QKADKKTMEWFTVL-EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP 1161
             +     T ++  V  ++       V  L  G+ Y +RV + N+VG         +P F  
Sbjct: 10449 ESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQG-------KPSFCT 10501

Query: 1162  RPGITYE----PPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKN 1217
             +P IT +    PP    LDF +           ++  G    L     G PKPK+SWFK+
Sbjct: 10502 KP-ITCKDELAPPTLH-LDFRD---------KLTIRVGEAFALTGRYSGKPKPKVSWFKD 10550

Query: 1218  GLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
               D+ ED R  + +    L LE  K    D G Y     N  G  +  C++ V
Sbjct: 10551 EADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 10603



 Score =  100 bits (250), Expect = 7e-21
 Identities = 118/495 (23%), Positives = 197/495 (39%), Gaps = 46/495 (9%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVG---EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQW 792
             F   G E+  E  + V+ +N VG     +V+      D  D P  P+   V  +S T+QW
Sbjct: 16095 FKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQW 16154

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
             + P YDGG  I GYI+E+K+    RWM+ +F  I +   E   ++E   YE RV A NA 
Sbjct: 16155 KKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAA 16214

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG 912
             G+      S   +      +P  ++++     T+ +      +V A   D Y     P  
Sbjct: 16215 GVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDA---DIYGK---PIP 16268

Query: 913   CSEWVAALQGLTEHTSILVKDLPTGARL----LFRVRAHNMAGPGAPVTTTEPVTVQ-EI 967
               +W+   Q L+    + +K       L      RV + N       V     VTV  ++
Sbjct: 16269 TIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 16328

Query: 968   LQRPRLQLPRHLRQTIQKKVGEPVNLL--IPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP 1025
             L RP    P      I     E   L    P Q      + +  E +  +    ++ ++ 
Sbjct: 16329 LDRPG---PPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN 16385

Query: 1026  TDTILFIRAARRVHSGTYQVTVRIEN-------MEDKATLVLQVVDKPSPPQDLRVTDAW 1078
               T L  +  + +    Y   +   N       +E +  +       P  P+   VT   
Sbjct: 16386 VQT-LSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVT 16444

Query: 1079  GLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR---RTHCVVPELIIGNGY 1135
               ++ + W+ P   G +E+ GY ++K DK+ + W     H R        V  LI  + Y
Sbjct: 16445 KDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRC--HKRLIGELRLRVTGLIENHDY 16502

Query: 1136  YFRVFSQNMVGFSDRAATTK-----EPVFIPRPGITYEPPNYKALDFSEAP---SFTQPL 1187
              FRV ++N  G S+ +  +      +P++ P P     P N K +D + +    S+++P+
Sbjct: 16503 EFRVSAENAAGLSEPSPPSAYQKACDPIYKPGP-----PNNPKVIDITRSSVFLSWSKPI 16557

Query: 1188  VNRSV-IAGYTAMLC 1201
              +    I GY    C
Sbjct: 16558 YDGGCEIQGYIVEKC 16572



 Score =  100 bits (248), Expect = 1e-20
 Identities = 107/487 (21%), Positives = 186/487 (38%), Gaps = 42/487 (8%)

Query: 800   GQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP 859
             G+P+    L R        MR N ++  E  +    + E V  +   Y + A   S  + 
Sbjct: 20197 GKPLPKVTLSRDGVPLKATMRFNTEITAE--NLTINLKESVTADAGRYEITAANSSGTTK 20254

Query: 860   ASQPFMPIGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVA 918
             A    + +  P  PT  + + D+++ +V+LKW PP+  G   +  Y +       + W  
Sbjct: 20255 AFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 20314

Query: 919   ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG-----PGAPVTTTEPVTVQEILQRPRL 973
              +      T + V  L TG    FR++A N  G       A VT   P T       P  
Sbjct: 20315 -VSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTP-- 20371

Query: 974   QLPRHLRQTIQKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTD 1027
              +    R++I     EPV+      +    + K R  + W K        ++ IR +   
Sbjct: 20372 WVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK------ANKLVIRTTHFK 20425

Query: 1028  TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWK 1087
              +  I A        Y             +  +  +D   PP+++R+TD    +V+L W+
Sbjct: 20426 -VTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQ 20484

Query: 1088  PPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
              P   G +++ GY V++ D     W      +   T  ++  L   + Y FRVF++N VG
Sbjct: 20485 QPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVG 20544

Query: 1147  FSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCA 1203
                  +    P+                +D    P    PL    V+   AG +  L   
Sbjct: 20545 SISNPSEVVGPI--------------TCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAG 20590

Query: 1204  VRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             + G P P I W+K+  +L  +A   + +   + ++ I+     + G Y  +  N  G A 
Sbjct: 20591 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 20650

Query: 1264  CECRLEV 1270
                R+++
Sbjct: 20651 ATIRVQI 20657



 Score = 99.4 bits (246), Expect = 2e-20
 Identities = 77/249 (30%), Positives = 111/249 (44%), Gaps = 13/249 (5%)

Query: 391  DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV---VGGEKCSTEL 447
            D E +W KNG +I+ S   Y +        L I   +  D A+       + GE  S   
Sbjct: 2060 DPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAF 2119

Query: 448  FVKEPPVLITRPLEDQLVMVGQR---VEFECEVSEEGAQVKWLKDGVELTREETFKYRFK 504
             + +   LIT   E Q V+  ++     FECE SE   +VKW KDG+E+   E  KYR  
Sbjct: 2120 LLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEV--HEGDKYRMH 2177

Query: 505  KDGQRHHLIINEAMLEDAGHYALC---TSGGQALAELIVQEKKLEVYQSIADLMVGAKDQ 561
             D + H L I      DA  Y+         +  A+LIV+   +E  + + D+ V     
Sbjct: 2178 SDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYS 2237

Query: 562  AVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEG- 620
               +C VS EN+ G W  N  EL  + +  ++       LT+ DVT  D+ +YSFV +G 
Sbjct: 2238 GELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK 2297

Query: 621  -FACNLSAK 628
               C L  K
Sbjct: 2298 KTTCKLKMK 2306



 Score = 99.0 bits (245), Expect = 3e-20
 Identities = 116/522 (22%), Positives = 200/522 (38%), Gaps = 83/522 (15%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  P+ PK+++    S ++ W  P YDGG P+ GY++E K+  +  W        +Q   
Sbjct: 18698 PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQ 18757

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPP-----SEPTHLAVEDVS 882
                 ++ E   Y  R+ A+N+ G+  P+      +    I PP     ++   + V   S
Sbjct: 18758 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18817

Query: 883   DTT---VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
              T    V++K RP   V     +G   +          A ++  +  T +++ ++     
Sbjct: 18818 ATLRLFVTIKGRPEPEVKWEKAEGILTDR---------AQIEVTSSFTMLVIDNVTRFDS 18868

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
               + +   N +G     + T  V V+ +L  P                  PVNL I    
Sbjct: 18869 GRYNLTLENNSG-----SKTAFVNVR-VLDSP----------------SAPVNLTIREVK 18906

Query: 1000  KPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAA-RRVHSGTYQVTVRIENMED---- 1054
             K    ++W     PL      I N   +     R A   + +   + T RIEN+++    
Sbjct: 18907 KDSVTLSWEP---PLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSY 18963

Query: 1055  ----------------KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
                             + T  ++V + P PP  + + D       ++W+ P+  G +++ 
Sbjct: 18964 YFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKIT 19023

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
             GY V+   K + +W T  +  +     +  L  G  Y FRV + N  G SD       P 
Sbjct: 19024 GYVVEMQTKGSEKWSTCTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSD-------PR 19075

Query: 1159  FIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNG 1218
              +  P I        A D    PS   P    +V A     +    +G P+  ++W K+G
Sbjct: 19076 QLGVPVI--------ARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDG 19127

Query: 1219  LDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
               L E  R  + S + V +L I++    D G Y    +N  G
Sbjct: 19128 QTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG 19169



 Score = 99.0 bits (245), Expect = 3e-20
 Identities = 115/467 (24%), Positives = 176/467 (37%), Gaps = 65/467 (13%)

Query: 824   DLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSD 883
             DL   L  +A R+  G  YE+++   NA+G +  +   Q     GPP  P  +  + V+ 
Sbjct: 20621 DLASILIKDADRLNSGC-YELKLR--NAMGSASATIRVQILDKPGPPGGP--IEFKTVTA 20675

Query: 884   TTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFR 943
               ++L WRPP   G   +  Y VE        W    + L E   I    +  G   +FR
Sbjct: 20676 EKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL-EECIITTTKIIKGNEYIFR 20734

Query: 944   VRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRP 1003
             VRA N  G G P+ +   V     +      +P   + T                 K   
Sbjct: 20735 VRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKIT-----------------KNSM 20777

Query: 1004  QVTWTKE----GQPLAGEEVSIRNSPT--------DTILFIR--AARRVHSGTYQVTVRI 1049
              V W++     G  ++G  +  R+  +        +TI   R        +  YQ  V  
Sbjct: 20778 TVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCA 20837

Query: 1050  ENMEDKATL--------VLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYT 1101
              N   +               +D P PP  +R+ D+   ++ L W  P   G + + GY 
Sbjct: 20838 VNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYV 20897

Query: 1102  VQKADKKTMEWFTVLE--HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVF 1159
             V+    +  EW TV      R T  VV  L  G  YYFRV + N  G         EP+ 
Sbjct: 20898 VEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQG-------EPIE 20950

Query: 1160  IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVRGSPKPKISWFK 1216
             +  P         +A D  EAP     +  R+ +   AG    +    +G P P ++W K
Sbjct: 20951 MNEP--------VQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRK 21002

Query: 1217  NGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             +  +LG DAR+ + +      L I +    D G Y+    N  GE +
Sbjct: 21003 DEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPK 21049



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 116/522 (22%), Positives = 197/522 (37%), Gaps = 81/522 (15%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  P  PK+ ++   S  + W  P YDGG  I GYI+E+       W        I + +
Sbjct: 16533 PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTN 16592

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTT-- 885
              E  +++E   Y  R+ A+N  G+   +    P +    +  P     L +  + +    
Sbjct: 16593 IEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAG 16652

Query: 886   ------VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
                   V +K RP   V  G +DG   +          A +   +  TS+++ ++     
Sbjct: 16653 GSLRLFVPIKGRPTPEVKWGKVDGEIRD---------AAIIDVTSSFTSLVLDNVNRYDS 16703

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
               + +   N +G     T +  VTV+ +L  P                  PVNL +    
Sbjct: 16704 GKYTLTLENSSG-----TKSAFVTVR-VLDTP----------------SPPVNLKVTEIT 16741

Query: 1000  KPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT--------- 1046
             K    +TW       G  +    V  R +   +  +       H  ++++          
Sbjct: 16742 KDSVSITWEPPLLDGGSKIKNYIVEKREATRKS--YAAVVTNCHKNSWKIDQLQEGCSYY 16799

Query: 1047  --VRIEN-----MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWG 1099
               V  EN     +  +    ++V + P PP  + V D    +V+L W  P+  G +++  
Sbjct: 16800 FRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQ 16859

Query: 1100  YTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVF 1159
             Y V+   K + +W +     +    V+  L  G  Y FRV + N  G SD  +     V 
Sbjct: 16860 YIVEMQAKHSEKW-SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLA---VP 16915

Query: 1160  IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGL 1219
             I    +  EP           P+F+    + SV  G    +   + G PKP I+W K+GL
Sbjct: 16916 IVAKDLVIEP--------DVKPAFS----SYSVQVGQDLKIEVPISGRPKPTITWTKDGL 16963

Query: 1220  DLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
              L +  R  +     + TL I++    DGG Y     N+ G+
Sbjct: 16964 PLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQ 17005



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 125/521 (23%), Positives = 208/521 (39%), Gaps = 94/521 (18%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVI---DVPDAPAAPKISNVGEDSCTVQW 792
             F  +  E+  E  + V  +N VG  + +   +     D  D P  P+   V  +  T+QW
Sbjct: 17177 FKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQW 17236

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
               P YDGG  I GYI+E++     RWM+ +F  + E       + E   YE RV A NA 
Sbjct: 17237 TKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAA 17296

Query: 853   G-MSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSL--KWRPPERVGAGGLDGYSVEYC 909
             G +S+PS ++ P             A ++V    +S+  K+R    V AG  + + +E  
Sbjct: 17297 GAISKPSDSTGPI-----------TAKDEVELPRISMDPKFRDTIVVNAG--ETFRLEAD 17343

Query: 910   PEG----CSEWVAALQGLTEHTSILVKDLPTGARLLFR-----------VRAHNMAGPGA 954
               G      EW+   + + E     +K+    A L+ +           +RA N+AG   
Sbjct: 17344 VHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAG--- 17400

Query: 955   PVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN-LLIPFQGKPRPQVTWTKEGQP 1013
               + + PV V ++L RP                G P   + +      +  +TW+   Q 
Sbjct: 17401 --SKSFPVNV-KVLDRP----------------GPPEGPVQVTGVTSEKCSLTWSPPLQD 17441

Query: 1014  LAGEEVS---IRNSPTDTILFIRAARRVHSGTYQVTVRIEN------------------M 1052
               G ++S   +    T  + +   A  V + + +VT  +E                   +
Sbjct: 17442 -GGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPL 17500

Query: 1053  EDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEW 1112
             E    L+      P PP+ L VT+    ++ + W  P   G +E+ GY V+K D+  + W
Sbjct: 17501 ESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRW 17560

Query: 1113  FTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPVFIPRPGIT 1166
                           V  L   + Y FRV ++N  G  + +  T      +PVF P P   
Sbjct: 17561 IKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGP--- 17617

Query: 1167  YEPPNYKALDFSE---APSFTQPLVN-RSVIAGYTAMLCCA 1203
               P N   +D ++     ++ +P+ +  S I GY   +C A
Sbjct: 17618 --PTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKA 17656



 Score = 97.4 bits (241), Expect = 8e-20
 Identities = 105/411 (25%), Positives = 162/411 (39%), Gaps = 57/411 (13%)

Query: 876   LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLP 935
             L V  V+    +L W  P+  G   +  Y VE        WV  ++G     S +V  L 
Sbjct: 22842 LTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVI-VEGECPTLSYVVTRLI 22900

Query: 936   TGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI 995
                  +FRVRA N  GPG PV + EP+  +     P           I ++VG       
Sbjct: 22901 KNNEYIFRVRAVNKYGPGVPVES-EPIVARNSFTIPS-------PPGIPEEVGT------ 22946

Query: 996   PFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPT--------DTILF---IRAARRVHS 1040
                GK    + WTK     G  ++   V  R   +        D +++   ++    +  
Sbjct: 22947 ---GKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEG 23003

Query: 1041  GTYQVTVRIENME-----DKATLVLQVVDK---PSPPQDLRVTDAWGLNVALEWKPPQDV 1092
               YQ  V   N        +A+  +   +    P PP   RV D    +++L W  P   
Sbjct: 23004 CDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYD 23063

Query: 1093  GNTELWGYTVQKADKKTMEWFTVLEH--YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
             G T++ GY ++  +K T +W+ V  +   R T   VP+L +G  Y FRV + N+ G S+ 
Sbjct: 23064 GGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEY 23123

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKP 1210
             + +  E   + R  I          D   A    + +  R   AG +  L  +V G P P
Sbjct: 23124 SESIAEIEPVERIEIP---------DLELADDLKKTVTIR---AGASLRLMVSVSGRPPP 23171

Query: 1211  KISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
              I+W K G+DL   A         +L ++  K   +D G Y   A N  G+
Sbjct: 23172 VITWSKQGIDLASRAIIDTTESYSLLIVD--KVNRYDAGKYTIEAENQSGK 23220



 Score = 95.1 bits (235), Expect = 4e-19
 Identities = 68/224 (30%), Positives = 97/224 (43%), Gaps = 4/224 (1%)

Query: 391  DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVK 450
            +A V W K G +I  S  K+   + G K  L I+     D+  Y   V G+K S  LFV 
Sbjct: 5207 EANVIWSK-GPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVT 5265

Query: 451  EPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRH 510
               +    PLEDQ V  G+   F CE+S E   V W K+  +L    T       +G+ H
Sbjct: 5266 GIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVL--ISSEGKTH 5323

Query: 511  HLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSD 570
             L + E  L+D            + A+L V E        + D     KD+   KCEVS 
Sbjct: 5324 KLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVS- 5382

Query: 571  ENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
            ++V   W K+G+E+VP  +  +   G    L I      D+ +Y
Sbjct: 5383 KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEY 5426



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 97/413 (23%), Positives = 161/413 (38%), Gaps = 53/413 (12%)

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P  + +++VS  ++++ W PPE  G   +  Y VE      + W    Q +   TSI
Sbjct: 19183 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVAR-TSI 19241

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGA-----------PVTTTEPVTVQEILQRPRLQLPRH 978
              +  L TG+   FRV A N  G  +           P +   P    +++   +  +   
Sbjct: 19242 KIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTM--- 19298

Query: 979   LRQTIQKKVGEPVNLLIPF--QGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAAR 1036
                T Q  V +  + +I +  + K R  + W+K  + L  +   ++ S  D  L      
Sbjct: 19299 -LVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIAD-TQMKVSGLDEGLM----- 19351

Query: 1037  RVHSGTYQVTVRIENME-----DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQD 1091
                   Y+  V  EN+       K+   +   D   PP    VT+    +V+L+W  P  
Sbjct: 19352 ------YEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHY 19405

Query: 1092  VGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
              G  ++ GY V++ +     W      + + T+  V EL     Y FRVF++N       
Sbjct: 19406 DGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSE 19465

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVRGS 1207
              + +  P+ +               D  E P     +  R VI   AG    +   + G 
Sbjct: 19466 PSESTGPIIVK--------------DDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGR 19511

Query: 1208  PKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             P P ISW K+G+++ E AR  + S      L ++     D G YV    N+ G
Sbjct: 19512 PLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG 19564



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 98/428 (22%), Positives = 164/428 (38%), Gaps = 61/428 (14%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P  +  ++V+  +++L W PP+  G   ++ Y VE      + W   +      T
Sbjct: 15937 GPPTGPVKM--DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVART 15993

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQ----LPRHLRQTI 983
             +I    L TG    FR+ A N  G    + + EP   Q   + P       +    R ++
Sbjct: 15994 TIKACRLKTGCEYQFRIAAENRYGKSTYLNS-EPTVAQYPFKVPGPPGTPVVTLSSRDSM 16052

Query: 984   QKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
             + +  EP++      +    + K R  + W K           +  +P     F +    
Sbjct: 16053 EVQWNEPISDGGSRVIGYHLERKERNSILWVK-----------LNKTPIPQTKF-KTTGL 16100

Query: 1038  VHSGTYQVTVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
                  Y+  V  EN+          +  +     D P  P+ + VT     +V L+WK P
Sbjct: 16101 EEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRN---SVTLQWKKP 16157

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF- 1147
                G +++ GY V+K +     W      +   TH  V  L+  + Y FRV ++N  G  
Sbjct: 16158 TYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVF 16217

Query: 1148  -----SDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCC 1202
                  S  A T ++ V  PR               S  P +   +V   V AG +  +  
Sbjct: 16218 SEPSESTGAITARDEVDPPR--------------ISMDPKYKDTIV---VHAGESFKVDA 16260

Query: 1203  AVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEA 1262
              + G P P I W K   +L   AR  + S     +L ++     D G Y+ +A N+ GE 
Sbjct: 16261 DIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGER 16320

Query: 1263  RCECRLEV 1270
                  ++V
Sbjct: 16321 SVTVNVKV 16328



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 114/418 (27%), Positives = 156/418 (37%), Gaps = 43/418 (10%)

Query: 870  PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGC--SEWVAALQGLTEHT 927
            P  P +   ED+  T+V  KW PP   G   +  Y++E   +    SEW+     L  H 
Sbjct: 8497 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTL-RHC 8555

Query: 928  SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
               V  L  G   LFRVRA N  GPG P  + +P+  ++    P             K +
Sbjct: 8556 KYSVTKLIEGKEYLFRVRAENRFGPGPPCVS-KPLVAKDPFGPP---------DAPDKPI 8605

Query: 988  GEPV--NLLIPFQGKPR----PQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSG 1041
             E V  N ++    +P+    P + +  E + +     S  N      L       +   
Sbjct: 8606 VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGL 8665

Query: 1042 TYQVTVRIENMEDKATL--------VLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
            TY   V  EN                   +  P PP   RVTD     + LEW+PP   G
Sbjct: 8666 TYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNG 8724

Query: 1094 NTELWGYTVQKADKKTMEWFTVLEHYRRTH-CVVPELIIGNGYYFRVFSQNMVGFSDRAA 1152
              E+ GY V K    T EW    E   +     V E+  G  Y  RV + N  G      
Sbjct: 8725 GGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGE 8784

Query: 1153 TTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKI 1212
            T  +PV +  P    EPP  + LD S             ++AG T  +   V G P P  
Sbjct: 8785 T--QPVTVAEP---QEPPAVE-LDVSVKGGI-------QIMAGKTLRIPAVVTGRPVPTK 8831

Query: 1213 SWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             W K   +L +D R  + +      L I+     D G YV  ATN  G      R+EV
Sbjct: 8832 VWTKEEGELDKD-RVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 8888



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 101/405 (24%), Positives = 158/405 (39%), Gaps = 35/405 (8%)

Query: 867   IGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
             +G P  PT  +  ++V+   ++LKW PP+  G   +  Y +E      ++WV     + +
Sbjct: 13768 VGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAV-Q 13826

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGA-----PVTTTEPVTVQEILQRPRLQLPRH-- 978
              T+  V  L  G    FRV A N  G G      P+    P  V +    P +   RH  
Sbjct: 13827 KTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDS 13886

Query: 979   --LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQ-PLAGEEVSIRNSPTDTILFIRAA 1035
               L  T  KK G         + K R  + W +  + P+   +  +           R  
Sbjct: 13887 VSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVM 13946

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
                 +G     V   ++  +  + L  +D P  P+ + +T     +V L W  P+  G  
Sbjct: 13947 AINLAG-----VGKPSLPSEPVVALDPIDPPGKPEVINITRN---SVTLIWTEPKYDGGH 13998

Query: 1096  ELWGYTVQKADKKTMEWFTVLEHYRRTHCV--VPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
             +L GY V+K D  +  W     H     C   V +L+ G  Y FR+ ++N  G     + 
Sbjct: 13999 KLTGYIVEKRDLPSKSWMKA-NHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 14057

Query: 1154  TKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML-CCAVRGSPKPKI 1212
             + E +        YE P    LD    P+    L   ++ AG T +L   ++ G P PK 
Sbjct: 14058 STETIICKDE---YEAPTI-VLD----PTIKDGL---TIKAGDTIVLNAISILGKPLPKS 14106

Query: 1213  SWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
             SW K G D+      ++ S      L I+     D G Y   ATN
Sbjct: 14107 SWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATN 14151



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 65/244 (26%), Positives = 113/244 (46%), Gaps = 6/244 (2%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            +V +G  ++L V+++    E  W+K+GQE+Q S   +I         L I   +  D   
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID-KQSHMLLIEDMTKEDAGN 2378

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVE 492
            Y   +     ST   V    V +  PL+D  V+ G +   EC+VS  +   VKW  +  +
Sbjct: 2379 YSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQ 2438

Query: 493  LTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIA 552
            +  ++  +   K  G +  L+IN     D G Y L     +    L V+  K+++ + + 
Sbjct: 2439 IKPDDRVQAIVK--GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLR 2494

Query: 553  DLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEA 612
            DL        VF+ E+S   +  +W    KE+ P S+ K+   G+++KLT+ ++   DE 
Sbjct: 2495 DLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEG 2554

Query: 613  DYSF 616
             Y+F
Sbjct: 2555 KYTF 2558



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 107/447 (23%), Positives = 169/447 (37%), Gaps = 74/447 (16%)

Query: 846   VYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYS 905
             V A N+ G +  + +       GPP  P     ++VS   V + W PP   G   +  Y 
Sbjct: 18079 VTATNSAGTATENLSVIVLEKPGPPVGPVRF--DEVSADFVVISWEPPAYTGGCQISNYI 18136

Query: 906   VEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
             VE      + W   +      T+I +  L TG    FR+ A N  G  AP+ + + V VQ
Sbjct: 18137 VEKRDTTTTTW-HMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDS-KAVIVQ 18194

Query: 966   EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSI 1021
                + P                G P    +    K +  V W +     G  + G  +  
Sbjct: 18195 YPFKEP----------------GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQ 18238

Query: 1022  RNSPTDTILFIRAARRVHSGT------------YQVTVRIENME--------DKATLVLQ 1061
             +    ++IL+++  +     T            Y+  V  EN+          +  +   
Sbjct: 18239 KEK--NSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD 18296

Query: 1062  VVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYR 1120
               D P  P+ + +T     NV L+WK P   G +++ GY V+K D     W      +  
Sbjct: 18297 PCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVL 18353

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGF------SDRAATTKEPVFIPRPGITYEPPNYKA 1174
              T   V  L+    Y FRV ++N  G       S  A T ++ +  P   +    P YK 
Sbjct: 18354 ETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLD---PKYKD 18410

Query: 1175  LDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGED-ARFRMFSKQ 1233
             +                V AG T +L   +RG P P + W K+G +L E  AR  + S  
Sbjct: 18411 VIV--------------VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTI 18456

Query: 1234  GVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                TL ++     DGG Y+ + +N+ G
Sbjct: 18457 QKTTLVVKDCIRTDGGQYILKLSNVGG 18483



 Score = 90.9 bits (224), Expect = 7e-18
 Identities = 68/227 (29%), Positives = 112/227 (49%), Gaps = 8/227 (3%)

Query: 386  ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSL--ADDAAYQCVVGGEKC 443
            E+++ D   +W   G+ ++ S +  I ++ G KR LT+ +  L  A +  YQ +      
Sbjct: 5114 EISEADIPGQWKLKGELLRPSPTCEI-KAEGGKRFLTLHKVKLDQAGEVLYQAL--NAIT 5170

Query: 444  STELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRF 503
            +  L VKE  +    PL+D  V   ++  FEC ++ E A V W K G ++ +    K+  
Sbjct: 5171 TAILTVKEIELDFAVPLKDVTVPERRQARFECVLTRE-ANVIWSK-GPDIIKSSD-KFDI 5227

Query: 504  KKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAV 563
              DG++H L+IN++  +D G Y     G +  A L V   +L+    + D  V   + A 
Sbjct: 5228 IADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETAT 5287

Query: 564  FKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPAD 610
            F CE+S E +  VW KN  +L     + +S  G+ HKL + +VT  D
Sbjct: 5288 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDD 5334



 Score = 90.5 bits (223), Expect = 9e-18
 Identities = 108/430 (25%), Positives = 157/430 (36%), Gaps = 64/430 (14%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP  P    + D+     SL W  P   G   +  Y VE C     +WV AL  +T+ T
Sbjct: 12688 GPPQPP--FDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTK-T 12744

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
             S  V  L  G   +FRVRA N  G   P+T+                 P+ + Q      
Sbjct: 12745 SCRVGKLIPGQEYIFRVRAENRFGISEPLTS-----------------PKMVAQFPFGVP 12787

Query: 988   GEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARR-VHSGT 1042
              EP N  +    K    V W +     G P+ G    I     +++L+++A    V S  
Sbjct: 12788 SEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG--YLIERKERNSLLWVKANDTLVRSTE 12845

Query: 1043  YQVTVRIENME----------------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEW 1086
             Y     +E +E                 K T  +       PP    V D     V+L W
Sbjct: 12846 YPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIW 12905

Query: 1087  KPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNG------YYFRVF 1140
               P+  G +++ GY V+       +W   +      H +  E     G      Y FR  
Sbjct: 12906 ARPKHDGGSKIIGYFVEACKLPGDKW---VRCNTAPHQIPQEEYTATGLEEKAQYQFRAI 12962

Query: 1141  SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200
             ++  V  S  +  + +PV I    +   PP    +D S A          +V AG    L
Sbjct: 12963 ARTAVNISPPSEPS-DPVTILAENV---PPR---IDLSVAMKSLL-----TVKAGTNVCL 13010

Query: 1201  CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                V G P P +SW K+G  L      +M  ++ + TLE+      D G Y   A N  G
Sbjct: 13011 DATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSG 13070

Query: 1261  EARCECRLEV 1270
                   +L+V
Sbjct: 13071 SKSATIKLKV 13080



 Score = 90.5 bits (223), Expect = 9e-18
 Identities = 111/461 (24%), Positives = 182/461 (39%), Gaps = 71/461 (15%)

Query: 727   VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG---EDQVNLTVKVIDVPDAPAAPKISNV 783
             ++ TK ++    EG E E    + V+ +N VG     +V+      D  D P  P+   +
Sbjct: 18254 IQDTKFKTTGLDEGLEYE----FKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVI 18309

Query: 784   GEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYE 843
               ++ T++W+ PAYDGG  I GYI+E+K     RWM+ +F  + E       ++E   YE
Sbjct: 18310 TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYE 18369

Query: 844   MRVYAVNAIG-MSRPSPASQPFM---PIGPPSEPTHLAVEDV-----SDTTV---SLKWR 891
              RV A NA G  S PS +S        I  P+       +DV      +T V    ++ +
Sbjct: 18370 FRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGK 18429

Query: 892   PPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG 951
             P   V     DG  +E            ++   + T+++VKD        + ++  N+ G
Sbjct: 18430 PIPDV-VWSKDGKELEETAARME-----IKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 18483

Query: 952   PGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN-LLIPFQGKPRPQVTWTKE 1010
                  T + P+TV ++L RP                G P   L +      +  + W   
Sbjct: 18484 -----TKSIPITV-KVLDRP----------------GPPEGPLKVTGVTAEKCYLAWNPP 18521

Query: 1011  GQPLAGEEVS---IRNSPTDTILFIRAARRVHSGTYQVTVRI------------------ 1049
              Q   G  +S   I    T  + + + +  V +  Y+VT  +                  
Sbjct: 18522 LQD-GGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIG 18580

Query: 1050  ENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
             E +E            P PP    V+     ++ + W  P D G TE+ GY ++K DK+ 
Sbjct: 18581 EPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEG 18640

Query: 1110  MEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             + W     +        V  L  G+ Y FRV ++N  G  +
Sbjct: 18641 VRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGE 18681



 Score = 89.0 bits (219), Expect = 3e-17
 Identities = 99/416 (23%), Positives = 166/416 (39%), Gaps = 40/416 (9%)

Query: 359  EKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAK 418
            E +   F+K ++    + K  +     E+++ D  V+W+K+ QE+Q++    I +     
Sbjct: 3008 EARHIEFRKHIKDIKVLEK-KRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVH 3066

Query: 419  RTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVS 478
            R L I    ++D   Y  V GG   + +LFV+   V I    ++  V+  QR   E EV+
Sbjct: 3067 RLL-IPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVN 3125

Query: 479  EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAEL 538
            E+     W KDG+E+  +   ++++  + + H + I+E    DAG Y       ++   L
Sbjct: 3126 EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL 3185

Query: 539  IVQ-EKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIG 596
             V   +  +V Q +  + V +   A F   +S      + W K  + L    + K  H G
Sbjct: 3186 YVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDG 3245

Query: 597  RVHKLTIDDVTPADEADYSFVPEG--FACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGR 654
            + + L + +  P D A Y+   +        SA L  +EV     P QE P         
Sbjct: 3246 QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLS-VEVPEVVSPDQEMPVYPPAIITP 3304

Query: 655  IPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFD 714
            + DT V   G   R    +SG       + K                            D
Sbjct: 3305 LQDT-VTSEGQPARFQCRVSGTDLKVSWYSK----------------------------D 3335

Query: 715  KKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE--DQVNLTVKV 768
            KK+  +     R+   +D     +  A  EDEG YT    N VG+     NL+++V
Sbjct: 3336 KKI--KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEV 3389



 Score = 89.0 bits (219), Expect = 3e-17
 Identities = 135/650 (20%), Positives = 234/650 (36%), Gaps = 98/650 (15%)

Query: 661   VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD------------APEDTGDS 708
             V A NK  +  P+  DP   V+ Q   T  + AP  P P              PE  G S
Sbjct: 21821 VSAVNKFGVGRPLDSDP---VVAQIQYTVPD-APGIPEPSNITGNSITLTWARPESDGGS 21876

Query: 709   D--EWVFDKKLLCETEGRVRVETTKDRSI----FTVEGAEKEDEGVYTVTVKNPVGEDQV 762
             +  +++ +++   E +    V+    R I    F V G  + +E  + V  +N  G    
Sbjct: 21877 EIQQYILERR---EKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPA 21933

Query: 763   NLTVKVI------DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSY 816
             +   ++I      + P  P   K+++  + + +++W  P +DGG  I+GYI+E  K    
Sbjct: 21934 SGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLG 21993

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIG----------MSRPSPASQPFMP 866
              W ++N +   +  +    +  G  Y+ RV A+N  G          +      + P + 
Sbjct: 21994 DWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELD 22053

Query: 867   IGPPSEPTHLAVEDVS---------DTTVSLKWRPPE-----RVGAGGLDGYSVEYCPEG 912
             I    + TH+     S           T +  W  P+     R      D +S     E 
Sbjct: 22054 IDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-LTVEN 22112

Query: 913   CSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQ--R 970
             C+   A    LT      V++      + F V+  +  GP  P+T  +       L    
Sbjct: 22113 CNRNDAGKYTLT------VENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDA 22166

Query: 971   PRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTIL 1030
             P L     +   + +K             +   + +W    +    +   + +       
Sbjct: 22167 PLLDGGARIHHYVVEK-------------REASRRSWQVISEKCTRQIFKVNDLAEGVPY 22213

Query: 1031  FIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQ 1090
             + R +       Y V    E  E      +   ++P+PP+ L V D    +  L W  P 
Sbjct: 22214 YFRVSA---VNEYGVGEPYEMPEP-----IVATEQPAPPRRLDVVDTSKSSAVLAWLKPD 22265

Query: 1091  DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
               G + + GY ++   K +  W     H ++    V  L+    Y FRV ++N  G+S+ 
Sbjct: 22266 HDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEP 22324

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKP 1210
                    V I  P I  EP        ++    T  L+     AG    +   + G P P
Sbjct: 22325 REAFSS-VIIKEPQI--EPT-------ADLTGITNQLITCK--AGSPFTIDVPISGRPAP 22372

Query: 1211  KISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             K++W    + L E  R  + + +   TL ++     D G Y     N  G
Sbjct: 22373 KVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAG 22422



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 71/263 (26%), Positives = 119/263 (45%), Gaps = 10/263 (3%)

Query: 375  VSKGHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            V +G K  L  +++  D   VKW  N ++I+           G K+ L I++   +D+  
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVK-GTKQRLVINRTHASDEGP 2468

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
            Y+ +VG  + +  L V++  + I R L D      Q V FE E+S  G  V W     E+
Sbjct: 2469 YKLIVGRVETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEI 2526

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIAD 553
              + + KY+ +  G+ + L +   M +D G Y           +L V    +   + + D
Sbjct: 2527 --KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPLTD 2582

Query: 554  LMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
              V    +AVF+CEV++ + +G WL++GK L   + I+    G   +L I      D  +
Sbjct: 2583 QTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGE 2642

Query: 614  YSFVPEGFACNLSAKLHFMEVKI 636
            Y++  +      SAKL    VKI
Sbjct: 2643 YTY--KVATSKTSAKLKVEAVKI 2663



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 156/799 (19%), Positives = 296/799 (37%), Gaps = 121/799 (15%)

Query: 1     MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASN--KYGLA 58
             +P      ++ F K   S E+A  +  V E+   RA  +V W + G  +  +   ++  +
Sbjct: 26407 LPVSAPPKITQFLKAEASKEIAKLT-CVVESSVLRAK-EVTWYKDGKKLKENGHFQFHYS 26464

Query: 59    TEGTRHTLTVREVGPADQGSYAVI----AGSSKVKFDLKVIEAEKAEPMLAPAPAPAEAT 114
              +GT + L +  +  +DQG Y        G+SK                        +A 
Sbjct: 26465 ADGT-YELKINNLTESDQGEYVCEISGEGGTSKTNLQFM-----------------GQAF 26506

Query: 115   GAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIG---LFVMRPQDGEVTVGGS 171
              +  E  +  +E  +S    K + S       P AP+ PI    + V   QD  V+    
Sbjct: 26507 KSIHEKVSKISETKKS--DQKTTESTVTRKTEPKAPE-PISSKPVIVTGLQDTTVSSDSV 26563

Query: 172   ITFSARVAGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQ 230
               F+ +  G      P   W K GK +    K         S D+    +  E+H TD  
Sbjct: 26564 AKFAVKATGEPR---PTAIWTKDGKAITQGGKYKL------SEDKGG--FFLEIHKTDTS 26612

Query: 231   PAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDT 290
              +  G Y C V        S+  LT+ +A+   +   +S  + + +    + +       
Sbjct: 26613 DS--GLYTCTVKNSAGSVSSSCKLTI-KAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQ 26669

Query: 291   GILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLK 350
               L  S  +K  ++    + +  E  ++  + E ++++  +  E+      +T       
Sbjct: 26670 KALR-SEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKT----- 26723

Query: 351   RLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKY 410
                    +E ++ A  K       +++G ++ L   +A    +VKW+ NG E+  S  +Y
Sbjct: 26724 ---SQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA-TDVKWVLNGVELTNS-EEY 26778

Query: 411   IFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELF----VKEPPVLITRPLED 462
              +   G+ +TLTI Q S  D+    C+     G  KC  +L     + + P  I++P   
Sbjct: 26779 RYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP-RS 26837

Query: 463   QLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLED 521
             Q +  GQ V F CE+S E   +++W K+ + ++          +    + L I  A + D
Sbjct: 26838 QNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS--ISRSRNVYSLEIRNASVSD 26895

Query: 522   AGHYAL--------CTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENV 573
             +G Y +        C++    +   +V+E   EV       ++        +   S ++V
Sbjct: 26896 SGKYTIKAKNFRGQCSATASLMVLPLVEEPSREV-------VLRTSGDTSLQGSFSSQSV 26948

Query: 574   RGVWLKNGKELVPDSRIKVSHIGRVH--KLTIDDVTPADEADYSFVPEGF--ACNLSAKL 629
             +    K        S    S +  +    ++   ++   E+        F    N++   
Sbjct: 26949 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLE 27008

Query: 630   HFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQ 689
                   +    R  PPKI       +P  I +  G  L +    +G+P P V W      
Sbjct: 27009 SSTSKMLKAGIRGIPPKIE-----ALPSDISIDEGKVLTVACAFTGEPTPEVTWSCG--- 27060

Query: 690   GNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVY 749
                                      +K+  + +GR  +E T D +   +   +K+D G+Y
Sbjct: 27061 ------------------------GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLY 27096

Query: 750   TVTVKNPVGEDQVNLTVKV 768
             T+++ N  G D   + + +
Sbjct: 27097 TLSLGNEFGSDSATVNIHI 27115



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 67/265 (25%), Positives = 115/265 (43%), Gaps = 6/265 (2%)

Query: 375  VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY 434
            V +G       EL+     V W KN  ++  S +  +  S G    L + + +L D +  
Sbjct: 5280 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRT-VLISSEGKTHKLEMKEVTLDDISQI 5338

Query: 435  QCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELT 494
            +  V     + +L V E     T  L D+  +    +  +CEVS++   VKW KDG E+ 
Sbjct: 5339 KAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKD-VPVKWFKDGEEIV 5397

Query: 495  REETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADL 554
                 KY  K DG R  L I +A L+D G Y       +  A + V+ + ++V + +  +
Sbjct: 5398 PSP--KYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGV 5455

Query: 555  MVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
             V   + A F+ E+S+ +V G W   G+ L      ++   G+ H L + +       + 
Sbjct: 5456 EVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEV 5515

Query: 615  SFVPEGFACNLSAKLHFMEVKIDFV 639
            SF  +      +A L   E+ + F+
Sbjct: 5516 SF--QAANAKSAANLKVKELPLIFI 5538



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 106/418 (25%), Positives = 147/418 (35%), Gaps = 55/418 (13%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P  +  ++VS   V+  W PPE  G   +  Y VE      + WV  L      T
Sbjct: 14855 GPPTGP--IKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVE-LATTVIRT 14911

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTT-----EPVTVQEILQRPRLQLPRHLRQT 982
             +     L TG    FRV+A N  G G  +T+       P  V      P++        T
Sbjct: 14912 TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFKVPGPPGTPQVTAVTKDSMT 14971

Query: 983   IQ-----KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
             I         G P+ L    + K R  + W    + L    +   +  TD I        
Sbjct: 14972 ISWHEPLSDGGSPI-LGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGI-------- 15022

Query: 1038  VHSGTYQVTVRIENMEDKAT--------LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
                  Y+  V  ENM  K+         L L  +D P  P  L +T      V L+W  P
Sbjct: 15023 ----AYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRH---TVTLKWAKP 15075

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS 1148
             +  G  ++  Y V+K D     W      +       V  L     Y FRV ++N     
Sbjct: 15076 EYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKN----- 15130

Query: 1149  DRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVR 1205
               AA    P   P   IT         D  EAP     +  +  +   AG    L   V 
Sbjct: 15131 --AAGAISPPSEPSDAITCR-------DDVEAPKIKVDVKFKDTVILKAGEAFRLEADVS 15181

Query: 1206  GSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             G P P + W K+G +L   A+  +        L  +     D G Y   ATN  G A+
Sbjct: 15182 GRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAK 15239



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 99/432 (22%), Positives = 160/432 (37%), Gaps = 45/432 (10%)

Query: 846   VYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYS 905
             +   N +G    S          PP  P     +DVS  +++L W PP   G   +  Y 
Sbjct: 16997 ITVANVVGQKTASIEIVTLDKPDPPKGPVKF--DDVSAESITLSWNPPLYTGGCQITNYI 17054

Query: 906   VEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
             V+      + W   +      T++ V  L TG    FR+ A N  G    + + +P+  Q
Sbjct: 17055 VQKRDTTTTVW-DVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALES-DPIVAQ 17112

Query: 966   EILQRPRLQ----LPRHLRQTIQKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLA 1015
                + P            + ++  +  EPVN      +    + K R  + WTK  + + 
Sbjct: 17113 YPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTII 17172

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVT 1075
              +      +  + I +     RV++    V V   +   +  +     D P  P+ + V 
Sbjct: 17173 HDTQFKAQNLEEGIEY---EFRVYAENI-VGVGKASKNSECYVARDPCDPPGTPEPIMVK 17228

Query: 1076  DAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNG 1134
                   + L+W  P   G + + GY V+K D     W      +   T   V  L     
Sbjct: 17229 RN---EITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQR 17285

Query: 1135  YYFRVFSQNMVGFSDRAA------TTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLV 1188
             Y FRV ++N  G   + +      T K+ V +PR               S  P F   +V
Sbjct: 17286 YEFRVIAKNAAGAISKPSDSTGPITAKDEVELPR--------------ISMDPKFRDTIV 17331

Query: 1189  NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDG 1248
                V AG T  L   V G P P I W +   ++ E AR  + +      L ++     DG
Sbjct: 17332 ---VNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 17388

Query: 1249  GIYVCRATNLQG 1260
             G Y+ RA+N+ G
Sbjct: 17389 GQYILRASNVAG 17400



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 109/404 (26%), Positives = 150/404 (37%), Gaps = 61/404 (15%)

Query: 847   YAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSV 906
             Y V A   +    A      +  P    +L + DVS    ++ W PPE  G   +  Y +
Sbjct: 11969 YVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYIL 12028

Query: 907   EYCPEGCSEWVA-ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
             E C      W   +   LT  T+  V  L  G   +FRVRA N  G G P T ++PV   
Sbjct: 12029 EKCETKRMVWSTYSATVLTPGTT--VTRLIEGNEYIFRVRAENKIGTGPP-TESKPV--- 12082

Query: 966   EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAG----- 1016
                          + +T   K G P    +    K    V W       G+ + G     
Sbjct: 12083 -------------IAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEK 12129

Query: 1017  -EEVSIRNSPTDTILFIRAARRVHS----GTYQVTVRIEN--------MEDKATLVLQVV 1063
              E+ S R  P +         +V +      YQ  V+ EN        +  +  +    +
Sbjct: 12130 KEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKDPI 12189

Query: 1064  DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK----ADKKTMEWF---TVL 1116
             + P PP + RV D    ++ L W  P   G   + GY V+     AD    E +      
Sbjct: 12190 EPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAA 12249

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALD 1176
                 R    V  L     Y FRV +QN VG   R A  KE +   +P    EPP    LD
Sbjct: 12250 AQLVRKEFTVTSLDENQEYEFRVCAQNQVGIG-RPAELKEAI---KPKEILEPPEID-LD 12304

Query: 1177  FSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLD 1220
              S      + LV   V AG    L   VRG P PK++W K G+D
Sbjct: 12305 AS-----MRKLV--IVRAGCPIRLFAIVRGRPAPKVTWRKVGID 12341



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 110/462 (23%), Positives = 181/462 (39%), Gaps = 59/462 (12%)

Query: 769   IDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQE 828
             +D  D P  P   N+   + T++W  P Y GG  I  YI+E++   + RW++ NF  I E
Sbjct: 15049 LDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILE 15108

Query: 829   LSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSL 888
                    + E   YE RV A NA G   P       +      E   + V+     TV L
Sbjct: 15109 NEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVIL 15168

Query: 889   KWRPPERVGA--GGLDGYSVEYCPEGCS-EWVAALQGLTE--HTSILVKDL--------- 934
             K     R+ A   G    ++E+  +G   E  A L+       T+++ KD          
Sbjct: 15169 KAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYT 15228

Query: 935   -----PTG-ARLLFRVRAHNMAG-PGAPVTTTEPVTVQEILQ-RPRLQLPRHLRQTIQKK 986
                  P G A+ +F V+  +  G P  P+  TE  + + +L   P L             
Sbjct: 15229 LTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLD-----------D 15277

Query: 987   VGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRN--SPTDTILFIRAARRVHSGTYQ 1044
              G  ++  I  Q +   ++ WT     +   ++ +       + I  + A  +   G   
Sbjct: 15278 GGAKIDHYI-VQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVG--- 15333

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK 1104
                  E +E +  L +     P PP++  VT     ++ + W  P   G +E+  Y V++
Sbjct: 15334 -----EPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVER 15388

Query: 1105  ADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPV 1158
              DK    W     +        V  L  G+ Y FR+ ++N  G S  + T+      + V
Sbjct: 15389 RDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTV 15448

Query: 1159  FIPRPGITYEPPNYKALDFSEAP---SFTQPLVN-RSVIAGY 1196
             F P P     P N + LD S +    ++ +P+ +  S I GY
Sbjct: 15449 FKPGP-----PGNPRVLDTSRSSISIAWNKPIYDGGSEITGY 15485



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 66/214 (30%), Positives = 97/214 (45%), Gaps = 18/214 (8%)

Query: 1064  DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL-EHYRRT 1122
             +KP  P    +T     +  + WKPP   G  ++  Y ++K +KK  +W +V  E  R T
Sbjct: 24518 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 24577

Query: 1123  HCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPS 1182
                V  LI G  Y FRV  +N+ G S+ +  + EP+  P+  +  + P++K         
Sbjct: 24578 VFSVKNLIEGLEYEFRVKCENLGGESEWSEIS-EPI-TPKSDVPIQAPHFK--------- 24626

Query: 1183  FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA---RFRMFSKQGVLTLE 1239
               + L N +V     A L C V G PKP + W++ G ++  D    R + F K G   L 
Sbjct: 24627 --EELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEF-KGGYHQLI 24683

Query: 1240  IRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
             I      D  +Y  RATN  G       LEV VP
Sbjct: 24684 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVP 24717



 Score = 82.0 bits (201), Expect = 3e-15
 Identities = 91/374 (24%), Positives = 142/374 (37%), Gaps = 41/374 (10%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P  + ++++  T++++ W PPE  G   L GY VE        W+   + +T  T
Sbjct: 23528 GPPTGP--IKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRST 23585

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
                 + L  G   +FRV A N  G G+ + +     V E     R+  P    Q      
Sbjct: 23586 FKFTR-LTEGNEYVFRVAATNRFGIGSYLQSE----VIECRSSIRIPGPPETLQIFDVSR 23640

Query: 988   GEPVNLLIPFQGKPRPQVTW--TKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQV 1045
                     P +     QVT    +  +  A   V +   P  T+   R+        Y+ 
Sbjct: 23641 DGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPV-TMTRYRSTGLTEGLEYEH 23699

Query: 1046  TVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTEL 1097
              V   N           K  + +  +  P  PQ+ RVTD    +V+L W  P+D G +++
Sbjct: 23700 RVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKV 23759

Query: 1098  WGYTVQKADKKTMEWF------TVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRA 1151
              GY ++       EW       T +  Y  TH  +P+   G  Y FRV + N  G     
Sbjct: 23760 TGYLIEMQKVDQHEWTKCNTTPTKIREYTLTH--LPQ---GAEYRFRVLACNAGG----- 23809

Query: 1152  ATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPK 1211
                 EP  +P      E   Y   +  E   + + +  R    G    L   ++G P P 
Sbjct: 23810 --PGEPAEVPGTVKVTEMLEYPDYELDER--YQEGIFVRQ---GGVIRLTIPIKGKPFPI 23862

Query: 1212  ISWFKNGLDLGEDA 1225
               W K G D+ + A
Sbjct: 23863 CKWTKEGQDISKRA 23876



 Score = 81.3 bits (199), Expect = 6e-15
 Identities = 69/301 (22%), Positives = 127/301 (42%), Gaps = 26/301 (8%)

Query: 367  KKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGS---KYIFESIGAKRTLTI 423
            + ++   QV +  +  +  E+ + D +  W K+G EI        KY+ E       + I
Sbjct: 3104 RSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVER--RIHRMFI 3161

Query: 424  SQCSLADDAAYQCVVGGEKCSTELFVKEP-PVLITRPLEDQLVMVGQRVEFECEVS-EEG 481
            S+   +D   Y  V G  + S  L+V  P P  + + L+   V  G+   F   +S    
Sbjct: 3162 SETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQ 3221

Query: 482  AQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALA----- 536
             ++ W K+  E      FK +F  DGQ + L++ EA  EDA  Y         +A     
Sbjct: 3222 PKISWYKE--EQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSAS 3279

Query: 537  ------ELIVQEKKLEVYQS-----IADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELV 585
                  E++  ++++ VY       + D +      A F+C VS  +++  W    K++ 
Sbjct: 3280 LSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIK 3339

Query: 586  PDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPP 645
            P    +++     ++L I +  P DE  Y+FV       +S+  + + +++  + RQ   
Sbjct: 3340 PSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN-LSLEVQALDRQSSG 3398

Query: 646  K 646
            K
Sbjct: 3399 K 3399



 Score = 81.3 bits (199), Expect = 6e-15
 Identities = 100/418 (23%), Positives = 150/418 (35%), Gaps = 61/418 (14%)

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P  + + +VS    +L W PP   G   +  Y +E        W    + +     +
Sbjct: 14168 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHV 14227

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGE 989
               K L  G   +FRV A N  G G PV + EPV + +    P                G 
Sbjct: 14228 ATK-LIQGNEYIFRVSAVNHYGKGEPVQS-EPVKMVDRFGPP----------------GP 14269

Query: 990   PVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHS----- 1040
             P    +    K    V+W +     G  + G  V  R   +  + ++RA +   S     
Sbjct: 14270 PEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKS--LRWVRAIKTPVSDLRCK 14327

Query: 1041  -------GTYQVTVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALE 1085
                     TY+  V  EN            + L+      P PP +  VTD    + +L 
Sbjct: 14328 VTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLA 14387

Query: 1086  WKPPQDVGNTELWGYTVQKADKKTMEWF--TVLEHYRRTHCVVPELIIGNGYYFRVFSQN 1143
             W  P   G  E+ GY V+        W   T     R T  VVP+L     Y FR+ + N
Sbjct: 14388 WGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRITQFVVPDLQTKEKYNFRISAIN 14447

Query: 1144  MVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCA 1203
               G         EP  IP   I        A DF       + LV R   AG +  +   
Sbjct: 14448 DAGVG-------EPAVIPDVEIVERE---MAPDFELDAELRRTLVVR---AGLSIRIFVP 14494

Query: 1204  VRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
             ++G P P+++W K+ ++L   A     + +    L I +   +D G +V    N  G+
Sbjct: 14495 IKGRPAPEVTWTKDNINLKNRANIE--NTESFTLLIIPECNRYDTGKFVMTIENPAGK 14550



 Score = 78.2 bits (191), Expect = 5e-14
 Identities = 70/236 (29%), Positives = 112/236 (47%), Gaps = 14/236 (5%)

Query: 396  WLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVV---GGEKCST-ELFVKE 451
            W+K+G  I+ S  K+ F + G  R L I    L+D   Y CV+     EK ST +L V+E
Sbjct: 4846 WMKDGSNIRES-PKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEE 4904

Query: 452  PPVLITRPLEDQLVMV-GQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRH 510
             PV   + LE+++ +V GQ +   CE+++E   V W KDG ++  E+  +      G   
Sbjct: 4905 LPVRFVKTLEEEVTVVKGQPLYLSCELNKE-RDVVWRKDG-KIVVEKPGRIVPGVIGLMR 4962

Query: 511  HLIINEAMLEDAGHYALCTSGGQAL----AELIVQEKKLEVYQSIADLMVGAKDQAVFKC 566
             L IN+A   DAG Y +       L       +V+  +  + + I D  V  K  A+F C
Sbjct: 4963 ALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 5022

Query: 567  EVSDENVRGVWLKNGKEL--VPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEG 620
            +++ +     W K   E+   P+ + ++   G    L I +  P D A+Y+   EG
Sbjct: 5023 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEG 5078



 Score = 77.8 bits (190), Expect = 6e-14
 Identities = 98/433 (22%), Positives = 154/433 (35%), Gaps = 42/433 (9%)

Query: 847   YAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSV 906
             Y + A   S    A+     +  P  P  + +  +      L W PP   G   +  Y V
Sbjct: 13061 YTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIV 13120

Query: 907   EYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             +        W A +      TS  V+ L  G    FR+ A N  G G PV T EP   + 
Sbjct: 13121 DKRETSRPNW-AQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFT-EPAIAKN 13178

Query: 967   ILQRPRLQLPRHLRQTIQKKV-----------GEPVNLLIPFQGKPRPQVTWTKEGQ-PL 1014
                 P    P  +    +  +           G P+   +  + +    V WTK  + P+
Sbjct: 13179 PYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYL-LEKRETQAVNWTKVNRKPI 13237

Query: 1015  AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRV 1074
                 +        T    R      +G  +      +   KA         P PP   +V
Sbjct: 13238 IERTLKATGLQEGTEYEFRVTAINKAGPGK-----PSDASKAAYARDPQYPPGPPAFPKV 13292

Query: 1075  TDAWGLNVALEWKPPQDVGNTELWGYTVQ--KADKKTMEWFTVLEHYRRTHCVVPELIIG 1132
              D    +V+L W  P   G + + GY V+  +AD        + ++ ++T   V  L+  
Sbjct: 13293 YDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMED 13352

Query: 1133  NGYYFRVFSQNMVGFSDRAATTKE----PVFIPRPGITYEPPNYKALDFSEAPSFTQPLV 1188
               Y FRV++ N +G+SD +    +     + IP  G          LD        + L+
Sbjct: 13353 TQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEG---------ELD----ADLRKTLI 13399

Query: 1189  NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDG 1248
              R   AG T  L   V+G P PKI+W K  ++L +     + S      L       +D 
Sbjct: 13400 LR---AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDA 13456

Query: 1249  GIYVCRATNLQGE 1261
             G Y+    N  G+
Sbjct: 13457 GKYILTLENSCGK 13469



 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 65/250 (26%), Positives = 112/250 (44%), Gaps = 8/250 (3%)

Query: 375  VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY 434
            V++  +     E+A+ D++ +WL++G+ + ++ +    ES G KR L I+   L D   Y
Sbjct: 2585 VAESQEAVFECEVANPDSKGEWLRDGKHLPLTNN-IRSESDGHKRRLIIAATKLDDIGEY 2643

Query: 435  QCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQ-VKWLKDGVEL 493
               V   K S +L V+   V I + L++  V   Q   F  E++    + V+W+K+GV L
Sbjct: 2644 TYKVATSKTSAKLKVEA--VKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVL 2701

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIAD 553
               E  KY     G  + L I    + D   Y        A A L V+  K  + +   D
Sbjct: 2702 ESNE--KYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVK--IIKKPKD 2757

Query: 554  LMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
            +         F+  VS + V   W     E+ P  + ++    +VHKL + +++P+D  +
Sbjct: 2758 VTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGE 2817

Query: 614  YSFVPEGFAC 623
            Y+ V     C
Sbjct: 2818 YTAVVGQLEC 2827



 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 52/242 (21%), Positives = 99/242 (40%), Gaps = 3/242 (1%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            +V +  + +   E++      +WLK  QEI     ++     G K ++ I   +  D+A 
Sbjct: 5545 KVFEKDEAKFECEVSREPKTFRWLKGTQEIT-GDDRFELIKDGTKHSMVIKSAAFEDEAK 5603

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
            Y      +  S +L ++   +    PL+D      +   F  E+S +  +VKW K+   L
Sbjct: 5604 YMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL 5663

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIAD 553
                T     + +G+ H +   +  ++D     +   G  + A+L V E        + D
Sbjct: 5664 --HTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQD 5721

Query: 554  LMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
                 KD+ + +CE+S  +    W K+GKE+ P     +   G+   L +     +D   
Sbjct: 5722 YTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQ 5781

Query: 614  YS 615
            Y+
Sbjct: 5782 YT 5783



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 60/195 (30%), Positives = 92/195 (47%), Gaps = 17/195 (8%)

Query: 439  GGEKCSTEL----FVKEPPVLITRPLEDQLV----MVGQRVEFECEVSEEGAQVKWLKDG 490
            GGEK   E      +K  P+   + ++D ++     VG    FEC VS   A   W+KDG
Sbjct: 4791 GGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDG 4850

Query: 491  VELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQ----ALAELIVQEKKLE 546
              +   E+ K+RF  DG+   L I +  L DAG Y      G     + A+L+V+E  + 
Sbjct: 4851 SNI--RESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVR 4908

Query: 547  VYQSIADLMVGAKDQAVF-KCEVSDENVRGVWLKNGKELV-PDSRIKVSHIGRVHKLTID 604
              +++ + +   K Q ++  CE++ E    VW K+GK +V    RI    IG +  LTI+
Sbjct: 4909 FVKTLEEEVTVVKGQPLYLSCELNKER-DVVWRKDGKIVVEKPGRIVPGVIGLMRALTIN 4967

Query: 605  DVTPADEADYSFVPE 619
            D    D   Y+   E
Sbjct: 4968 DADDTDAGTYTVTVE 4982



 Score = 70.9 bits (172), Expect = 8e-12
 Identities = 62/255 (24%), Positives = 106/255 (41%), Gaps = 6/255 (2%)

Query: 386  ELADHDAEVKWLKNGQEIQMS-GSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCS 444
            ++A     +KW K   EI      K      G    L I      D A Y   + G++  
Sbjct: 5023 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYP 5082

Query: 445  TELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFK 504
             +L + E  V + +P+ED  +   +   F+ E+SE     +W   G  L    T +   K
Sbjct: 5083 AKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCE--IK 5140

Query: 505  KDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVF 564
             +G +  L +++  L+ AG            A L V+E +L+    + D+ V  + QA F
Sbjct: 5141 AEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQARF 5200

Query: 565  KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
            +C ++ E    +W K    +    +  +   G+ H L I+D    DE  Y+   EG    
Sbjct: 5201 ECVLTRE-ANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEG--KK 5257

Query: 625  LSAKLHFMEVKIDFV 639
             SA+L    +++ F+
Sbjct: 5258 TSARLFVTGIRLKFM 5272



 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 144/622 (23%), Positives = 227/622 (36%), Gaps = 79/622 (12%)

Query: 675   GDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRS 734
             G P   VI +  +T   K PA       + TG    ++ +KK L +        T    +
Sbjct: 18302 GRPEAIVITRNNVTLKWKKPAYDG--GSKITG----YIVEKKDLPDGRWMKASFTNVLET 18355

Query: 735   IFTVEGAEKEDEGVYTVTVKNPVG------EDQVNLTVK-VIDVPDAPAAPKISNVGEDS 787
              FTV G  ++    + V  +N  G      +    +T +  ID P+A   PK  +V    
Sbjct: 18356 EFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVH 18415

Query: 788   CTVQWEPPAYDGGQPILGYILERKKKKSYRWM-RLNF-DLIQELSHEARRMI--EGVVYE 843
                 +   A   G+PI   +  +  K+      R+     IQ+ +   +  I  +G  Y 
Sbjct: 18416 AGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYI 18475

Query: 844   MRVYAVNAIGMSRPSPASQPFMPI-GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLD 902
             +++   + +G ++  P +   +   GPP  P  L V  V+     L W PP + G   + 
Sbjct: 18476 LKL---SNVGGTKSIPITVKVLDRPGPPEGP--LKVTGVTAEKCYLAWNPPLQDGGANIS 18530

Query: 903   GYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPV 962
              Y +E        W      +      + K LP G   +FRV A N  G G P+ +  PV
Sbjct: 18531 HYIIEKRETSRLSWTQVSTEVQALNYKVTKLLP-GNEYIFRVMAVNKYGIGEPLESG-PV 18588

Query: 963   TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEE 1018
             T     + P                G P    +    K    VTW +     G  + G  
Sbjct: 18589 TACNPYKPP----------------GPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI 18632

Query: 1019  VSIR----------NSPTDTILFIRAARRVHSGTYQVTVRIENME-----DKATLVLQVV 1063
             +  R          N  T T L +R        +Y+  V  EN        + ++  +  
Sbjct: 18633 LEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRAC 18692

Query: 1064  DK---PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEH-- 1118
             D    P PP + +VTD    +V+L W  P   G   + GY V+  +    EW T      
Sbjct: 18693 DALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTG 18752

Query: 1119  YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFS 1178
              +     V +L     Y FR+ + N  G  + A      V   R     EPP  + LD  
Sbjct: 18753 LQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQER----IEPPEIE-LD-- 18805

Query: 1179  EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
                   + +V R   A  T  L   ++G P+P++ W K    L + A+  + S   +L +
Sbjct: 18806 --ADLRKVVVLR---ASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVI 18860

Query: 1239  EIRKPCPFDGGIYVCRATNLQG 1260
             +      FD G Y     N  G
Sbjct: 18861 D--NVTRFDSGRYNLTLENNSG 18880



 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 66/244 (27%), Positives = 95/244 (38%), Gaps = 30/244 (12%)

Query: 1034  AARRVHSGTYQVTVRIENME----------------DKATLVLQVVDKPSPPQDLRVTDA 1077
             A  + H  TY+VT   E  E                 + T  ++  + PSPP  L + D 
Sbjct: 14612 ATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIMDI 14671

Query: 1078  WGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYF 1137
                 V+L W  P+  G +++ GY ++   K + +W T +   +   CVV  L  G  Y F
Sbjct: 14672 TKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTVKGLECVVRNLTEGEEYTF 14730

Query: 1138  RVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYT 1197
             +V + N  G   R+A  +      RP I  E      LD        Q LV     AG  
Sbjct: 14731 QVMAVNSAG---RSAPRES-----RPVIVKEQTMLPELDLR---GIYQKLVIAK--AGDN 14777

Query: 1198  AMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
               +   V G PKP ++W K    L +  R    +      L I +    D G Y   A N
Sbjct: 14778 IKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN 14837

Query: 1258  LQGE 1261
             + GE
Sbjct: 14838 IVGE 14841



 Score = 66.6 bits (161), Expect = 1e-10
 Identities = 166/772 (21%), Positives = 275/772 (35%), Gaps = 163/772 (21%)

Query: 577  WLKNGKELVPD--SRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEV 634
            W  +G+++V D   ++ +   G    L I   TP+D  +++ V +  A   S  +    +
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDG-TQSLIIVPATPSDSGEWTVVAQNRAGRSSISVI---L 1499

Query: 635  KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAP 694
             ++ V  Q  P             + +  G++L + V  +G+P P ++W K         
Sbjct: 1500 TVEAVEHQVKPMFVEKLKN-----VNIKEGSRLEMKVRATGNPNPDIVWLK--------- 1545

Query: 695  ARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVK 754
                        +SD  V  K        ++R+E TK  +   ++    +D   YT T  
Sbjct: 1546 ------------NSDIIVPHKY------PKIRIEGTKGEAALKIDSTVSQDSAWYTATAI 1587

Query: 755  NPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
            N  G D     V V                     V++  P     +P    I+ R    
Sbjct: 1588 NKAGRDTTRCKVNV--------------------EVEFAEP-----EPERKLIIPRG--- 1619

Query: 815  SYRWMRLNFDLIQ--ELSHEARRMIEGVVYEMRVYA-------VNAIGMSRPSPASQP-- 863
            +YR   +    ++   L +   +  EG +Y+            + ++ + R  PA     
Sbjct: 1620 TYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECR 1679

Query: 864  FMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPE-GCSEWVAALQG 922
              PIG P+      + D      + + R     G   LD Y V Y  + G     A  + 
Sbjct: 1680 LTPIGDPTMVVEW-LHDGKPLEAANRLRMINEFGYCSLD-YGVAYSRDSGIITCRATNKY 1737

Query: 923  LTEHTS--ILVKD---------LPTGARLLFRVRA-HNMAGPGAPVTTTEPVTVQEILQR 970
             T+HTS  ++VKD         LP G + L R+     MA  GA    T   T Q+  Q+
Sbjct: 1738 GTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVT---TDQKEKQK 1794

Query: 971  PRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPTDTI 1029
            P + L     + ++   GE         G P+P+V W   GQ +   +   +R    D I
Sbjct: 1795 PDIVL---YPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY---DGI 1848

Query: 1030 LFIRAARRVHSGTYQVTVRIEN----MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALE 1085
             ++         T +V V  EN    +E K  L +Q        +D R      L  A E
Sbjct: 1849 HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQ------QREDFRSV----LRRAPE 1898

Query: 1086 WKPPQDVGNTELWGYTVQKADK-----KTMEWFTVLEHYRRTHCVVPELI---------- 1130
             +P   V       + VQK D+     +T E   +    R TH  VPE            
Sbjct: 1899 PRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRR 1958

Query: 1131 IGNGYYFRV---------------------------FSQNMVGFSDRAATTKEPVFIPRP 1163
               GYY  +                           +++ +     +A   +  + IP  
Sbjct: 1959 TEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIP-- 2016

Query: 1164 GITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGE 1223
              T++P   +     EAP   + + +++V  G  A     V G P P+  W+KNG+ +  
Sbjct: 2017 --TFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIER 2074

Query: 1224 DAR-FRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
              R +  + +  V  L IR     D    + +A N+ GE      L V+  Q
Sbjct: 2075 SDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ 2126



 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 64/246 (26%), Positives = 101/246 (41%), Gaps = 35/246 (14%)

Query: 15    KPRSVEVAAGSPAVFEAETERAGVK-VRWQRGGSDISASNKYGLATEGTRHTLTVREVGP 73
             KPRS+ V  G  A F  +T+   V  V W R G  +S S ++ + T   + T  +  V  
Sbjct: 26261 KPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQA 26320

Query: 74    ADQGSYAVIA----GSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGE 129
             +D+G+Y+V+     G  + +F L + +A   E  +   P          ++P P  +  E
Sbjct: 26321 SDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRV--------KSPEPRVKSPE 26372

Query: 130   SAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSAR------------ 177
             +  SPK   S   + P   +P +       + Q   V+    IT   +            
Sbjct: 26373 AVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTC 26432

Query: 178   VAGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGS 236
             V  +S+L+   V W+K GK      K   H Q H S D       +EL I +   +  G 
Sbjct: 26433 VVESSVLRAKEVTWYKDGK----KLKENGHFQFHYSADGT-----YELKINNLTESDQGE 26483

Query: 237   YRCEVS 242
             Y CE+S
Sbjct: 26484 YVCEIS 26489



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 102/453 (22%), Positives = 153/453 (33%), Gaps = 71/453 (15%)

Query: 820   RLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPAS-------QPFMPIGPPSE 872
             R+N ++   L   +  + +       VY V A   S  + A         P   +GP   
Sbjct: 21697 RMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGP--- 21753

Query: 873   PTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVK 932
                +   +++   ++L W  P   G   +  Y +E        W A ++   E  S    
Sbjct: 21754 ---IRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAW-ALIEDKCEAQSYTAI 21809

Query: 933   DLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ---EILQRPRLQLPRHLRQTI------ 983
              L  G    FRV A N  G G P+ + +PV  Q    +   P +  P ++          
Sbjct: 21810 KLINGNEYQFRVSAVNKFGVGRPLDS-DPVVAQIQYTVPDAPGIPEPSNITGNSITLTWA 21868

Query: 984   --QKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSG 1041
               +   G  +   I  + + +    W K           I   P     F +        
Sbjct: 21869 RPESDGGSEIQQYI-LERREKKSTRWVKV----------ISKRPISETRF-KVTGLTEGN 21916

Query: 1042  TYQVTVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
              Y+  V  EN           +     + V+ P PP  ++VTD     V+LEW  P   G
Sbjct: 21917 EYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDG 21976

Query: 1094  NTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAA 1152
               E+ GY ++       +W  V  E   +T   V +L  G  Y FRV + N  G  D   
Sbjct: 21977 GMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCE 22036

Query: 1153  TTKEPVFIPRPGITYEPPNYKALDFSEAP------SFTQPLVNRSVIAGYTAMLCCAVRG 1206
              T                  KA+D   AP      +F Q  V R   AG +  L  A +G
Sbjct: 22037 VTG---------------TIKAVDRLTAPELDIDANFKQTHVVR---AGASIRLFIAYQG 22078

Query: 1207  SPKPKISWFKNGLDLGEDARFRMFSKQGVLTLE 1239
              P P   W K   +L   A          LT+E
Sbjct: 22079 RPTPTAVWSKPDSNLSLRADIHTTDSFSTLTVE 22111



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 98/435 (22%), Positives = 159/435 (36%), Gaps = 53/435 (12%)

Query: 844   MRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDG 903
             ++ ++V  + + RP P + P            + V  VS  +  L W  P+  G   +  
Sbjct: 22423 VKTFSVTVVVIGRPGPVTGP------------IEVSSVSAESCVLSWGEPKDGGGTEITN 22470

Query: 904   YSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG-----PGAPVTT 958
             Y VE    G + W   +    + T I V  L       FRV + N  G       AP+  
Sbjct: 22471 YIVEKRESGTTAW-QLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIA 22529

Query: 959   TEPVTVQEILQRPRLQLPRHLRQTI--QKKVGEPVNLLIPF--QGKPRPQVTWTKEGQPL 1014
               P        RP +        +I  ++   +  + +I +  + K R  + W KE +  
Sbjct: 22530 EHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVP 22589

Query: 1015  AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRV 1074
               E        T  +  +    R ++      V   +   +  +    VD P  P+   V
Sbjct: 22590 CLE---CNYKVTGLVEGLEYQFRTYA-LNAAGVSKASEASRPIMAQNPVDAPGRPE---V 22642

Query: 1075  TDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTM---EW----FTVLEHYRRTHCVVP 1127
             TD     V+L W  P   G +++ GY +++     +    W    +T++     T   + 
Sbjct: 22643 TDVTRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALS 22702

Query: 1128  ELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPL 1187
             E   G+ Y FRV ++N  G   + + +  PV        Y PP  + LD           
Sbjct: 22703 E---GDTYEFRVLAKNAAGVISKGSESTGPVTCRDE---YAPPKAE-LDARLHGDLV--- 22752

Query: 1188  VNRSVIAGYTAMLCCAVRGSPKPKISWFKNG--LDLGEDARFRMFSKQGVLTLEIRKPCP 1245
                ++ AG   +L  AV G P+PKI W K    LDL E    +   K+   T  I+    
Sbjct: 22753 ---TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRA--TAVIKFCDR 22807

Query: 1246  FDGGIYVCRATNLQG 1260
              D G Y     N  G
Sbjct: 22808 SDSGKYTLTVKNASG 22822



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 81/335 (24%), Positives = 134/335 (40%), Gaps = 41/335 (12%)

Query: 950  AGPG---APVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
            AGPG   AP   T+PV VQ++++                  G  V       G P+P V 
Sbjct: 1028 AGPGEPAAPYFITKPV-VQKLVE------------------GGSVVFGCQVGGNPKPHVY 1068

Query: 1007 WTKEGQPLAGE---EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVV 1063
            W K G PL      +VS      +  L I       +G Y + VR ++ E  A+  L   
Sbjct: 1069 WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEE 1128

Query: 1064 DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKK-TMEWFTVLEHYRRT 1122
                     +    +   V    + P+ VG T   G+   + +K+   E   + +   + 
Sbjct: 1129 ADYELLMKSQQEMLYQTQVTAFVQEPK-VGETAP-GFVYSEYEKEYEKEQALIRKKMAKD 1186

Query: 1123 HCVVPELIIGNGYYFRVFSQNMVGFSDRAA--TTKEPVFIPRPGITYEPPNYKALDFSEA 1180
              VV   +    ++   F + ++   +     TT E +      +  +     A+D SE+
Sbjct: 1187 TVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEEL------LEEDGEEKMAVDISES 1240

Query: 1181 PS----FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRM-FSKQGV 1235
             +    F   + N  ++ G      C + G P PKI+W+K+G  +    R++M F + G 
Sbjct: 1241 EAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGR 1300

Query: 1236 LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             +L I    P D GIY   A+N++G A C  +L V
Sbjct: 1301 ASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV 1335



 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 65/275 (23%), Positives = 104/275 (37%), Gaps = 65/275 (23%)

Query: 1032 IRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQD 1091
            ++A  +V  G Y   + ++N      +       P PP D+ V +     + + WKPP  
Sbjct: 8248 VKAVNKVGGGEY---IELKN----PVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLY 8300

Query: 1092 VGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELII-------GNGYYFRVFSQNM 1144
             G +++ GY ++K  K    W    EH      +VP L         G  Y FRV ++N 
Sbjct: 8301 DGGSKIMGYIIEKIAKGEERWKRCNEH------LVPILTYTAKGLEEGKEYQFRVRAENA 8354

Query: 1145 VGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAV 1204
             G S+ +  T               P  KA+D  +AP       +  V  G    L  ++
Sbjct: 8355 AGISEPSRAT---------------PPTKAVDPIDAPKVILR-TSLEVKRGDEIALDASI 8398

Query: 1205 RGSPKPKISWFKN-GLDLGEDARFRMF----------------------------SKQGV 1235
             GSP P I+W K+  + + E+ + R                              SK+G 
Sbjct: 8399 SGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGE 8458

Query: 1236 LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
              L +R     D G+Y+ +  N  G A+  C + V
Sbjct: 8459 SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8493



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 55/197 (27%), Positives = 95/197 (48%), Gaps = 10/197 (5%)

Query: 451  EPPVLITRPLEDQLVMVGQRVEFECEV-SEEGAQVKWLKDGVELTREETFKYRFKKDGQR 509
            E P +  R ++ Q V  G    F   V  +   + +W K+GV++ R +   + + +D   
Sbjct: 2030 EAPKIFER-IQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNV- 2087

Query: 510  HHLIINEAMLEDAGHY---ALCTSG-GQALAELIVQEKKLEVY-QSIADLMVGAKD-QAV 563
              L+I +   ED+      A+  +G   + A L+VQ K+L  + Q + D++   KD  A 
Sbjct: 2088 CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMAT 2147

Query: 564  FKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV-PEGFA 622
            F+CE S+  V+  W K+G E+    + ++    +VH L+I  +  +D  DYS V  E   
Sbjct: 2148 FECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN 2207

Query: 623  CNLSAKLHFMEVKIDFV 639
               +AKL      ++FV
Sbjct: 2208 VKTTAKLIVEGAVVEFV 2224



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 28/95 (29%), Positives = 46/95 (48%)

Query: 1176  DFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGV 1235
             + S+AP+F     ++++  G   +  C + G P P+I WFKN L +   +   +   + V
Sbjct: 26824 ELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNV 26883

Query: 1236  LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
              +LEIR     D G Y  +A N +G+      L V
Sbjct: 26884 YSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26918



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 84/343 (24%), Positives = 125/343 (36%), Gaps = 68/343 (19%)

Query: 441   EKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEV-SEEGAQVKWLKDGVELTREETF 499
             E  S + F  +    IT  +    V  GQ   F   V S+  A+VKW  +GVEL  +E+ 
Sbjct: 26056 EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVEL--QESS 26113

Query: 500   KYRFKKDGQRHHLIINEAMLEDAGHY-ALCTS-GGQALAELIVQEKKLEVYQSIADLMVG 557
             K  +        L I +   +D+G Y A+CT+  G+A                 A L V 
Sbjct: 26114 KIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEA--------------SDYATLDVT 26159

Query: 558   AKDQAVFKCEVSDENV-RGVWLKNGKELVPDSRIKVSHIGRVHKLTIDD--------VTP 608
               D   +  +  DE V R V+     EL       VS   +  ++            +T 
Sbjct: 26160 GGDYTTYASQRRDEEVPRSVF----PELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTE 26215

Query: 609   ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRI---PDTIVVVAGN 665
               E+  S+     A   SA L    ++     R    KI      RI   P ++ V  G 
Sbjct: 26216 TRESLSSYEHSASAEMKSAALEEKSLEEKSTTR----KIKTTLAARILTKPRSMTVYEGE 26271

Query: 666   KLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRV 725
               R      G+P PTV W +                             K  +  T  R 
Sbjct: 26272 SARFSCDTDGEPVPTVTWLR-----------------------------KGQVLSTSARH 26302

Query: 726   RVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
             +V TTK +S F +   +  DEG Y+V V+N  G+ +   T+ +
Sbjct: 26303 QVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTI 26345



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 168/856 (19%), Positives = 281/856 (32%), Gaps = 184/856 (21%)

Query: 17   RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDIS--ASNKYGLATEGTRHTLTVREVGPA 74
            + V+V     AV E E     V   W + G +I+     ++    E   H + + E   +
Sbjct: 3108 KEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQS 3167

Query: 75   DQGSYAVIAGSSKVKFDLKVIEAE------KAEPMLAPAPAPAEATGAPGEAPAPAAE-- 126
            D G Y  +AG ++    L V   E      + +P+   +  PA         P P     
Sbjct: 3168 DAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWY 3227

Query: 127  ------------------------LGESAPSPKG---------------SSSAALNGPTP 147
                                    L E+ P                   S+S ++  P  
Sbjct: 3228 KEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEV 3287

Query: 148  GAPDDPIGLF---VMRP-QDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKV 203
             +PD  + ++   ++ P QD   + G    F  RV+G  L     V W+        S+ 
Sbjct: 3288 VSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK----VSWYSKDKKIKPSRF 3343

Query: 204  GQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG 263
             +  Q  D+Y         +L I +A P   G+Y         F  SN    V +   T 
Sbjct: 3344 FRMTQFEDTY---------QLEIAEAYPEDEGTYT--------FVASN---AVGQVSSTA 3383

Query: 264  DLDL-LSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVW 322
            +L L + A  R S    G+ + +S +   + D SS  K+            +  + E   
Sbjct: 3384 NLSLEVQALDRQS---SGKDVRESAKSQAVAD-SSFTKEESKISQKEIKSFQGSSYEYEV 3439

Query: 323  EILRQAPPSEYERIAFQYGV-----TDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQ--- 374
            ++      S     A            L  + +  +  +   K+ST    K+    Q   
Sbjct: 3440 QVFESVSQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGEAPKIFLHLQDVT 3499

Query: 375  VSKGHKIRLTVELADHD-AEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            V  G   +    L D    +V W   G +I+ S  +      G  + LTI    L D   
Sbjct: 3500 VKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEES-ERLKQSQNGNIQFLTICNVQLVDQGL 3558

Query: 434  YQCVVG---GEKCSTELFVKE--PPVLITRPLEDQLVMVGQRVEFE---CEVSEEG---- 481
            Y C+V    GE+ ++ +   E  P  ++   +E ++ M  +  EF        EEG    
Sbjct: 3559 YSCIVHNDCGERTTSAVLSVEGAPESILHERIEQEIEM--EMKEFSSSFLSAEEEGLHSA 3616

Query: 482  -AQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV 540
              Q+  + + +EL  E    Y  K D ++                       +    + +
Sbjct: 3617 ELQLSKINETLELLSESPV-YPTKFDSEK-----------------------EGTGPIFI 3652

Query: 541  QEKKLEVYQSIADLMVGAKDQAVFKCEV-SDENVRGVWLKNGKELVPDSRIKVSHIGRVH 599
            +E       S AD+ +G  D A     V      +  W  NG  L P +  K    G  H
Sbjct: 3653 KE------VSNADISMG--DVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDH 3704

Query: 600  KLTIDDVTPADEADYSFVPEG----FACNLSAKLH-----FMEVKIDFVPRQEPPKIHLD 650
             L I      DE +Y+ +         C+   K++       + + +    +   K+   
Sbjct: 3705 SLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGP 3764

Query: 651  CPGRIPDTIVVV---AGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGD 707
            CP      +  +    G     +  + G+PAPTV W K                      
Sbjct: 3765 CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFK---------------------- 3802

Query: 708  SDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVK 767
                  + K LC +     +        F V   ++ED G+Y    +N +GE      + 
Sbjct: 3803 ------ENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELL 3856

Query: 768  VI----DVPDAPAAPK 779
            V+    D+ D P   K
Sbjct: 3857 VLLEDTDMTDTPCKAK 3872



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 69/305 (22%), Positives = 116/305 (38%), Gaps = 26/305 (8%)

Query: 976   PRHLRQTIQKKVGEPVNLLIPFQ--GKPRPQVTWTKEGQPLA-GEEVSIRNSPTDTILFI 1032
             P  + Q   + + E  N+L   +  G+P P++ W K   P++    VSI  S     L I
Sbjct: 26829 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 26888

Query: 1033  RAARRVHSGTYQVTVRIENMEDKAT---LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
             R A    SG Y +  +    +  AT   +VL +V++PS    LR +    L  +   +  
Sbjct: 26889 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 26948

Query: 1090  Q-DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS 1148
             Q      E    +   +   +M          ++   + E  +       + S + +G S
Sbjct: 26949 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFV------EMSSSSFMGIS 27002

Query: 1149  DRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSP 1208
             +          + + GI   PP  +AL     PS      + S+  G    + CA  G P
Sbjct: 27003 NMTQLESSTSKMLKAGIRGIPPKIEAL-----PS------DISIDEGKVLTVACAFTGEP 27051

Query: 1209  KPKISWFKNG--LDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCEC 1266
              P+++W   G  +   E  RF + +   + TL I      DGG+Y     N  G      
Sbjct: 27052 TPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATV 27111

Query: 1267  RLEVR 1271
              + +R
Sbjct: 27112 NIHIR 27116



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 27/94 (28%), Positives = 44/94 (46%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P+    L N +VI G +  L C + G P P ++W++    +     F++  + G+  L I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
            R+    D G + C A N  G     C L V+V +
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSE 990



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 28/94 (29%), Positives = 45/94 (47%)

Query: 1180 APSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLE 1239
            AP   + +    V  G+ A   C ++ +P  +  WFK G ++ E  +  + S + + +LE
Sbjct: 4528 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLE 4587

Query: 1240 IRKPCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
            I +    D G Y C+A+N  G   C   L V VP
Sbjct: 4588 ILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVP 4621



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 24/85 (28%), Positives = 44/85 (51%)

Query: 12   FSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREV 71
            F  KP+++E+  G  A F     +    V+W+R    + + +KY +  +G +  L V++ 
Sbjct: 6249 FISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDA 6308

Query: 72   GPADQGSYAVIAGSSKVKFDLKVIE 96
               D G+Y V+ G+++    L VIE
Sbjct: 6309 TLQDMGTYVVMVGAARAAAHLTVIE 6333



 Score = 54.3 bits (129), Expect = 7e-07
 Identities = 31/96 (32%), Positives = 42/96 (43%)

Query: 1179 EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
            E P   Q L   +V +G  A  C  + G P+PKISW+K    L    + +        TL
Sbjct: 3191 EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTL 3250

Query: 1239 EIRKPCPFDGGIYVCRATNLQGEARCECRLEVRVPQ 1274
             + +  P D  +Y C A N  G A     L V VP+
Sbjct: 3251 LLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286



 Score = 54.3 bits (129), Expect = 7e-07
 Identities = 111/523 (21%), Positives = 174/523 (33%), Gaps = 88/523 (16%)

Query: 316   PAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRD-------EKKSTAFQKK 368
             PAEE   +  R++P  E  R      V+  R + +  +  R D        K +   QK 
Sbjct: 25991 PAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKT 26050

Query: 369   LEPAYQV------SKGHKIRLTVELADH------------------DAEVKWLKNGQEIQ 404
              E  Y+V      +  H  R+T+ +  H                   AEVKW  NG E+Q
Sbjct: 26051 SERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQ 26110

Query: 405   MSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFV--------------- 449
              S SK  + +     TL I  C   D   Y+ V    K     +                
Sbjct: 26111 ES-SKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQ 26169

Query: 450   ---KEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKD 506
                +E P  +   L           +   E+ E  + V+ +K  +  TRE    Y     
Sbjct: 26170 RRDEEVPRSVFPELTRTEAYAVSSFKKTSEM-EASSSVREVKSQMTETRESLSSYEHSAS 26228

Query: 507   GQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKC 566
              +     + E  LE+        +     A ++ + + + VY+          + A F C
Sbjct: 26229 AEMKSAALEEKSLEEKSTTRKIKT--TLAARILTKPRSMTVYEG---------ESARFSC 26277

Query: 567   EVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNL 625
             +   E V  V WL+ G+ L   +R +V+         I  V  +DE +YS V E      
Sbjct: 26278 DTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQ 26337

Query: 626   SA-------KLHFMEVKIDFVPRQEPPKIHLDCPGRI--PDTIVVVAGNKLRLDVPISGD 676
              A       K    E  +   PR + P+  +  P  +  P  +     +  +   P    
Sbjct: 26338 EAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETK 26397

Query: 677   PAPT-------VIWQKAITQGNKAPARP-------APDAPEDTGDSDEWVFDKKLLCETE 722
             P PT       V     ITQ  KA A           ++         W  D K L E  
Sbjct: 26398 PTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKE-N 26456

Query: 723   GRVRVETTKDRSI-FTVEGAEKEDEGVYTVTVKNPVGEDQVNL 764
             G  +   + D +    +    + D+G Y   +    G  + NL
Sbjct: 26457 GHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNL 26499



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 31/104 (29%), Positives = 46/104 (44%)

Query: 1167  YEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDAR 1226
             YE  + +      AP  T  + +  V  G        V+  P  ++ W+ NG++L E ++
Sbjct: 26055 YEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSK 26114

Query: 1227  FRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
                 +  GVLTLEI      D G Y    TN +GEA     L+V
Sbjct: 26115 IHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 28/90 (31%), Positives = 42/90 (46%)

Query: 6    KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHT 65
            K+P   F+K      V  G+ AV E E  R   KV+W + G++I  S KY +  +G    
Sbjct: 5976 KEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRK 6035

Query: 66   LTVREVGPADQGSYAVIAGSSKVKFDLKVI 95
            L + +  P D  +Y   A   K   +L V+
Sbjct: 6036 LVIHDCTPEDIKTYTCDAKDFKTSCNLNVV 6065



 Score = 52.4 bits (124), Expect = 3e-06
 Identities = 52/164 (31%), Positives = 74/164 (45%), Gaps = 17/164 (10%)

Query: 378   GHKIRLTVELADH-DAEVKWLKNGQEIQMSGS--KYIFESIGAKRTLTISQCSLADDAAY 434
             G  +R  V +  H +  V W K+GQ+I+   +  KY FES      LTI+  +  DDA Y
Sbjct: 25399 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEY 25458

Query: 435   QCVV----GGEKCSTELFV--KEPPVLIT-RPLEDQLV-----MVGQRVEFECEVSE-EG 481
               V     G + C  +L V    PP   T RP+  +L+       GQ V FE  VS    
Sbjct: 25459 TVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPP 25518

Query: 482   AQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHY 525
               +KW KDG  L+     +    +    + L I + + ED G+Y
Sbjct: 25519 PTLKWEKDGQPLSLGPNIEI-IHEGLDYYALHIRDTLPEDTGYY 25561



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 26/86 (30%), Positives = 45/86 (52%)

Query: 14   KKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGP 73
            + P+ +  A G+  VF AE  +  V+V+W R    +   +K+ + +EG  H L + ++ P
Sbjct: 6611 RPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKP 6670

Query: 74   ADQGSYAVIAGSSKVKFDLKVIEAEK 99
             DQG Y  IA   + +  L++  A K
Sbjct: 6671 RDQGEYRFIAKDKEARAKLELAAAPK 6696



 Score = 50.8 bits (120), Expect = 8e-06
 Identities = 51/207 (24%), Positives = 78/207 (37%), Gaps = 17/207 (8%)

Query: 1055  KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGY-TVQKADKKTMEWF 1113
             K  L    + +P PP+ L VT+    +  L W PP   G  ++ GY T  + +++  + +
Sbjct: 12483 KPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRW 12542

Query: 1114  TVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYK 1173
             T     +    VV  L  G  Y FRV ++N VG S           +PR         Y+
Sbjct: 12543 TEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVS-----------LPREAEGV----YE 12587

Query: 1174  ALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQ 1233
             A +    P    P    ++ AG    +   V G P P   W K   ++   +   +    
Sbjct: 12588 AKEQLLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKAD 12646

Query: 1234  GVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                 L I+     D G Y   A N  G
Sbjct: 12647 SSSILIIKDVTRKDSGYYSLTAENSSG 12673



 Score = 50.4 bits (119), Expect = 1e-05
 Identities = 22/81 (27%), Positives = 39/81 (48%)

Query: 17   RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
            + +E        F  +  R  V ++W + G ++   N+     +  +H LT+++ G  D+
Sbjct: 6436 KDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDE 6495

Query: 77   GSYAVIAGSSKVKFDLKVIEA 97
            G Y V AG  K   +L +IEA
Sbjct: 6496 GEYIVTAGQDKSVAELLIIEA 6516



 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 53/164 (32%), Positives = 80/164 (48%), Gaps = 20/164 (12%)

Query: 393 EVKWLKNGQEIQMS---GSKYIFESIGAKRTLTISQCSLADDAAYQCVV---GGEKCST- 445
           EV W ++GQ I  S   G +  F    AK  LTI   + A+   Y        G+  ST 
Sbjct: 36  EVSWFRDGQVISTSTLPGVQISFSDGRAK--LTIPAVTKANSGRYSLKATNGSGQATSTA 93

Query: 446 ELFVKE---PPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV-KWLKDGVELTREETFKY 501
           EL VK    PP  + R L+   V  G +V  +  V+     V K+ +DG E+  + +  +
Sbjct: 94  ELLVKAETAPPNFVQR-LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI--QSSLDF 150

Query: 502 RFKKDGQRHHLIINEAMLEDAGHYAL--CTSGGQA--LAELIVQ 541
           +  ++G  + L+I EA  ED+G Y++    S G+A   AEL+VQ
Sbjct: 151 QISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 54/228 (23%), Positives = 83/228 (36%), Gaps = 35/228 (15%)

Query: 1058 LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
            L +  +  P+ P+ L  T+     + L+WK P+  G + + GY ++K      ++    E
Sbjct: 8982 LAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDF----E 9037

Query: 1118 HYRRTHCVVPELIIGN-----GYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNY 1172
               +  C     ++ N      Y FRV + N +G S+ +                 P N 
Sbjct: 9038 RVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPSL----------------PLNV 9081

Query: 1173 KALDFSEAPSFTQPLVNRS----VIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFR 1228
               D    P+    L  R     V AG    +   V G P PKI W KN   + +     
Sbjct: 9082 VIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDAL 9141

Query: 1229 MFSKQGV------LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
              +K+ V        L I K    D G Y   A+N  G       +EV
Sbjct: 9142 QITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 9189



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 24/94 (25%), Positives = 40/94 (42%)

Query: 1178  SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             S  P     L + +V +   A       G P+P   W K+G  + +  ++++   +G   
Sbjct: 26544 SSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFF 26603

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
             LEI K    D G+Y C   N  G     C+L ++
Sbjct: 26604 LEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIK 26637



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 24/81 (29%), Positives = 37/81 (45%)

Query: 14   KKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGP 73
            KKP+ V     +   FE       V V+W     +I  S+K+ L +E   H L ++ + P
Sbjct: 2753 KKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2812

Query: 74   ADQGSYAVIAGSSKVKFDLKV 94
            +D G Y  + G  + K  L V
Sbjct: 2813 SDAGEYTAVVGQLECKAKLFV 2833



 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 2/96 (2%)

Query: 1178 SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA--RFRMFSKQGV 1235
            ++AP+FTQPL +  V+ G TA     + G P P++SWF++G  +        ++    G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1236 LTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
              L I      + G Y  +ATN  G+A     L V+
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 54/233 (23%), Positives = 91/233 (39%), Gaps = 50/233 (21%)

Query: 545  LEVYQSIADLMVGAKD----QAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK 600
            L+  + I D+++   +     A+F+C VS       W+K+G  +    + +    G+  K
Sbjct: 4810 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRK 4869

Query: 601  LTIDDVTPADEADYSFVPE--GFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDT 658
            L I DV  +D  +Y+ V          +AKL   E+ + FV   E             + 
Sbjct: 4870 LHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLE-------------EE 4916

Query: 659  IVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLL 718
            + VV G  L L   ++ +    V+W+K                            D K++
Sbjct: 4917 VTVVKGQPLYLSCELNKE--RDVVWRK----------------------------DGKIV 4946

Query: 719  CETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDV 771
             E  GR+           T+  A+  D G YTVTV+N     + +  VKV++V
Sbjct: 4947 VEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN-ANNLECSSCVKVVEV 4998



 Score = 47.8 bits (112), Expect = 7e-05
 Identities = 31/102 (30%), Positives = 44/102 (43%)

Query: 1169 PPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFR 1228
            P  + +      P F + + N  +  G  A L   V G PKPKI WF NG+ L   A ++
Sbjct: 3637 PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYK 3696

Query: 1229 MFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
                    +L I      D G Y C A+N  G+  C   L++
Sbjct: 3697 FVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3738



 Score = 47.8 bits (112), Expect = 7e-05
 Identities = 26/93 (27%), Positives = 41/93 (44%), Gaps = 3/93 (3%)

Query: 1181  PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDL---GEDARFRMFSKQGVLT 1237
             P FT PL N++   G        +   P+P ++W+K+G  +     D ++   S +G+  
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25444

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             L I      D   Y   A N  GE  C+ +L V
Sbjct: 25445 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 27/91 (29%), Positives = 40/91 (43%), Gaps = 1/91 (1%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMF-SKQGVLTLE 1239
            P F + L       G  A+    V G P P ++WFK    L     + +  +  G  T  
Sbjct: 3767 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3826

Query: 1240 IRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
            +  P   D G+Y+C+A N+ GE+ C   L V
Sbjct: 3827 VNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score = 45.8 bits (107), Expect = 3e-04
 Identities = 22/82 (26%), Positives = 35/82 (42%)

Query: 13   SKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVG 72
            +K  +++EV     A FE E     V   W + G +I  S K+ +  +G  H L +    
Sbjct: 2839 TKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTS 2898

Query: 73   PADQGSYAVIAGSSKVKFDLKV 94
              D   Y  + G+ +V   L V
Sbjct: 2899 TEDSAEYTFVCGNDQVSATLTV 2920



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 27/80 (33%), Positives = 37/80 (46%)

Query: 17   RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
            + V V AG  A F+ E     + V W   G  +  S+K    +EG  HTLT+R+V   D 
Sbjct: 5898 KDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDA 5957

Query: 77   GSYAVIAGSSKVKFDLKVIE 96
            G   + A   K   +L V E
Sbjct: 5958 GEVQLTAKDFKTHANLFVKE 5977



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 1183 FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRK 1242
            FT+PL +++V  G TA+L C V      K+ WFKNG ++ +  ++ + +   V  L I  
Sbjct: 5982 FTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 6040

Query: 1243 PCPFDGGIYVCRATNLQGEARCECRLEVRVP 1273
              P D   Y C A +     +  C L V  P
Sbjct: 6041 CTPEDIKTYTCDAKDF----KTSCNLNVVPP 6067



 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 33/108 (30%), Positives = 43/108 (39%), Gaps = 6/108 (5%)

Query: 1165  ITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNG--LDLG 1222
             +T  PP     D +  P F + L N     G +      V G P P + W K+G  L LG
Sbjct: 25477 VTLHPP---PTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLG 25533

Query: 1223  EDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
              +    +        L IR   P D G Y   ATN  G   C+  L+V
Sbjct: 25534 PNIEI-IHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 48/223 (21%), Positives = 85/223 (38%), Gaps = 8/223 (3%)

Query: 558   AKDQAVFKCEVSDENVRG---VWLKNGKELVPDSRIKVSHIGR-VHKLTIDDVTPADEAD 613
             +K+ A   C V    +R     W K+GK+L  +   +  +     ++L I+++T +D+ +
Sbjct: 26424 SKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGE 26483

Query: 614   YSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPI 673
             Y     G        L FM      +  +           +      V    + +   PI
Sbjct: 26484 YVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI 26543

Query: 674   SGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDR 733
             S  P   V   +  T  + + A+ A  A  +   +  W  D K + +  G+ ++   K  
Sbjct: 26544 SSKPV-IVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG-GKYKLSEDKGG 26601

Query: 734   SIFTVEGAEKEDEGVYTVTVKNPVG--EDQVNLTVKVIDVPDA 774
                 +   +  D G+YT TVKN  G       LT+K I   +A
Sbjct: 26602 FFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEA 26644



 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 26/91 (28%), Positives = 43/91 (47%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P+F Q L + +V  G    L   V G P P + ++++G ++     F++  +  + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
             +  P D G Y   ATN  G A     L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 29/108 (26%), Positives = 49/108 (45%), Gaps = 16/108 (14%)

Query: 10   SAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVR 69
            + F+K   ++EV+         E  + G +V W +G  +I  + +Y + TEG +  L ++
Sbjct: 6158 AVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQ 6217

Query: 70   EVGPADQGSYAVIAGSS----KVKF------------DLKVIEAEKAE 101
                 D G+Y     SS    KVK             +L+++E EKAE
Sbjct: 6218 NAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAE 6265



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 23/76 (30%), Positives = 35/76 (46%)

Query: 28   VFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSK 87
            VFE E   +G+ V W     +I  S+KY +   G  + LTV  +   D+G Y   AG + 
Sbjct: 2505 VFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENM 2564

Query: 88   VKFDLKVIEAEKAEPM 103
                L V     ++P+
Sbjct: 2565 TSGKLTVAGGAISKPL 2580



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 45/174 (25%), Positives = 72/174 (41%), Gaps = 10/174 (5%)

Query: 449  VKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQ 508
            +KE   +I  PL D +   G  V     ++    +V W  +   +  +E FK    +D  
Sbjct: 4430 IKEDGPMIHTPLVDTVSEEGDIVHLTTSITN-AKEVNWYFENKLVPSDEKFKCL--QDQN 4486

Query: 509  RHHLIINEAMLED-AGHY---ALCTSGGQALAELIVQEKKLE--VYQSIADLMVGAKDQA 562
             + L+I++   ED  G Y   AL  SG  A +  +   K+    + + I  L V     A
Sbjct: 4487 TYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGHLA 4546

Query: 563  VFKCEV-SDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYS 615
             F CE+ S  NVR  W K G+E+    +  +     +  L I      D  +Y+
Sbjct: 4547 KFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYT 4600



 Score = 42.0 bits (97), Expect = 0.004
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 14/111 (12%)

Query: 453  PVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHH 511
            P  IT+P+  +LV  G  V F C+V       V W K GV LT    +K  + K      
Sbjct: 1036 PYFITKPVVQKLVEGGS-VVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1094

Query: 512  LIINEAMLEDAGHYALC-------TSGGQALA-----ELIVQEKKLEVYQS 550
            L+I+    +DAG Y +        TS   +L      EL+++ ++  +YQ+
Sbjct: 1095 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQT 1145



 Score = 41.6 bits (96), Expect = 0.005
 Identities = 21/86 (24%), Positives = 38/86 (44%)

Query: 9    VSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTV 68
            V  F K+ + +EV        E       ++ +W     ++ ++ KY + +   R  LTV
Sbjct: 2220 VVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTV 2279

Query: 69   REVGPADQGSYAVIAGSSKVKFDLKV 94
            ++V   DQG Y+ +    K    LK+
Sbjct: 2280 KDVTKEDQGEYSFVIDGKKTTCKLKM 2305



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 23/105 (21%), Positives = 46/105 (43%), Gaps = 16/105 (15%)

Query: 12   FSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREV 71
            F K  + ++V     A+FE E     + V+W +   ++  +++  +  E   H L +   
Sbjct: 3014 FRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPST 3073

Query: 72   GPADQGSYAVIAGSS----------------KVKFDLKVIEAEKA 100
              +D G Y V+AG +                 +K +++VIE ++A
Sbjct: 3074 RMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRA 3118



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 23/91 (25%), Positives = 41/91 (45%)

Query: 8    PVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLT 67
            P   F +    ++V     A FE E  R   KV+W + G++I    KY + ++G    L 
Sbjct: 6067 PHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILV 6126

Query: 68   VREVGPADQGSYAVIAGSSKVKFDLKVIEAE 98
            + +    D+  Y+    +++    L V+E E
Sbjct: 6127 INKCLLDDEAEYSCEVRTARTSGMLTVLEEE 6157



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 38/167 (22%), Positives = 69/167 (41%), Gaps = 8/167 (4%)

Query: 457 TRPLEDQLVMVGQRVEFECEVSE-EGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIIN 515
           T+PL+  +V+ G    FE  +S     +V W +DG  ++       +      R  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 516 EAMLEDAGHYALCTSGGQ----ALAELIVQEKKL--EVYQSIADLMVGAKDQAVFKCEVS 569
                ++G Y+L  + G     + AEL+V+ +       Q +  + V    Q   +  V+
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 570 DENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYS 615
                 V + ++G E+      ++S  G ++ L I +  P D   YS
Sbjct: 129 GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 27   AVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA-VIAGS 85
            A FE ET    VKV+W + G ++   +KY + ++   H L++  +  +D   Y+ V+   
Sbjct: 2146 ATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVED 2205

Query: 86   SKVKFDLKVI 95
              VK   K+I
Sbjct: 2206 ENVKTTAKLI 2215



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 29/105 (27%), Positives = 44/105 (41%), Gaps = 9/105 (8%)

Query: 27   AVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA--VIAG 84
            AVF  +  R    V+W R G +I    KY    +G+ H L +++    D+  YA  V   
Sbjct: 6535 AVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDR 6594

Query: 85   SSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGE 129
             S+ +  ++ I  E   P       P +   APG      AEL +
Sbjct: 6595 KSRARLFVEEIPVEIIRP-------PQDILEAPGADVVFLAELNK 6632



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 40    VRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEK 99
             ++W R G ++  S KY ++++G  HTLTV      D+G Y  IA +   + +       +
Sbjct: 24259 IKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQ 24318

Query: 100   AEPMLAPA-PAPAEATGAPG 118
             A P   P  P   +  GA G
Sbjct: 24319 ATPQFHPGYPLKEKYYGAVG 24338



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 69/326 (21%), Positives = 130/326 (39%), Gaps = 64/326 (19%)

Query: 478   SEEGAQVKWLKDGVELTREE---TFKYR------FKKDGQRHHLIINEAMLEDAGHYALC 528
             + E  Q  WLK  +E    +   T K+R       KKD    +++++ A +   G  A+ 
Sbjct: 25191 ASEALQHPWLKQKIERVSTKVIRTLKHRRYYHTLIKKD---LNMVVSAARISCGG--AIR 25245

Query: 529   TSGGQALAELIVQEKKL-----EVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKE 583
             +  G ++A++ V   ++     ++  ++ +   G   + V K E  D++ +  W    ++
Sbjct: 25246 SQKGVSVAKVKVASIEIGPVSGQIMHAVGE--EGGHVKYVCKIENYDQSTQVTWYFGVRQ 25303

Query: 584   LVPDSRIKVSHIGRVHKLTIDDVTPADEADY--SFVPEGFACNLSAKLHFMEVK--IDFV 639
             L    + ++++   V  L + D+T  D+  Y    V +    +  A+L    V+   D+ 
Sbjct: 25304 LENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYY 25363

Query: 640   PRQEPPKIH--------LDCPGRIPDTI---VVVAGNKLRLDVPISGDPAPTVIWQKAIT 688
              R+   KI         L+ P      +       G  +R  V I+  P P V W K+  
Sbjct: 25364 CRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKS-- 25421

Query: 689   QGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGV 748
              G K   +P  +  + T +SD+ ++                       T+     +D+  
Sbjct: 25422 -GQKI--KPGDNDKKYTFESDKGLYQ---------------------LTINSVTTDDDAE 25457

Query: 749   YTVTVKNPVGED--QVNLTVKVIDVP 772
             YTV  +N  GED  +  LTV +   P
Sbjct: 25458 YTVVARNKYGEDSCKAKLTVTLHPPP 25483



 Score = 40.4 bits (93), Expect = 0.011
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 38   VKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKV 94
            V V+W + G +I  S KY +  +G R  L +++    D+G Y    G+ K K ++ V
Sbjct: 5385 VPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTV 5441



 Score = 40.4 bits (93), Expect = 0.011
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 19   VEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGS 78
            V+V     A FE E  R     RW +G  +I+  +++ L  +GT+H++ ++     D+  
Sbjct: 5544 VKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAK 5603

Query: 79   Y 79
            Y
Sbjct: 5604 Y 5604



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 46/199 (23%), Positives = 87/199 (43%), Gaps = 20/199 (10%)

Query: 453  PVLITRPLEDQLVMVGQRVEFECEV-SEEGAQVKWLKDGVELTREETFKYRFKKDGQRHH 511
            PV + +P+  +  + GQ   F+ +V      +  W  DG ++  + T K   K+DG +  
Sbjct: 1411 PVFVLKPVSFKC-LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ-S 1468

Query: 512  LIINEAMLEDAGHYALCT---SGGQALAELI-VQEKKLEVYQSIADLM--VGAKDQAVFK 565
            LII  A   D+G + +     +G  +++ ++ V+  + +V     + +  V  K+ +  +
Sbjct: 1469 LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLE 1528

Query: 566  CEV---SDENVRGVWLKNGKELVPDS--RIKVSHIGRVHKLTIDDVTPADEADYSFVPEG 620
             +V    + N   VWLKN   +VP    +I++        L ID     D A Y+     
Sbjct: 1529 MKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAIN 1588

Query: 621  FA------CNLSAKLHFME 633
             A      C ++ ++ F E
Sbjct: 1589 KAGRDTTRCKVNVEVEFAE 1607



 Score = 39.7 bits (91), Expect = 0.019
 Identities = 26/92 (28%), Positives = 37/92 (40%), Gaps = 1/92 (1%)

Query: 1181 PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
            P+   PL +     G  A   C V G+   K+SW+     +     FRM   +    LEI
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3357

Query: 1241 RKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272
             +  P D G Y   A+N  G+      L + V
Sbjct: 3358 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEV 3389



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 29/94 (30%), Positives = 37/94 (39%), Gaps = 1/94 (1%)

Query: 11   AFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVRE 70
            A SK      VA    AVFE E      K  W R G  +  +N     ++G +  L +  
Sbjct: 2575 AISKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAA 2634

Query: 71   VGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPML 104
                D G Y     +SK    LKV EA K +  L
Sbjct: 2635 TKLDDIGEYTYKVATSKTSAKLKV-EAVKIKKTL 2667



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 22/88 (25%), Positives = 41/88 (46%), Gaps = 16/88 (18%)

Query: 29   FEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSS-- 86
            FE      G+  +W + G +I +++K  + T+   H+L +R V   D   Y  +AG +  
Sbjct: 2942 FEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATS 3001

Query: 87   ---------KVKF-----DLKVIEAEKA 100
                      ++F     D+KV+E ++A
Sbjct: 3002 TATLYVEARHIEFRKHIKDIKVLEKKRA 3029



 Score = 38.5 bits (88), Expect = 0.041
 Identities = 22/81 (27%), Positives = 35/81 (43%)

Query: 1191  SVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGI 1250
             +V  G +A   C   G P P ++W + G  L   AR ++ + +   T EI      D G 
Sbjct: 26266 TVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGN 26325

Query: 1251  YVCRATNLQGEARCECRLEVR 1271
             Y     N +G+   E  L ++
Sbjct: 26326 YSVVVENSEGKQEAEFTLTIQ 26346



 Score = 37.7 bits (86), Expect = 0.071
 Identities = 30/109 (27%), Positives = 43/109 (39%), Gaps = 1/109 (0%)

Query: 1163 PGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLG 1222
            PG   E  +   L+    P F    V+   + G TA     V G P P+  WF +G  + 
Sbjct: 1393 PGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIV 1452

Query: 1223 EDARFRMFSKQ-GVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             D   ++  K+ G  +L I    P D G +   A N  G +     L V
Sbjct: 1453 NDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTV 1501



 Score = 36.6 bits (83), Expect = 0.16
 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 456   ITRPLEDQLVMVGQRVEFECE-VSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLII 514
             I + ++D    +G+  +  C+ V      +KW + G EL +    KY+   DG+ H L +
Sbjct: 24230 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSR--KYKMSSDGRTHTLTV 24287

Query: 515   NEAMLEDAGHY 525
                  ED G Y
Sbjct: 24288 MTEEQEDEGVY 24298



 Score = 36.6 bits (83), Expect = 0.16
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 1175  LDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSP--KPKISWFKNGLDLGEDARFRM-FS 1231
             L  S  P  TQ L  ++  +   A L C V  S     +++W+K+G  L E+  F+  +S
Sbjct: 26407 LPVSAPPKITQFL--KAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYS 26464

Query: 1232  KQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
               G   L+I      D G YVC  +   G ++
Sbjct: 26465 ADGTYELKINNLTESDQGEYVCEISGEGGTSK 26496



 Score = 36.2 bits (82), Expect = 0.21
 Identities = 20/79 (25%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query: 17   RSVEVAAGSPAVFEAETERAGV-KVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPAD 75
            + V V  G+ AV E +     V  V+W      I   ++     +GT+  L +     +D
Sbjct: 2406 KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASD 2465

Query: 76   QGSYAVIAGSSKVKFDLKV 94
            +G Y +I G  +   +L V
Sbjct: 2466 EGPYKLIVGRVETNCNLSV 2484



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 14   KKPRSVEVAAGSPAVFEAETERAGVK-VRWQRGGSDISASNKYGLATEGTRHTLTVREVG 72
            K  +++ V     AVF  E     VK V+W + G  + ++ KY ++ +GT ++L ++   
Sbjct: 2665 KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCA 2724

Query: 73   PADQGSYAVIAG 84
              D+  Y    G
Sbjct: 2725 IVDESVYGFRLG 2736



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 23/78 (29%), Positives = 35/78 (44%)

Query: 19   VEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGS 78
            VEV  G  A FE E     V  +W+  G  ++AS    +  +G +H L +        G 
Sbjct: 5455 VEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGE 5514

Query: 79   YAVIAGSSKVKFDLKVIE 96
             +  A ++K   +LKV E
Sbjct: 5515 VSFQAANAKSAANLKVKE 5532



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 28   VFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSK 87
            + + E  +A   V+W + G +I  S    +  +G +  L +++   +D G Y    G+ K
Sbjct: 5731 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDK 5790

Query: 88   V--KFDLKVIEAEKAEPM 103
               K D++  E +   P+
Sbjct: 5791 TSGKLDIEDREIKLVRPL 5808



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 19/118 (16%)

Query: 577   WLKNGKELVP---DSRIKVSHIGRVHKLTIDDVTPADEADYSFVP------EGFACNLSA 627
             W K+G+++ P   D +        +++LTI+ VT  D+A+Y+ V       +     L+ 
Sbjct: 25418 WYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477

Query: 628   KLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQK 685
              LH         P  +    + +C            G  +  ++ +SG P PT+ W+K
Sbjct: 25478 TLHPPPTDSTLRPMFKRLLANAECQ----------EGQSVCFEIRVSGIPPPTLKWEK 25525



 Score = 35.4 bits (80), Expect = 0.35
 Identities = 16/47 (34%), Positives = 30/47 (63%)

Query: 40  VRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSS 86
           V++ R G++I +S  + ++ EG  ++L + E  P D G+Y+V A +S
Sbjct: 135 VKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181



 Score = 35.4 bits (80), Expect = 0.35
 Identities = 45/203 (22%), Positives = 72/203 (35%), Gaps = 60/203 (29%)

Query: 40    VRWQRGGSDISASN---KYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIE 96
             V W + G  I   +   KY   ++   + LT+  V   D   Y V+A +   +      +
Sbjct: 25416 VTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE------D 25469

Query: 97    AEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGL 156
             + KA+  +   P P ++T  P                                      +
Sbjct: 25470 SCKAKLTVTLHPPPTDSTLRP--------------------------------------M 25491

Query: 157   FVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDR 215
             F     + E   G S+ F  RV+G   + PP +KW K G+ + L   +     +H+  D 
Sbjct: 25492 FKRLLANAECQEGQSVCFEIRVSG---IPPPTLKWEKDGQPLSLGPNIEI---IHEGLD- 25544

Query: 216   ASKVYLFELHITDAQPAFTGSYR 238
                   + LHI D  P  TG YR
Sbjct: 25545 -----YYALHIRDTLPEDTGYYR 25562



 Score = 35.0 bits (79), Expect = 0.46
 Identities = 19/65 (29%), Positives = 28/65 (43%)

Query: 17   RSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
            +   V      VF  E    G K +W R    I  S+KY +  +   +TL +R+    DQ
Sbjct: 6342 KDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQ 6401

Query: 77   GSYAV 81
             +Y V
Sbjct: 6402 ANYNV 6406



 Score = 34.3 bits (77), Expect = 0.78
 Identities = 20/85 (23%), Positives = 36/85 (42%), Gaps = 9/85 (10%)

Query: 5    GKKPVSAFSKKPRSVEVAAG--SPAVFEAETERAGVKVR-------WQRGGSDISASNKY 55
            GKK       KPR + +  G     V E +  +  VKV        W + G ++  S++ 
Sbjct: 2296 GKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRV 2355

Query: 56   GLATEGTRHTLTVREVGPADQGSYA 80
             +  +   H L + ++   D G+Y+
Sbjct: 2356 HIVIDKQSHMLLIEDMTKEDAGNYS 2380



 Score = 34.3 bits (77), Expect = 0.78
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 4/87 (4%)

Query: 1179 EAPS-FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
            EAP+ F + L +++V     A+  C +    K  + W++NG ++ E  +++ F K G + 
Sbjct: 6515 EAPTEFVEHLEDQTVTEFDDAVFSCQL-SREKANVKWYRNGREIKEGKKYK-FEKDGSIH 6572

Query: 1238 LEIRKPCPFDGGI-YVCRATNLQGEAR 1263
              I K C  D    Y C   + +  AR
Sbjct: 6573 RLIIKDCRLDDECEYACGVEDRKSRAR 6599



 Score = 34.3 bits (77), Expect = 0.78
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 5/65 (7%)

Query: 393   EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELF 448
             ++KW + G+E+  S  KY   S G   TLT+      D+  Y C+    VG  + S++L 
Sbjct: 24258 DIKWYRFGKELIQS-RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLL 24316

Query: 449   VKEPP 453
             ++  P
Sbjct: 24317 LQATP 24321



 Score = 33.9 bits (76), Expect = 1.0
 Identities = 24/92 (26%), Positives = 34/92 (36%)

Query: 1179 EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
            EAP     L + +V  G TA   C ++      ++W   G  + E  R +      +  L
Sbjct: 3487 EAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFL 3546

Query: 1239 EIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             I      D G+Y C   N  GE      L V
Sbjct: 3547 TICNVQLVDQGLYSCIVHNDCGERTTSAVLSV 3578



 Score = 33.9 bits (76), Expect = 1.0
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 24   GSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVI 82
            GS A+FE     +     W + GS+I  S K+    +G    L + +V  +D G Y  +
Sbjct: 4828 GSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCV 4886



 Score = 33.5 bits (75), Expect = 1.3
 Identities = 25/125 (20%), Positives = 50/125 (40%), Gaps = 7/125 (5%)

Query: 16    PRSVEVAAGSPAVFEAETE-RAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPA 74
             P  + + AG     EA    +     +W++G  ++  S+   +    +   L +++V   
Sbjct: 12600 PEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRK 12659

Query: 75    DQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSP 134
             D G Y++ A +S         + +K + ++  AP P +      +  A A  L    P  
Sbjct: 12660 DSGYYSLTAENS------SGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLE 12713

Query: 135   KGSSS 139
              G S+
Sbjct: 12714 DGGSN 12718



 Score = 33.1 bits (74), Expect = 1.7
 Identities = 53/201 (26%), Positives = 74/201 (36%), Gaps = 44/201 (21%)

Query: 87   KVKFDLKVIEAEKAEPMLAP--APAPAEATGAPGEAPAPAAELGE----------SAPSP 134
            K + ++K I+    EP   P  AP      G   EA AP  E  +            PSP
Sbjct: 4719 KPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPSP 4778

Query: 135  KGSSSAALNGPTPGA--PDD----------PIGLFVMRPQDGEVT----VGGSITFSARV 178
              +    L   + G   PD+          P+  FV   +D  +T    VG S  F   V
Sbjct: 4779 IEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLK-FVKEIKDIILTESEFVGSSAIFECLV 4837

Query: 179  AGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSY 237
            + ++     +  W K G  +  S K   H  + D  DR       +LHI D Q +  G Y
Sbjct: 4838 SPSTA----ITTWMKDGSNIRESPK---HRFIADGKDR-------KLHIIDVQLSDAGEY 4883

Query: 238  RCEVSTKDKFDCSNFNLTVHE 258
             C +   +K   S   L V E
Sbjct: 4884 TCVLRLGNKEKTSTAKLVVEE 4904



 Score = 33.1 bits (74), Expect = 1.7
 Identities = 16/72 (22%), Positives = 31/72 (43%)

Query: 27   AVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSS 86
            AVF  E     ++V+W +    +  +    +  EG  H++T +++   D     V A   
Sbjct: 5641 AVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGM 5700

Query: 87   KVKFDLKVIEAE 98
              +  L V+E +
Sbjct: 5701 SSEAKLTVLEGD 5712



 Score = 33.1 bits (74), Expect = 1.7
 Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 19    VEVAAGSPAVFEAETE-RAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQG 77
             V + AGS  V +A    +   K+ W +G  ++    K  L   G R T  ++    +D G
Sbjct: 22752 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 22811

Query: 78    SYAV----IAGSSKVKFDLKVIEA 97
              Y +     +G+  V   +KV+++
Sbjct: 22812 KYTLTVKNASGTKAVSVMVKVLDS 22835



 Score = 32.7 bits (73), Expect = 2.3
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 460  LEDQLVMVGQRVEFECEVSEEGA-QVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAM 518
            +++  ++ G  V F C++S     ++ W KDG  +   E ++  F +DG R  L I   +
Sbjct: 1251 IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG-RASLRIPVVL 1309

Query: 519  LEDAGHYALCTS 530
             ED G Y    S
Sbjct: 1310 PEDEGIYTAFAS 1321



 Score = 32.3 bits (72), Expect = 3.0
 Identities = 43/171 (25%), Positives = 67/171 (39%), Gaps = 22/171 (12%)

Query: 948  NMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQT--IQKKVGEPVNLLIPFQGKPRPQV 1005
            N  G G   T TE    + + +      P  L++   I+   G P        G+P P V
Sbjct: 3739 NSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTV 3798

Query: 1006 TWTKEGQPL-AGEEVSIRNSPTDTILFI-RAARRVHSGTYQVTVRIENMEDKAT------ 1057
            TW KE + L      +I ++P  +  FI    +R  SG Y    + ENM  ++T      
Sbjct: 3799 TWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLY--ICKAENMLGESTCAAELL 3856

Query: 1058 LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKK 1108
            ++L+  D    P   + T           + P+D   T L G  V+  D +
Sbjct: 3857 VLLEDTDMTDTPCKAKSTP----------EAPEDFPQTPLKGPAVEALDSE 3897



 Score = 32.3 bits (72), Expect = 3.0
 Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 1/83 (1%)

Query: 12   FSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREV 71
            F+   + V V     A FE    R    V W +G   I +S+K+ +  +G +H L + + 
Sbjct: 5183 FAVPLKDVTVPERRQARFECVLTREA-NVIWSKGPDIIKSSDKFDIIADGKKHILVINDS 5241

Query: 72   GPADQGSYAVIAGSSKVKFDLKV 94
               D+G Y       K    L V
Sbjct: 5242 QFDDEGVYTAEVEGKKTSARLFV 5264



 Score = 32.3 bits (72), Expect = 3.0
 Identities = 24/67 (35%), Positives = 30/67 (44%), Gaps = 5/67 (7%)

Query: 467   VGQRVEFECEVSEEG---AQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAG 523
             V  R + + +V  +G   A V W KDG  L  +ET +           L I EA  ED G
Sbjct: 19101 VKAREQLKIDVPFKGRPQATVNWRKDGQTL--KETTRVNVSSSKTVTSLSIKEASKEDVG 19158

Query: 524   HYALCTS 530
              Y LC S
Sbjct: 19159 TYELCVS 19165



 Score = 32.0 bits (71), Expect = 3.9
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 6    KKPVSAFSKKPRSVEVAAGSPAVFEAETERA-GVKVRWQRGGSDISASNKYGLATEGTRH 64
            K+      +K   +EVA G  A F  E + A  V+ +W + G +I  S+K  + +     
Sbjct: 4525 KRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYIS 4584

Query: 65   TLTVREVGPADQGSYAVIAGS 85
            +L +      D G Y   A +
Sbjct: 4585 SLEILRTQVVDCGEYTCKASN 4605



 Score = 32.0 bits (71), Expect = 3.9
 Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 1/76 (1%)

Query: 1179 EAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTL 1238
            E   FT+ L N  V    T  L C V   P  ++ W+K   ++ E  R+ + ++     L
Sbjct: 6156 EEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRIL 6214

Query: 1239 EIRKPCPFDGGIYVCR 1254
             I+     D G Y CR
Sbjct: 6215 VIQNAHLEDAGNYNCR 6230



 Score = 32.0 bits (71), Expect = 3.9
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 988   GEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPTD-TILFIRAARRVHSGTYQV 1045
             G+ V   I   G P P + W K+GQPL+ G  + I +   D   L IR      +G Y+V
Sbjct: 25504 GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRV 25563

Query: 1046  T 1046
             T
Sbjct: 25564 T 25564



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 5/81 (6%)

Query: 21    VAAGSPAVFEAETERAGVKV-RWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSY 79
             V AG+   F A      V   +W   GS+I     Y + T+     LT++     D G Y
Sbjct: 11217 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 11276

Query: 80    AV----IAGSSKVKFDLKVIE 96
              +     AGS  V   L V++
Sbjct: 11277 QITVSNAAGSKTVAVHLTVLD 11297



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 25/107 (23%), Positives = 43/107 (40%), Gaps = 11/107 (10%)

Query: 18    SVEVAAGSPAVFEAETERAGVK-VRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQ 76
             ++ V AG     EA+     +  + W RG  +I  S +  +     +  L V++    D 
Sbjct: 17329 TIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDG 17388

Query: 77    GSYAV----IAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGE 119
             G Y +    +AGS     ++KV++         P   P + TG   E
Sbjct: 17389 GQYILRASNVAGSKSFPVNVKVLDRP------GPPEGPVQVTGVTSE 17429



 Score = 31.6 bits (70), Expect = 5.1
 Identities = 32/96 (33%), Positives = 42/96 (43%), Gaps = 18/96 (18%)

Query: 988   GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDT----ILFIRAARRVHSGTY 1043
             GE         G+P P VTW ++GQ L+    S R+  T T       I + +    G Y
Sbjct: 26270 GESARFSCDTDGEPVPTVTWLRKGQVLS---TSARHQVTTTKYKSTFEISSVQASDEGNY 26326

Query: 1044  QVTVRIENMEDKA----TLVLQ---VVDK--PSPPQ 1070
              V V  EN E K     TL +Q   V +K   SPP+
Sbjct: 26327 SVVV--ENSEGKQEAEFTLTIQKARVTEKAVTSPPR 26360



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 1/71 (1%)

Query: 1183 FTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRK 1242
            F +PL +  V     A   C +      K+ WFK+G ++ +  ++ + SK  V  L I K
Sbjct: 6071 FLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINK 6129

Query: 1243 PCPFDGGIYVC 1253
                D   Y C
Sbjct: 6130 CLLDDEAEYSC 6140



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 43/175 (24%), Positives = 71/175 (40%), Gaps = 15/175 (8%)

Query: 379   HKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT-LTISQCSLADDAAYQCV 437
             + + L+ E  +HD   + L    E+Q  GS         K T  TI+     ++ +++  
Sbjct: 15758 NSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQGEEYSFRVS 15817

Query: 438   VGGEKCSTELFVKEPPV----LITRPLEDQL-----VMVGQRVEFECE-VSEEGAQVKWL 487
                EK  ++      PV    L+  P    L     V+ G+ ++ +   +      V W 
Sbjct: 15818 AQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWH 15877

Query: 488   KDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYA--LCTSGGQALAELIV 540
             KD V L  ++T +   +       L I +A  ED GHY   L  S G+A+  L V
Sbjct: 15878 KDNVPL--KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNV 15930



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 3/87 (3%)

Query: 23    AGSPAVFEAETE-RAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSY-A 80
             AGSP   +     R   KV W+     +  +++  + T   R TLTV++    D G Y  
Sbjct: 22356 AGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFL 22415

Query: 81    VIAGSSKVK-FDLKVIEAEKAEPMLAP 106
              +  ++ VK F + V+   +  P+  P
Sbjct: 22416 TLENTAGVKTFSVTVVVIGRPGPVTGP 22442



 Score = 31.2 bits (69), Expect = 6.6
 Identities = 31/113 (27%), Positives = 44/113 (38%), Gaps = 8/113 (7%)

Query: 963   TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSI 1021
             T++ + + P   LP + +      VGE V   +     P P VTW K GQ +  G+    
Sbjct: 25377 TMRLLERPPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKK 25433

Query: 1022  RNSPTDTILF---IRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQD 1071
                 +D  L+   I +        Y V  R +  ED     L V   P PP D
Sbjct: 25434 YTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHP-PPTD 25485



 Score = 30.8 bits (68), Expect = 8.6
 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 3/97 (3%)

Query: 981  QTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA-GEEVSIRNSPTDTILFIRAARRVH 1039
            Q +  + G+P        G+P+P+++W KE Q L+ G +    +   +  L +  A    
Sbjct: 3200 QPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPED 3259

Query: 1040 SGTYQVTVRIEN--MEDKATLVLQVVDKPSPPQDLRV 1074
            +  Y    + +       A+L ++V +  SP Q++ V
Sbjct: 3260 AAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPV 3296



 Score = 30.8 bits (68), Expect = 8.6
 Identities = 20/78 (25%), Positives = 31/78 (39%)

Query: 21   VAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYA 80
            V  G  A F  E     + V W +  + +  S    +++EG  H L ++EV   D     
Sbjct: 5280 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 5339

Query: 81   VIAGSSKVKFDLKVIEAE 98
                       LKV+EA+
Sbjct: 5340 AQVKELSSTAQLKVLEAD 5357


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  286 bits (732), Expect = 9e-77
 Identities = 238/845 (28%), Positives = 366/845 (43%), Gaps = 77/845 (9%)

Query: 386  ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCST 445
            +L+   A VKW +NG+EI+  G KY FE  G+   L I  C L D+  Y C V   K   
Sbjct: 6473 QLSREKANVKWYRNGREIK-EGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 6531

Query: 446  ELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKK 505
             LFV+E PV I RP +D L   G  V F  E++++  +V+WL++ + + + +  K++   
Sbjct: 6532 RLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD--KHQMMS 6589

Query: 506  DGQRHHLIINEAMLEDAGHYALCTSGGQALAEL-IVQEKKLEVYQSIADLMVGAKDQAVF 564
            +G+ H L I +    D G Y       +A A+L +    K++       + VG     V 
Sbjct: 6590 EGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVV 6649

Query: 565  KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
              +   +     W K  + L   S   +          I +    D+  Y  V +    N
Sbjct: 6650 PYDAYPK-AEAEWFKENEPL---STKTIDTTAEQTSFRILEAKKGDKGRYKIVLQ----N 6701

Query: 625  LSAKLH-FMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW 683
               K   F+ +K+            +D PG + +           L+V  + D   ++ W
Sbjct: 6702 KHGKAEGFINLKV------------IDVPGPVRN-----------LEVTETFDGEVSLAW 6738

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEK 743
            ++ +T G         +  +    +     D+   CE               FTV G +K
Sbjct: 6739 EEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCE---------------FTVTGLQK 6783

Query: 744  ED-EGVYTVTVKNPVGEDQVNLTVKVI------DVPDAPAAPKISNVGEDSCTVQWEPPA 796
               E ++ V+ +N VG  +   T   +      DVP  P    I++V     ++ WEPP 
Sbjct: 6784 GGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPE 6843

Query: 797  YDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSR 856
            YDGG  I  Y++E + K S RW        ++LS     ++EG  Y  RV A N IG+ +
Sbjct: 6844 YDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGK 6903

Query: 857  PSPASQPFM----PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG 912
            PS A+ PF+    PI  PS P +L   D + ++V LKW PP + G   + GY +E C EG
Sbjct: 6904 PSAAT-PFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEG 6962

Query: 913  CSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPR 972
               W+     L    +  V  L  G + L+RV A N AG   P     P+T  +    P 
Sbjct: 6963 KDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPT 7022

Query: 973  LQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILF 1031
            + L    +  ++  V  P+ +L+P  G PRP  TW    + L  G+ V ++       L 
Sbjct: 7023 MDLSA-FKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELV 7081

Query: 1032 IRAARRVHSGTYQVTVRIENMED--KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
            I  + R   G Y  T+++EN        + + V+ +PS P++L+  D    +V L W+PP
Sbjct: 7082 ISPSERSDKGIY--TLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPP 7139

Query: 1090 QDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             D G + L GY V+K +     W  V++        VP+L+ G  Y F+V ++N  G   
Sbjct: 7140 DDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCG-PG 7198

Query: 1150 RAATTKEPVFIPRPGITYEPP-NYKALDFSEAPSFT--QPLVN--RSVIAGYTAMLCCAV 1204
              A   EPV +  P    +PP N K  D +    F    P  N   S I GY    C   
Sbjct: 7199 EPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERC--P 7256

Query: 1205 RGSPK 1209
            RGS K
Sbjct: 7257 RGSDK 7261



 Score =  243 bits (619), Expect = 1e-63
 Identities = 204/708 (28%), Positives = 303/708 (42%), Gaps = 81/708 (11%)

Query: 567   EVSDENVRGVWLKNGKELVPDSRIKVSHI--GRVHKLTIDDVTPADEADYSFVPEGFACN 624
             +V DE  R     +  E  P+++ KV+ +  G+ +K  +  V  A E+D + VPE     
Sbjct: 10781 KVGDEEWRRA--NHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVK 10838

Query: 625   LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQ 684
                             R EPP++ LD        I V  G+ LRL   I G P P V W+
Sbjct: 10839 ---------------DRLEPPELILDANMAREQHIKV--GDTLRLSAIIKGVPFPKVTWK 10881

Query: 685   KAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKE 744
             K              DAP                     + R++ T   S   +  A  E
Sbjct: 10882 KEDR-----------DAPT--------------------KARIDVTPVGSKLEIRNAAHE 10910

Query: 745   DEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL 804
             D G+Y++TV+NP G   V++ V V+D P  P   ++S + +DSC + W+ P  DGG  I 
Sbjct: 10911 DGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVIT 10970

Query: 805   GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMS------RPS 858
              Y++ER+   S +W  L+    ++ SH A+ + EG  Y  RV A N  G        +P 
Sbjct: 10971 NYVVERRDVASAQWSPLS-ATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPI 11029

Query: 859   PASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVA 918
              A  P  P GPP +  H+   DV  T VSL W  P+R G   + GY VEY  EG  +W+ 
Sbjct: 11030 KALDPLHPPGPPKDLHHV---DVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK 11086

Query: 919   ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
                    +   +V  L  G    FRV+A N+ G G P  TT P+  QE L  P ++L   
Sbjct: 11087 F--KTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLP-DTTIPIECQEKLVPPSVELDVK 11143

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARR 1037
             L + +  K G  V      +G P P   WT +G  +   E  ++      ++L I+   R
Sbjct: 11144 LIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 11203

Query: 1038  VHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTE 1096
               +G YQ+TV          + L V+D P PP   + + D    ++ + W+PP+D G + 
Sbjct: 11204 RDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSP 11263

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS---DRAAT 1153
             +  Y V+K D +   W  V     +T   +P L  G  Y FRV ++N +G     D   T
Sbjct: 11264 VINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPT 11323

Query: 1154  TKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVN-RSVIAGY------TAMLCCAVRG 1206
               +  F P P    +P      + +   S+T P  +  S I GY             V  
Sbjct: 11324 VAKHKFSP-PSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNK 11382

Query: 1207  SPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCR 1254
             +P   + +   GL  G    FR+F++       + KP P    I  CR
Sbjct: 11383 TPIADLKFRVTGLYEGNTYEFRVFAEN---LAGLSKPSPSSDPIKACR 11427



 Score =  238 bits (608), Expect = 2e-62
 Identities = 190/681 (27%), Positives = 288/681 (42%), Gaps = 96/681 (14%)

Query: 344  DLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEI 403
            DLR +++ LK +   EKKS  F  K+            RL V L       KW KNG+E+
Sbjct: 6361 DLR-IVEPLKDIETMEKKSVTFWCKVN-----------RLNVTL-------KWTKNGEEV 6401

Query: 404  QMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQ 463
                ++  +     K  LTI  C   D+  Y    G +K   EL + E P      LEDQ
Sbjct: 6402 PFD-NRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 6460

Query: 464  LVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAG 523
             V       F C++S E A VKW ++G E+  +E  KY+F+KDG  H LII +  L+D  
Sbjct: 6461 TVTEFDDAVFSCQLSREKANVKWYRNGREI--KEGKKYKFEKDGSIHRLIIKDCRLDDEC 6518

Query: 524  HYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKE 583
             YA      ++ A L V+E  +E+ +   D++       VF  E++ + V   WL+N   
Sbjct: 6519 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 6578

Query: 584  LVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE 643
            +V   + ++   G++H+L I D+ P D+ +Y F+         AK      K++      
Sbjct: 6579 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI---------AKDKEARAKLELA---A 6626

Query: 644  PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PKI           +VV  G  L + VP    P     W K                  
Sbjct: 6627 APKIK-----TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKE----------------- 6664

Query: 704  DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
                      ++ L  +T     ++TT +++ F +  A+K D+G Y + ++N  G+ +  
Sbjct: 6665 ----------NEPLSTKT-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGF 6709

Query: 764  LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF 823
            + +KVIDVP      +++   +   ++ WE P  DGG  I+GY++ER+  K   W+ L  
Sbjct: 6710 INLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWV-LAT 6768

Query: 824  DLIQELSHEARRMIE-GVVYEMRVYAVNAIGMSRPSPASQPF---MPIGPPSEPTHLAVE 879
            D  +        + + GV Y  RV A N +G   P     P         P  P ++ + 
Sbjct: 6769 DRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTIT 6828

Query: 880  DVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
            DV+   VSL W PPE  G   +  Y +E   +    W  A+    E  S  V D+  G  
Sbjct: 6829 DVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQE 6888

Query: 940  LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
              FRVRA N  G G P   T  V V + ++RP                  PVNL    Q 
Sbjct: 6889 YSFRVRAQNRIGVGKPSAATPFVKVADPIERP----------------SPPVNLTSSDQT 6932

Query: 1000 KPRPQVTWTKE----GQPLAG 1016
            +   Q+ W       G P+ G
Sbjct: 6933 QSSVQLKWEPPLKDGGSPILG 6953



 Score =  236 bits (601), Expect = 1e-61
 Identities = 159/530 (30%), Positives = 248/530 (46%), Gaps = 48/530 (9%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R EPP+I LD   R    +V+ A   LRL V I G P P V W+KA              
Sbjct: 18729 RIEPPEIELDADLR--KVVVLRASATLRLFVTIKGRPEPEVKWEKA-------------- 18772

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                           + +L +   R ++E T   ++  ++   + D G Y +T++N  G  
Sbjct: 18773 --------------EGILTD---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSK 18815

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSYRW 818
                + V+V+D P AP    I  V +DS T+ WEPP  DGG  I  YI+E+++  +K+Y  
Sbjct: 18816 TAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYAT 18875

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAV 878
             +  N     + +     + EG  Y  RV A N  G+  P+  ++P     PP  P  + +
Sbjct: 18876 ITNN---CTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTL 18932

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
              DV+  T ++KW  PE  G   + GY VE   +G  +W    Q  T   +I    L  G 
Sbjct: 18933 VDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATI--SGLTAGE 18990

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
               +FRV A N  G   P     PV  ++I  +P ++LP H   T   K  E + + +PF+
Sbjct: 18991 EYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFK 19047

Query: 999   GKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             G+P+  V W K+GQ L     V++ +S T T L I+ A +   GTY++ V          
Sbjct: 19048 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 19107

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
             + + V+D+P PP  +R+ +    ++ + W PP+  G  ++  Y V+K +  +  W  V +
Sbjct: 19108 ITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ 19167

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVG---FSDRAATTKEPVFIPRPG 1164
                RT   +  L  G+ Y FRV ++N  G   +S+ +A   E  F P PG
Sbjct: 19168 AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSP-PG 19216



 Score =  234 bits (596), Expect = 5e-61
 Identities = 179/608 (29%), Positives = 272/608 (44%), Gaps = 59/608 (9%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W   G +L    R+ V    +V KLTI + T  D  +Y+   +      S       +K+
Sbjct: 23400 WFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSET-----IKV 23454

Query: 637   DFVPRQEPPK--IHLDCPGRIPDTIVVVAGNKLRLD--VPISGDPAPTVIWQKAITQGNK 692
               + +  PP   I +D    I  T + ++     LD   P+SG     V+ Q+       
Sbjct: 23455 IILDKPGPPTGPIKID---EIDATSITISWEPPELDGGAPLSG----YVVEQR------- 23500

Query: 693   APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                    DA                     G + V  +  RS F      + +E V+ V 
Sbjct: 23501 -------DA------------------HRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVA 23535

Query: 753   VKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYI 807
               N  G     + +V      I +P  P   +I +V  D  T+ W PP  DGG  + GYI
Sbjct: 23536 ATNRFGIGSYLQSEVIECRSSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYI 23595

Query: 808   LERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM-- 865
             +ERK+ ++ RW+R+N   +    + +  + EG+ YE RV A+NA G  +PS  S+P +  
Sbjct: 23596 VERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAM 23655

Query: 866   -PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLT 924
              PI PP +P +  V D + T+VSL W  PE  G   + GY +E       EW       T
Sbjct: 23656 DPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPT 23715

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
             +     +  LP GA   FRV A N  GPG P      V V E+L+ P  +L    ++ I 
Sbjct: 23716 KIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIF 23775

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
              + G  + L IP +GKP P   WTKEGQ ++ +   I  S T T L I+ A R  SGTY 
Sbjct: 23776 VRQGGVIRLTIPIKGKPFPICKWTKEGQDIS-KRAMIATSETHTELVIKEADRGDSGTYD 23834

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             + +  +  +    + ++V+  P+ P+  L   D    +V + W+PP D G  ++ GY ++
Sbjct: 23835 LVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILE 23894

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             + +     W+T+    R T  VV  L     Y+FRV ++N  G S +   ++EPV    P
Sbjct: 23895 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGIS-KPLKSEEPVTPKTP 23953

Query: 1164  GITYEPPN 1171
                 EPP+
Sbjct: 23954 LNPPEPPS 23961



 Score =  232 bits (591), Expect = 2e-60
 Identities = 155/508 (30%), Positives = 236/508 (46%), Gaps = 43/508 (8%)

Query: 702   PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG- 758
             P+D G S    +V +K+     +  V V +      +T+    +  E V+ +  +N  G 
Sbjct: 9869  PKDDGGSKITNYVIEKRE-ANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGI 9927

Query: 759   ----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
                 + +      +  VP AP  P +S+V  +S TV WE P YDGG P+ GY LE K   
Sbjct: 9928  GEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTT 9987

Query: 815   SYRWMRLNFDLIQEL----SHEARRMIEGVVYEMRVYAVNAIGM------SRPSPASQPF 864
             S RW R+N D I+ +    S++   +IEG  Y+ RVYA+NA G+      S P+ A  P 
Sbjct: 9988  SKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPI 10047

Query: 865   MPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLT 924
              P GPP       V D + ++  L+W PP + G   + GY VEY  EG  EW        
Sbjct: 10048 APPGPPFPK----VTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEV 10103

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
               T ++V  L  GA   FRVRA N+AG G P   T+ + +++ L  P LQL   +R  I 
Sbjct: 10104 RGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIV 10163

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
                G  + ++    GKP P VTW    + L  +E +I  +   + + I+  +R H G Y 
Sbjct: 10164 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLP-QEATIETTAISSSMVIKNCQRSHQGVYS 10222

Query: 1045  VTVRIENMEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             +  + E  E K T+++ V+D P P        +    +  L W  P+D G + +  Y ++
Sbjct: 10223 LLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIE 10282

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF-----SDRAATTKEPV 1158
             K +     W  V     R +  V  LI G  Y+FR+ ++N +G      +  A   +EP+
Sbjct: 10283 KRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPI 10342

Query: 1159  FIP-RP-------------GITYEPPNY 1172
              +P RP              +T+ PP Y
Sbjct: 10343 TVPERPEDLEVKEVTKNTVTLTWNPPKY 10370



 Score =  232 bits (591), Expect = 2e-60
 Identities = 161/590 (27%), Positives = 263/590 (44%), Gaps = 48/590 (8%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P++ LD    +   IVV AG   R+ +P  G P P + W +                 
Sbjct: 17648 EAPELDLD--SELRKGIVVRAGGSARIHIPFKGRPTPEITWSR----------------- 17688

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                   +E  F  K        V++E   + +  +++  ++ D G Y + ++N  G    
Sbjct: 17689 ------EEGEFTDK--------VQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSA 17734

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
              +TVKV+D P  P    +  V +DS  + WEPP  DGG  +  Y++++++     +  ++
Sbjct: 17735 FVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVS 17794

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVS 882
                  + S +   + EG +Y  RV A N  G+  P           PPS P  + + DVS
Sbjct: 17795 -SKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVS 17853

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
              T+ SL W  PE  G   + GY VE  P+G  +W  ++   ++  + +V  L +G    F
Sbjct: 17854 QTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKW--SIVAESKVCNAVVTGLSSGQEYQF 17911

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV+A+N  G   P     PV  +++  +P L+LP +   T   + GE + + IP  G+PR
Sbjct: 17912 RVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPR 17968

Query: 1003  PQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQ 1061
             P ++W K+G+PL     V++  + T T+L I+   +   G Y VT           L + 
Sbjct: 17969 PNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVI 18028

Query: 1062  VVDKPSPP-QDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             V++KP PP   +R  +     V + W+PP   G  ++  Y V+K D  T  W  V     
Sbjct: 18029 VLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVA 18088

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
             RT   + +L  G  Y FR+F++N  G S  A    + V +  P   ++ P      F  +
Sbjct: 18089 RTTIKITKLKTGTEYQFRIFAENRYGKS--APLDSKAVIVQYP---FKEPGPPGTPFVTS 18143

Query: 1181  PSFTQPLV--NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFR 1228
              S  Q LV  +  V  G T ++   +    K  I W K      +D +F+
Sbjct: 18144 ISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18193



 Score =  231 bits (588), Expect = 4e-60
 Identities = 175/602 (29%), Positives = 274/602 (45%), Gaps = 99/602 (16%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIW------------------- 683
             EPP++ +D   R  D IVV AG  L+++  I+G P P + W                   
Sbjct: 19413 EPPRVMMDVKFR--DVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTD 19470

Query: 684   ----------------QKAITQGNKAPAR-----------PAPDA--------------- 701
                             Q  +T  N A  R           P P A               
Sbjct: 19471 NHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSL 19530

Query: 702   ----PEDTG--DSDEWVFDKK-------LLCETEGRVRVETTKDRSIFTVEGAEKEDEGV 748
                 P++ G  D D ++ +K+        +CE  G +++ + K   +       K +E +
Sbjct: 19531 SWGRPQEDGGADIDYYIVEKRETSHLAWTICE--GELQMTSCKVTKLL------KGNEYI 19582

Query: 749   YTVTVKNP--VGEDQVNLTVKVID---VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPI 803
             + VT  N   VGE   ++ +K +D   VP  P + +I++V ++S T+ W  P  DGG  I
Sbjct: 19583 FRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSVTKESMTLCWSRPESDGGSEI 19642

Query: 804   LGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRP---SPA 860
              GYI+ER++K S RW+R+N   + +L  ++  + EG  YE RVYA NA G+S P   SP 
Sbjct: 19643 SGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPL 19702

Query: 861   SQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAAL 920
              +   P+  PS P+   + D   TT+++ W  P   G   + GY+VEY     ++W  ++
Sbjct: 19703 IRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSI 19762

Query: 921   QGL--TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
             Q L  TE+T   +  L TGA  +FRV++ N  G   P  +++P   +E  + P   +   
Sbjct: 19763 QSLRGTEYT---ISGLTTGAEYVFRVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSE 19819

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRV 1038
             +R+T+  K G    + +PF+G+P P V W+K    L      +  + + T L I  A R 
Sbjct: 19820 MRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLR-TRAYVDTTDSRTSLTIENANRN 19878

Query: 1039  HSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
              SG Y +T++        TLV++V+D P PP ++ V D    +  L W  P++ G   + 
Sbjct: 19879 DSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVK 19938

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
              Y ++K +     W +V  +  R    V  L  G  YYFRV  +N  G     A TKE V
Sbjct: 19939 NYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVG-IPAETKEGV 19997

Query: 1159  FI 1160
              I
Sbjct: 19998 KI 19999



 Score =  230 bits (587), Expect = 6e-60
 Identities = 151/532 (28%), Positives = 240/532 (45%), Gaps = 42/532 (7%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R+E P   +D   R   T++V AG    + VP  G P P V+W K             PD
Sbjct: 19808 REEEPLFDIDSEMR--KTLIVKAGASFTMTVPFRGRPVPNVLWSK-------------PD 19852

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                 T                  R  V+TT  R+  T+E A + D G YT+T++N +   
Sbjct: 19853 TDLRT------------------RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAA 19894

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMR 820
              + L VKV+D P  P    + +V ++S  + W+ P  DGG P+  Y +E+++     W+ 
Sbjct: 19895 SLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVS 19954

Query: 821   LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVED 880
             +  +    LS++   + EG +Y  RV   N  G+  P+   +       PS P  L V  
Sbjct: 19955 VTNNC-NRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEKPSPPEKLGVTS 20013

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL 940
             +S  +VSL W  PE  G   +  Y VE   +G   WV     + + T  +V  L   +  
Sbjct: 20014 ISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC--AVAKSTHHVVSGLRENSEY 20071

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FRV A N AG   P     PV ++E L+ P + +      T+  + G  + + IP  GK
Sbjct: 20072 FFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGK 20131

Query: 1001  PRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLV 1059
             P P+VT +++G PL A    +   +  +  + ++ +    +G Y++T    +   KA + 
Sbjct: 20132 PLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFIN 20191

Query: 1060  LQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEH 1118
             + V+D+P PP   + ++D    +V L+W+PP+  G +++  Y + K +  T  W  V   
Sbjct: 20192 IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSAT 20251

Query: 1119  YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR----AATTKEPVFIPRPGIT 1166
               RT   V +L  G  Y FR+ ++N  G SD       T K P   P P  T
Sbjct: 20252 VARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPST 20303



 Score =  229 bits (585), Expect = 1e-59
 Identities = 167/615 (27%), Positives = 275/615 (44%), Gaps = 63/615 (10%)

Query: 565  KCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACN 624
            +CE   +N    W++   +LVP+   KV+ + + +K  +  V+  ++A  S  P      
Sbjct: 6958 RCEEGKDN----WIRCNMKLVPELTYKVTGLEKGNKY-LYRVSAENKAGVSD-PSEILGP 7011

Query: 625  LSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQ 684
            L+A   F+E  +D                   D + V+  N + + VP +G P PT  W 
Sbjct: 7012 LTADDAFVEPTMDL--------------SAFKDGLEVIVPNPITILVPSTGYPRPTATW- 7056

Query: 685  KAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKE 744
                                        F  K+L ET  RV+++T    +   +  +E+ 
Sbjct: 7057 ---------------------------CFGDKVL-ETGDRVKMKTLSAYAELVISPSERS 7088

Query: 745  DEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPIL 804
            D+G+YT+ ++N V      + V VI  P AP   K  ++ +DS  + WEPP  DGG P+ 
Sbjct: 7089 DKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLT 7148

Query: 805  GYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPF 864
            GY++E+++     W ++  D + +L      +++G  Y  +V A N  G   P+   +P 
Sbjct: 7149 GYVVEKREVSRKTWTKV-MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPV 7207

Query: 865  ---MPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQ 921
                P   P  P ++   D +  ++ L W PP+  G   + GY VE CP G  +WVA  +
Sbjct: 7208 NMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGE 7267

Query: 922  GLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQ 981
             + E T + V  L  G    +RV+A N  G   P   TE +   +  + P + L   L  
Sbjct: 7268 PVAE-TKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLA 7326

Query: 982  TIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIRAARRVHS 1040
             +  K G  + L     GKP P++TWTK    L  ++ ++I N P  + + I  ++R  +
Sbjct: 7327 GLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDT 7386

Query: 1041 GTYQVTVRIENMEDKATLVLQ--VVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
            GTY   +   N+  +AT V++  V+DKP PP    +TD    +  L W PP+D G +++ 
Sbjct: 7387 GTY--IIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKIT 7444

Query: 1099 GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD----RAATT 1154
             Y V++    +  W  +    + T+    +LI    Y FRV ++NM G  +       T 
Sbjct: 7445 NYVVERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITA 7504

Query: 1155 KEPVFIPRPGITYEP 1169
            K     P P    EP
Sbjct: 7505 KYQFDPPGPPTRLEP 7519



 Score =  225 bits (574), Expect = 2e-58
 Identities = 166/609 (27%), Positives = 271/609 (44%), Gaps = 60/609 (9%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P I LD   R    I + AG  LRL VPI G P P V W K                 
Sbjct: 16566 EAPDIDLDLELR--KIINIRAGGSLRLFVPIKGRPTPEVKWGKV---------------- 16607

Query: 703   EDTGDSDEWVFDKKLLCETEGRVR----VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG 758
                                +G +R    ++ T   +   ++   + D G YT+T++N  G
Sbjct: 16608 -------------------DGEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSG 16648

Query: 759   EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSY 816
                  +TV+V+D P  P   K++ + +DS ++ WEPP  DGG  I  YI+E+++  +KSY
Sbjct: 16649 TKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSY 16708

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHL 876
               +  N     + S +  ++ EG  Y  RV A N  G+  P+  + P      P  P  +
Sbjct: 16709 AAVVTN---CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 16765

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V+DV+  +VSL W  PE  G   +  Y VE   +   +W    +   +    ++ +L  
Sbjct: 16766 TVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQ 16823

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G   LFRV A N  G   P +   P+  ++++  P ++ P     ++Q  VG+ + + +P
Sbjct: 16824 GEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVK-PAFSSYSVQ--VGQDLKIEVP 16880

Query: 997   FQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDK 1055
               G+P+P +TWTK+G PL     +++ +S   T L I+   +   G Y +TV     +  
Sbjct: 16881 ISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKT 16940

Query: 1056  ATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFT 1114
             A++ +  +DKP PP+  ++  D    ++ L W PP   G  ++  Y VQK D  T  W  
Sbjct: 16941 ASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDV 17000

Query: 1115  VLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKA 1174
             V     RT   V +L  G  Y FR+F++N  G S   A   +P+    P   Y+ P    
Sbjct: 17001 VSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS--FALESDPIVAQYP---YKEPGPPG 17055

Query: 1175  LDFSEAPSFTQPLV--NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSK 1232
               F+ A S    ++  +  V  G + ++   +    +  I W K    +  D +F+  + 
Sbjct: 17056 TPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNL 17115

Query: 1233  QGVLTLEIR 1241
             +  +  E R
Sbjct: 17116 EEGIEYEFR 17124



 Score =  224 bits (571), Expect = 4e-58
 Identities = 156/532 (29%), Positives = 231/532 (43%), Gaps = 44/532 (8%)

Query: 622   ACNLSAKLHFME--VKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAP 679
             A N+     + E   +I+ V R E P + L     +  T+ + AG  LRL V +SG P P
Sbjct: 23047 AVNVKGMSEYSESIAEIEPVERIEIPDLEL--ADDLKKTVTIRAGASLRLMVSVSGRPPP 23104

Query: 680   TVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE 739
              + W K   QG                             +   R  ++TT+  S+  V+
Sbjct: 23105 VITWSK---QG----------------------------IDLASRAIIDTTESYSLLIVD 23133

Query: 740   GAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDG 799
                + D G YT+  +N  G+    + VKV D P    + K+  V  DS T+ WE P  DG
Sbjct: 23134 KVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDG 23193

Query: 800   GQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP 859
             G P+  YI+E K++ + R  +       +  +    ++EG +Y  RV   N  G+  P  
Sbjct: 23194 GAPVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE 23252

Query: 860   ASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW--- 916
              S   +    P  P  L V DV+ +TV+L W  P   G   L GY +E C  G   W   
Sbjct: 23253 TSDAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKV 23312

Query: 917   VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLP 976
             V     + EHT   V  L  G + LFR+RA N  G   P  T   VTVQ++   P + L 
Sbjct: 23313 VTLKPTVLEHT---VTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLS 23369

Query: 977   RHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAA 1035
                ++TI    G PV L+IP  G+P P  +W   G  L   E V++        L IR  
Sbjct: 23370 TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRET 23429

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGN 1094
                 +G Y + ++        T+ + ++DKP PP   +++ +    ++ + W+PP+  G 
Sbjct: 23430 TIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGG 23489

Query: 1095  TELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
               L GY V++ D     W  V E   R+      L  GN Y FRV + N  G
Sbjct: 23490 APLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFG 23541



 Score =  220 bits (561), Expect = 6e-57
 Identities = 171/617 (27%), Positives = 257/617 (41%), Gaps = 63/617 (10%)

Query: 575   GVWLKNGKELVPDSRIKVSHI--GRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFM 632
             G W K   E    +R  V+ +  G  +K  +  +  A + D        +C ++      
Sbjct: 21926 GDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGD--------SCEVTGT---- 21973

Query: 633   EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNK 692
                I  V R   P++ +D       T VV AG  +RL +   G P PT +W K       
Sbjct: 21974 ---IKAVDRLTAPELDIDA--NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSK------- 22021

Query: 693   APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                   PD+                      R  + TT   S  TVE   + D G YT+T
Sbjct: 22022 ------PDS------------------NLSLRADIHTTDSFSTLTVENCNRNDAGKYTLT 22057

Query: 753   VKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             V+N  G   +  TVKV+D P  P      +V   S T+ W+ P  DGG  I  Y++E+++
Sbjct: 22058 VENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKRE 22117

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSE 872
                  W  ++    +++  +   + EGV Y  RV AVN  G+  P    +P +    P+ 
Sbjct: 22118 ASRRSWQVISEKCTRQI-FKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAP 22176

Query: 873   PTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVK 932
             P  L V D S ++  L W  P+  G   + GY +E   +G   WV A  G T+  +  V+
Sbjct: 22177 PRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA--GHTKQLTFTVE 22234

Query: 933   DLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN 992
              L       FRV+A N AG   P      V ++E    P   L     Q I  K G P  
Sbjct: 22235 RLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFT 22294

Query: 993   LLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
             + +P  G+P P+VTW  E   L   + VSI  +   T L ++ + R  SG Y +T+    
Sbjct: 22295 IDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTA 22354

Query: 1052  MEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTM 1110
                  ++ + V+ +P P    + V+     +  L W  P+D G TE+  Y V+K +  T 
Sbjct: 22355 GVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTT 22414

Query: 1111  EWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS---DRAATTKEPVFIP-----R 1162
              W  V    +RT   V  L     Y FRV S+N  G S   + A    E  F+P     R
Sbjct: 22415 AWQLVNSSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTR 22474

Query: 1163  PGITYEPPNYKALDFSE 1179
             P + +   N  ++ + E
Sbjct: 22475 PEVYHVSANAMSIRWEE 22491



 Score =  219 bits (559), Expect = 1e-56
 Identities = 172/604 (28%), Positives = 278/604 (46%), Gaps = 64/604 (10%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W+K  +EL   +R+++        L++ D    D  +Y    +  A   S  ++   VK+
Sbjct: 16205 WIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVN---VKV 16261

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                         LD PG  P+  VV++G        ++ +   T+ W+  +  G      
Sbjct: 16262 ------------LDRPGP-PEGPVVISG--------VTAEKC-TLAWKPPLQDGGS---- 16295

Query: 697   PAPDAPEDTGDSDEWVFDKK---LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
                       D   ++ +++    L  T     V+T   +    +EG    +E  + +  
Sbjct: 16296 ----------DIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEG----NEYTFRIMA 16341

Query: 754   KNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYIL 808
              N  G     E +  +      VPDAP AP+++ V +DS  V WE PA DGG  ILGY+L
Sbjct: 16342 VNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEILGYVL 16401

Query: 809   ERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPAS---QPFM 865
             E++ K+  RW R +  LI EL      +IE   YE RV A NA G+S PSP S   +   
Sbjct: 16402 EKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEPSPPSAYQKACD 16461

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAAL--QGL 923
             PI  P  P +  V D++ ++V L W  P   G   + GY VE C     EW       G+
Sbjct: 16462 PIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGI 16521

Query: 924   TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
              + T+I V+ L       FR+ A N AG G       P+ V+E L+ P + L   LR+ I
Sbjct: 16522 NK-TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKII 16580

Query: 984   QKKVGEPVNLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
               + G  + L +P +G+P P+V W K +G+      + + +S T  +L      R  SG 
Sbjct: 16581 NIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVL--DNVNRYDSGK 16638

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
             Y +T+   +    A + ++V+D PSPP +L+VT+    +V++ W+PP   G +++  Y V
Sbjct: 16639 YTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIV 16698

Query: 1103  QKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV---F 1159
             +K +     +  V+ +  +    + +L  G  YYFRV ++N  G     A T +P+    
Sbjct: 16699 EKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIG-LPAQTADPIKVAE 16757

Query: 1160  IPRP 1163
             +P+P
Sbjct: 16758 VPQP 16761



 Score =  219 bits (557), Expect = 2e-56
 Identities = 152/493 (30%), Positives = 234/493 (47%), Gaps = 38/493 (7%)

Query: 700   DAPEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFT----VEGAEKEDEGVYTVTV 753
             D PED G  +   ++ +K   CET+  V   +T   ++ T    V    + +E ++ V  
Sbjct: 11946 DPPEDDGGCEIQNYILEK---CETKRMVW--STYSATVLTPGTTVTRLIEGNEYIFRVRA 12000

Query: 754   KNPVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYIL 808
             +N +G      +  VI     D P  P  P+++ V ++  TV W PP YDGG+ I GY L
Sbjct: 12001 ENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFL 12060

Query: 809   ERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM--- 865
             E+K+K S RW+ +N   I E   + + ++    Y+ RV A N IG+  PS  S+P +   
Sbjct: 12061 EKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVAKD 12120

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP--------EGCSEWV 917
             PI PP  PT+  V D +  +++L W  P   G   + GY VE  P        EG     
Sbjct: 12121 PIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKRCN 12180

Query: 918   AALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPR 977
             AA Q + +     V  L       FRV A N  G G P    E +  +EIL+ P + L  
Sbjct: 12181 AAAQLVRK--EFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDA 12238

Query: 978   HLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
              +R+ +  + G P+ L    +G+P P+VTW K G      +  +    T   L I  + R
Sbjct: 12239 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAFLVIPNSTR 12298

Query: 1038  VHSGTYQVTVRIENMEDKATLV-LQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               SG Y +T+ +    +KA  V ++V+D P P  DL+V+D    +  + W PP++ G ++
Sbjct: 12299 DDSGKYSLTL-VNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQ 12357

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKE 1156
             +  Y V+K +     W TV    ++T   V  L+ GN YYFRV + N  G          
Sbjct: 12358 VTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYG-------PGV 12410

Query: 1157  PVFIPRPGITYEP 1169
             P  +P+P +  +P
Sbjct: 12411 PTDVPKPVLASDP 12423



 Score =  218 bits (554), Expect = 4e-56
 Identities = 174/627 (27%), Positives = 269/627 (42%), Gaps = 72/627 (11%)

Query: 573   VRGV------WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLS 626
             +RGV      W  +G E+  D    V        LTI +    D  +Y       A + +
Sbjct: 11162 IRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKT 11221

Query: 627   AKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKA 686
               +H                  LD PG     I +       LDV        T+ WQ  
Sbjct: 11222 VAVHLTV---------------LDVPGPPTGPINI-------LDVT---PEHMTISWQP- 11255

Query: 687   ITQGNKAPARPAPDAPEDTGDSD--EWVFDKK-LLCETEGRVRVETTKDRSIFTVEGAEK 743
                            P+D G S    ++ +K+    +T G V   ++K +    +   +K
Sbjct: 11256 ---------------PKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK--LKIPHLQK 11298

Query: 744   EDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD 798
               E V+ V  +N +G     +    +       P  P  P ++++ E++ TV W  P  D
Sbjct: 11299 GCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSD 11358

Query: 799   GGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPS 858
             GG PI GY +ER++    +W+R+N   I +L      + EG  YE RV+A N  G+S+PS
Sbjct: 11359 GGSPITGYYMERREVTG-KWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPS 11417

Query: 859   PASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSE 915
             P+S P     PI PP  P +  ++D S  T  L W  P   G   + GY VE    G ++
Sbjct: 11418 PSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQ 11477

Query: 916   WVAALQG-LTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQ 974
             W    +  L    +  V  L  G    FR++A N+ G G P    E V  ++IL  P ++
Sbjct: 11478 WNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVE 11537

Query: 975   LPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIR 1033
             L    R  I  +VG+ + +L   +G+P P +TWTKEG+ L  E+ V +        L I+
Sbjct: 11538 LDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIK 11597

Query: 1034  AARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
              A R   G Y ++ +  +   + + ++ V+D+P P Q+L+VT+    N  + W+ P D G
Sbjct: 11598 EAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNG 11657

Query: 1094  NTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
              +E+  + V+        W  V     +   +   L+  N YYFRV ++N VG       
Sbjct: 11658 GSEITNFIVEYRKPNQKGWSIVASDVTK-RLIKANLLANNEYYFRVCAENKVGVGP-TIE 11715

Query: 1154  TKEPVF----IPRPGITYEPPNYKALD 1176
             TK P+     I RPG   EP N    D
Sbjct: 11716 TKTPILAINPIDRPG---EPENLHIAD 11739



 Score =  218 bits (554), Expect = 4e-56
 Identities = 153/548 (27%), Positives = 243/548 (44%), Gaps = 49/548 (8%)

Query: 633   EVKIDFVPRQ--EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQG 690
             E+K    P++  EPP+I LD   R    ++V AG  +RL   + G PAP V W+K    G
Sbjct: 12218 ELKEAIKPKEILEPPEIDLDASMR--KLVIVRAGCPIRLFAIVRGRPAPKVTWRKV---G 12272

Query: 691   NKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYT 750
                  R                             +V+     +   +  + ++D G Y+
Sbjct: 12273 IDNVVRKG---------------------------QVDLVDTMAFLVIPNSTRDDSGKYS 12305

Query: 751   VTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
             +T+ NP GE  V + V+V+D P   +  K+S+V + SC V W PP  DGG  +  YI+E+
Sbjct: 12306 LTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGSQVTHYIVEK 12365

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PI 867
             ++     W  +  + +++ S     ++ G  Y  RV AVN  G   P+   +P +   P+
Sbjct: 12366 READRKTWSTVTPE-VKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPL 12424

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG--CSEWVAALQGLTE 925
               P  P  L V +++  + +L W PP R G   +DGY   Y  E      W      + +
Sbjct: 12425 SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTE--YSVVK 12482

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
               S++V  L  G +  FRV A N  G   P         +E L  P++ +P    + I  
Sbjct: 12483 DLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMP----EQITI 12538

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
             K G+ + +     GKP P   W K E + +    +++  + + +IL I+   R  SG Y 
Sbjct: 12539 KAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYS 12598

Query: 1045  VTVRIENMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
             +T    +  D   + + V+D P PPQ    ++D      +L W  P + G + +  Y V+
Sbjct: 12599 LTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVE 12658

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             K D    +W T L    +T C V +LI G  Y FRV ++N  G S+   + K     P  
Sbjct: 12659 KCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISEPLTSPKMVAQFPF- 12717

Query: 1164  GITYEPPN 1171
             G+  EP N
Sbjct: 12718 GVPSEPKN 12725



 Score =  217 bits (552), Expect = 7e-56
 Identities = 151/520 (29%), Positives = 234/520 (45%), Gaps = 42/520 (8%)

Query: 636   IDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPA 695
             I+   R   P + LD   R  D IVV AG  +R+   +SG P PTV W            
Sbjct: 10141 IEMKDRLVSPDLQLDASVR--DRIVVHAGGVIRIIAYVSGKPPPTVTWNMN--------E 10190

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
             R  P                           +ETT   S   ++  ++  +GVY++  KN
Sbjct: 10191 RTLPQ-----------------------EATIETTAISSSMVIKNCQRSHQGVYSLLAKN 10227

Query: 756   PVGEDQVNLTVKVIDVPDAPAAPKIS-NVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
               GE +  + V V+DVP     P ++ N+  +SC + W  P  DGG PI  Y++E+++  
Sbjct: 10228 EAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESD 10287

Query: 815   SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPS 871
                W  + + + ++ +   + +I+G  Y  R+ A N+IGM      S+  +   PI  P 
Sbjct: 10288 RRAWTPVTYTVTRQ-NATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPE 10346

Query: 872   EPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILV 931
              P  L V++V+  TV+L W PP+  G   +  Y +E    G  ++              V
Sbjct: 10347 RPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTV 10406

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
             K L  G    +RV A N+ G G P   T+P+T ++ L  P L L    + TI  +VGE  
Sbjct: 10407 KGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTI--RVGEAF 10464

Query: 992   NLLIPFQGKPRPQVTWTK-EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE 1050
              L   + GKP+P+V+W K E   L  +   I+ +P    L    A+R  SG Y V V   
Sbjct: 10465 ALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENS 10524

Query: 1051  NMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
                 K    + VVD+P PP   +   +     + + WKPP D G +++  Y ++K +   
Sbjct: 10525 TGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGK 10584

Query: 1110  MEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
               W  V     +T C V +L+ G  Y FR+ ++N+ G SD
Sbjct: 10585 DVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGISD 10624



 Score =  214 bits (546), Expect = 3e-55
 Identities = 169/608 (27%), Positives = 283/608 (46%), Gaps = 58/608 (9%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P+I LD   R   +++  AG  +++ +P  G P PTV W+K                 
Sbjct: 20895 EAPEIDLDVALRT--SVIAKAGEDVQVLIPFKGRPPPTVTWRK----------------- 20935

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D+K L  ++ R  +E T   S+ T+    + D G Y +T++N VGE + 
Sbjct: 20936 -----------DEKNL-GSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKS 20983

Query: 763   N-LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
             + ++VKV+D P A    ++ +V   + T+ W+PP  DGG PI+ Y++E++      W  +
Sbjct: 20984 STVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVV 21043

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
             +       S +   + E   +  RV A N IG+  P   ++P      P+    L+++D 
Sbjct: 21044 SHKC-SSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDS 21102

Query: 882   SDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLL 941
             + T+V L W  P+  G   +  Y VE   +G   W  A  G+++   I V  L   + L 
Sbjct: 21103 TKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHA--GISKTCEIEVSQLKEQSVLE 21160

Query: 942   FRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKP 1001
             FRV A N  G   PVT   P+TV+E++  P + L       +  ++G  V+L +P++GKP
Sbjct: 21161 FRVFAKNEKGLSDPVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKP 21219

Query: 1002  RPQVTWTKEGQPLAGEEVSIRNSPTDT--ILFIRAARRVHSGTYQVTVRIENMEDKATLV 1059
             +P ++W K+G PL   E  +R S T+    L I+ A++ H G Y  TV ++N   +  + 
Sbjct: 21220 KPSISWLKDGLPLKESEF-VRFSKTENKITLSIKNAKKEHGGKY--TVILDNAVCRIAVP 21276

Query: 1060  LQVV--DKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
             + V+    PS P+  +R  +    +V L W  P+D G  E+  Y+++K +     W  V 
Sbjct: 21277 ITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVC 21336

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATT----KEPVFIPRPGITYEPPNY 1172
                 RT   VP L+    Y FRV ++N  G S    ++    K    IP P    +P  Y
Sbjct: 21337 SSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGP--PGKPVIY 21394

Query: 1173  KALDFSEAPSFTQPLVN-RSVIAGY-------TAMLCCAVRGSPKPKISWFKNGLDLGED 1224
                    + ++  P+ +  S + G+        ++L   V  SP     +   GL  G D
Sbjct: 21395 NVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLD 21454

Query: 1225  ARFRMFSK 1232
              +FR++++
Sbjct: 21455 YQFRVYAE 21462



 Score =  213 bits (543), Expect = 7e-55
 Identities = 137/438 (31%), Positives = 210/438 (47%), Gaps = 12/438 (2%)

Query: 732   DRSIFTVEGAEKEDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGED 786
             +  I T     K +E ++ V   N  G     E    +       P  P  P+++ + ++
Sbjct: 20649 EECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKN 20708

Query: 787   SCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRV 846
             S TV W  P  DGG  I GY LE++ KKS  W ++  + I++   +   + E   Y+ RV
Sbjct: 20709 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRV 20768

Query: 847   YAVNAIGM---SRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDG 903
              AVNA G    S PS   +   PI PP  P  + + D + ++++L W  P   G   + G
Sbjct: 20769 CAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTG 20828

Query: 904   YSVEYCPEGCSEWVA-ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPV 962
             Y VE       EW   + +G    T  +V +L  G    FRV A N AG G P+   EPV
Sbjct: 20829 YVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPV 20888

Query: 963   TVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSI 1021
               ++IL+ P + L   LR ++  K GE V +LIPF+G+P P VTW K+ + L  +   SI
Sbjct: 20889 QAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSI 20948

Query: 1022  RNSPTDTILFIRAARRVHSGTYQVTVRIENMEDK-ATLVLQVVDKPSPPQDLRVTDAWGL 1080
              N+ + ++L I    R  +G Y +T+     E K +T+ ++V+D P+  Q L+V      
Sbjct: 20949 ENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRG 21008

Query: 1081  NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF 1140
              V L W PP   G + +  Y ++K D     W  V      T   + +L     ++FRV 
Sbjct: 21009 TVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVL 21068

Query: 1141  SQNMVGFSDRAATTKEPV 1158
             ++N +G  +   TT EPV
Sbjct: 21069 AENEIGIGEPCETT-EPV 21085



 Score =  212 bits (540), Expect = 2e-54
 Identities = 170/605 (28%), Positives = 264/605 (43%), Gaps = 59/605 (9%)

Query: 641   RQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD 700
             R  PP+I LD   R    + + A   LRL VPI G PAP V W +               
Sbjct: 15482 RMLPPEIELDADLR--KVVTIRACCTLRLFVPIKGRPAPEVKWAR--------------- 15524

Query: 701   APEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGED 760
                D G+S +             +  +E+T   ++  V    + D G Y +TV+N  G  
Sbjct: 15525 ---DHGESLD-------------KASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSK 15568

Query: 761   QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--KKSYRW 818
                + V+V+D P  P   K+  V + S T+ W+PP  DGG  I  YI+E+++  +K+Y  
Sbjct: 15569 SAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYST 15628

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAV 878
             +  N     + S +  ++ EG  Y  RV A N  G+  P+  ++       P  P  + +
Sbjct: 15629 VATN---CHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITL 15685

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
              DV+  +VSL W  PE  G   + GY VE   +G  +W  A     + T   +  L  G 
Sbjct: 15686 MDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKW--ATCATVKVTEATITGLIQGE 15743

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
                FRV A N  G   P   + PV  ++++  P  +L   L  T     GE + + +PF 
Sbjct: 15744 EYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFI 15800

Query: 999   GKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             G+P P VTW K+  PL     V+  ++  +++L I+ A R   G Y V +     E   T
Sbjct: 15801 GRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIET 15860

Query: 1058  LVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
             L + V+DKP PP   +++ +    ++ L W PP+  G + +  Y V+K D  T  W  V 
Sbjct: 15861 LNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVS 15920

Query: 1117  EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALD 1176
                 RT      L  G  Y FR+ ++N  G S       EP     P     PP    + 
Sbjct: 15921 ATVARTTIKACRLKTGCEYQFRIAAENRYGKS--TYLNSEPTVAQYPFKVPGPPGTPVVT 15978

Query: 1177  FSEAPS----FTQPLVN-RSVIAGY-------TAMLCCAVRGSPKPKISWFKNGLDLGED 1224
              S   S    + +P+ +  S + GY        ++L   +  +P P+  +   GL+ G +
Sbjct: 15979 LSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVE 16038

Query: 1225  ARFRM 1229
               FR+
Sbjct: 16039 YEFRV 16043



 Score =  211 bits (537), Expect = 4e-54
 Identities = 158/561 (28%), Positives = 244/561 (43%), Gaps = 48/561 (8%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP+  LD   R   T+++ AG  +RL VP+ G P P + W K           P  +  +
Sbjct: 13318 PPEGELDADLR--KTLILRAGVTMRLYVPVKGRPPPKITWSK-----------PNVNLRD 13364

Query: 704   DTG-DSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
               G D     FD  L C                   E   K D G Y +T++N  G+ + 
Sbjct: 13365 RIGLDIKSTDFDTFLRC-------------------ENVNKYDAGKYILTLENSCGKKEY 13405

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
              + VKV+D P  P    +  + +DS  V WEPP  DGG PI+ Y+++++  +   W  + 
Sbjct: 13406 TIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVT 13465

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVS 882
              +   + S     + EG  Y  RV+A N  G+  P            P     L V  VS
Sbjct: 13466 TE-CSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVS 13524

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
              ++ S+ W+ P   G   + GY V++  E  ++W   ++ L+   S   KDL  G    F
Sbjct: 13525 KSSCSIGWKKPHSDGGSRIIGYVVDFLTEE-NKWQRVMKSLSLQYS--AKDLTEGKEYTF 13581

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV A N  G G P   T  V  ++ +  P L L          K      L IP +GKP 
Sbjct: 13582 RVSAENENGEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPA 13639

Query: 1003  PQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQ 1061
             P V+W K   PLA +  VS+ +S  +T L +   ++  +G Y +T++      + T+ ++
Sbjct: 13640 PSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIK 13699

Query: 1062  VVDKPS-PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             VV KP  P   ++  +     + L+W PP+D G +E+  Y ++K D    +W T     +
Sbjct: 13700 VVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQ 13759

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP-GITYEPPNYKALDF-- 1177
             +T   V  L  G  Y FRV ++N  G  +      EP+    P  +   PP    +D   
Sbjct: 13760 KTTFRVTRLHEGMEYTFRVSAENKYGVGE--GLKSEPIVARHPFDVPDAPPPPNIVDVRH 13817

Query: 1178  -SEAPSFTQP-LVNRSVIAGY 1196
              S + ++T P     S I GY
Sbjct: 13818 DSVSLTWTDPKKTGGSPITGY 13838



 Score =  211 bits (537), Expect = 4e-54
 Identities = 149/517 (28%), Positives = 234/517 (45%), Gaps = 47/517 (9%)

Query: 636   IDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPA 695
             ++ V R+  P   LD   R   T+VV AG  +R+ VPI G PAP V W K          
Sbjct: 14393 VEIVEREMAPDFELDAELR--RTLVVRAGLSIRIFVPIKGRPAPEVTWTK---------- 14440

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
                        D+             + R  +E T+  ++  +    + D G + +T++N
Sbjct: 14441 -----------DN----------INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIEN 14479

Query: 756   PVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK--K 813
             P G+    + V+V+D P      + +++ +DS T+ W+ P  DGG  I  YI+E+++  +
Sbjct: 14480 PAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYIVEKREATR 14539

Query: 814   KSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEP 873
             KSY           + +++   + EG  Y  RV A N  G+  P+  ++P      PS P
Sbjct: 14540 KSYSTATTK---CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPP 14596

Query: 874   THLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW--VAALQGLTEHTSILV 931
               L + D++ +TVSL W  P+  G   + GY +E   +G  +W  +  ++GL      +V
Sbjct: 14597 DSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGL----ECVV 14652

Query: 932   KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
             ++L  G    F+V A N AG  AP   + PV V+E    P L L    ++ +  K G+ +
Sbjct: 14653 RNLTEGEEYTFQVMAVNSAGRSAP-RESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNI 14711

Query: 992   NLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE 1050
              + IP  G+P+P VTW K  Q L   + V+   + T TIL I    R  SG Y +T R  
Sbjct: 14712 KVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNI 14771

Query: 1051  NMEDKATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
               E    + +QV D P PP   ++  +     V   W PP++ G   +  Y V+     +
Sbjct: 14772 VGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDS 14831

Query: 1110  MEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
               W  +     RT      L  G  Y FRV +QN  G
Sbjct: 14832 TTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYG 14868



 Score =  209 bits (531), Expect = 2e-53
 Identities = 164/608 (26%), Positives = 257/608 (42%), Gaps = 65/608 (10%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K   E+V  S + V        L I DVT  D   YS   E      S+     ++K+
Sbjct: 12560 WKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAEN-----SSGTDTQKIKV 12614

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKA-ITQGNKAPA 695
               +    PP+   D    I D           + +   G      I +K  +++G     
Sbjct: 12615 VVMDAPGPPQPPFD----ISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRG----- 12665

Query: 696   RPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKN 755
                           +WV     + +T  RV            + G E     ++ V  +N
Sbjct: 12666 --------------DWVTALASVTKTSCRVGK---------LIPGQEY----IFRVRAEN 12698

Query: 756   PVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
               G  +   + K++      VP  P   +++ V +D   V W+ P  DGG PI+GY++ER
Sbjct: 12699 RFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIER 12758

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ---PFMPI 867
             K++ S  W++ N  L++   +    ++EG+ Y  R+YA+N  G S PS  ++     MP+
Sbjct: 12759 KERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPV 12818

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE-- 925
              PP +P    V DV+ +TVSL W  P+  G   + GY VE C     +WV       +  
Sbjct: 12819 DPPGKP---EVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIP 12875

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
                     L   A+  FR  A        P   ++PVT+      PR+ L   ++  +  
Sbjct: 12876 QEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTV 12935

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTKEG---QPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
             K G  V L     GKP P V+W K+G   +P  G +++++ +     LF  +  R  SG 
Sbjct: 12936 KAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELF--SVNRKDSGD 12993

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
             Y +T    +    AT+ L+V+DKP PP  +++   +     L W+PP + G +E+  Y V
Sbjct: 12994 YTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIV 13053

Query: 1103  QKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPR 1162
              K +     W  V      T C V +LI G+ Y FR+ ++N  G  D   T  EP     
Sbjct: 13054 DKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFT--EPAIAKN 13111

Query: 1163  PGITYEPP 1170
             P   Y+PP
Sbjct: 13112 P---YDPP 13116



 Score =  207 bits (526), Expect = 7e-53
 Identities = 139/404 (34%), Positives = 194/404 (48%), Gaps = 13/404 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VPDAP  P ++ V +DS  V W  P +DGG+PI  YILE+++  S RW R+  D I   +
Sbjct: 10639 VPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPITNYILEKRETMSKRWARVTKDPIHPYT 10697

Query: 831   H-EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTV 886
                   ++EG  YE RV A N IG+  PSP S+P     PI  PS P +    D +  +V
Sbjct: 10698 KFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 10757

Query: 887   SLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA--LQGLTEHTSILVKDLPTGARLLFRV 944
              L W+PP   G   + GY VEY   G  EW  A         T   V  L  G    FRV
Sbjct: 10758 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRV 10817

Query: 945   RAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
              A N AG   P    EPV V++ L+ P L L  ++ +    KVG+ + L    +G P P+
Sbjct: 10818 LAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPK 10877

Query: 1005  VTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVD 1064
             VTW KE +  A  +  I  +P  + L IR A     G Y +TV         ++ + V+D
Sbjct: 10878 VTWKKEDRD-APTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD 10936

Query: 1065  KPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             KP PP+DL V++    +  L WK P D G + +  Y V++ D  + +W  +    ++   
Sbjct: 10937 KPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSH 10996

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPVFIPRP 1163
                 L  GN Y FRV ++N  G      T K     +P+  P P
Sbjct: 10997 FAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHPPGP 11040



 Score =  206 bits (524), Expect = 1e-52
 Identities = 169/608 (27%), Positives = 260/608 (42%), Gaps = 74/608 (12%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV---PEGFACNLSAKLHFME 633
             W K+GKEL   +++++        L   D T  D   Y+     P GFA       H   
Sbjct: 15123 WSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFA------KHIFN 15176

Query: 634   VKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKA 693
             VK+            LD PG                  P  G  A T +  +      K 
Sbjct: 15177 VKV------------LDRPG------------------PPEGPLAVTEVTSE------KC 15200

Query: 694   PARPAPDAPEDTGDSDEWVFDKK---LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYT 750
                  P   +     D ++  K+    L  T     V+ TK +    ++G    +E ++ 
Sbjct: 15201 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKG----NEYIFR 15256

Query: 751   VTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILG 805
             V   N  G     E +  L V     PD P  P+++ + +DS  V W  P  DGG  I+ 
Sbjct: 15257 VMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIIN 15316

Query: 806   YILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM 865
             YI+ER+ K   RW++ N   + +L ++   + EG  YE R+ A NA G+S PSP S PF 
Sbjct: 15317 YIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPSPTS-PFY 15375

Query: 866   PI-------GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEW-- 916
                      GPP  P    V D S +++S+ W  P   G   + GY VE       EW  
Sbjct: 15376 KACDTVFKPGPPGNP---RVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQI 15432

Query: 917   VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLP 976
             V    GL + TS  +  L        R+ A N  G G P         ++ +  P ++L 
Sbjct: 15433 VTPPAGL-KATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELD 15491

Query: 977   RHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE-GQPLAGEEVSIRNSPTDTILFIRAA 1035
               LR+ +  +    + L +P +G+P P+V W ++ G+ L  ++ SI ++ + T+L +   
Sbjct: 15492 ADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESL--DKASIESTSSYTLLIVGNV 15549

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
              R  SG Y +TV   +    A + ++V+D P PPQDL+V +    +V L W PP   G +
Sbjct: 15550 NRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGS 15609

Query: 1096  ELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK 1155
             ++  Y V+K +     + TV  +  +T   V +L  G  YYFRV ++N  G    A T +
Sbjct: 15610 KIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETAE 15669

Query: 1156  EPVFIPRP 1163
                   RP
Sbjct: 15670 SVKASERP 15677



 Score =  205 bits (522), Expect = 2e-52
 Identities = 166/590 (28%), Positives = 260/590 (44%), Gaps = 57/590 (9%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K+G  L P   IK++    +  L +  V   D  DY+   E  + + SA +   ++K+
Sbjct: 12957 WKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI---KLKV 13013

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                         LD PG  P   V +  NK+  D  +       + W+  +  G      
Sbjct: 13014 ------------LDKPG--PPASVKI--NKMYSDRAM-------LSWEPPLEDGGS---- 13046

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNP 756
                       +   ++ DK+         +V  T   +  +VE   +  E  + +  +N 
Sbjct: 13047 ----------EITNYIVDKRETSRPNW-AQVSATVPITSCSVEKLIEGHEYQFRICAENK 13095

Query: 757   VGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERK 811
              G      T   I     D P     P ISN+ +D  TV W+PPA DGG PI GY+LE++
Sbjct: 13096 YGVGDPVFTEPAIAKNPYDPPGRCDPPVISNITKDHMTVSWKPPADDGGSPITGYLLEKR 13155

Query: 812   KKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ------PFM 865
             + ++  W ++N   I E + +A  + EG  YE RV A+N  G  +PS AS+      P  
Sbjct: 13156 ETQAVNWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQY 13215

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA-LQGLT 924
             P GPP+ P    V D + ++VSL W  P   G   + GY VE        WV   L    
Sbjct: 13216 PPGPPAFP---KVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNL 13272

Query: 925   EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQ 984
             + T   V  L    +  FRV A N  G   P    +    ++IL  P  +L   LR+T+ 
Sbjct: 13273 QKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLI 13332

Query: 985   KKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTY 1043
              + G  + L +P +G+P P++TW+K    L     + I+++  DT L      +  +G Y
Sbjct: 13333 LRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKY 13392

Query: 1044  QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
              +T+     + + T+V++V+D P PP ++ V +    +  + W+PP   G + +  Y VQ
Sbjct: 13393 ILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQ 13452

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
             K D +   W TV     +T   V  L  G  Y+FRVF++N  G  D   T
Sbjct: 13453 KRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGDPGET 13502



 Score =  204 bits (519), Expect = 4e-52
 Identities = 155/574 (27%), Positives = 256/574 (44%), Gaps = 43/574 (7%)

Query: 632  MEVKIDFVPRQEPPKIHLDCPGRIPD---TIVVVAGNKL-----RLDVPISGDPAPTVIW 683
            +++  + V R E  K  L  P  + +   T  V A N+L      + V +   P+P    
Sbjct: 9074 LQITKEEVSRSEA-KTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPR-- 9130

Query: 684  QKAITQGNKAPARPAPDAPEDTGDSD--EWVFDKKLLCETEGR-VRVETTKDRSIFTVEG 740
              A+T           DAP D G S+   +V DK+     +     V  T     + +  
Sbjct: 9131 NLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWK 9190

Query: 741  AEKEDEGVYTVTVKNPVGEDQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPP 795
                 +  + V   N  G      + KV+      +P  P  PK+    + S  V W PP
Sbjct: 9191 LIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPP 9250

Query: 796  AYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS-----HEARRMIEGVVYEMRVYAVN 850
              +GG PI GY LE++++ S  W R++   I ++          R++EGV Y+ R  A+N
Sbjct: 9251 LDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAIN 9310

Query: 851  AIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVE 907
            A G+  PS  S P +   PI PP  P+   V+D + +++SL W+PP + G   + GY VE
Sbjct: 9311 AAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVE 9370

Query: 908  YCPEGCSEW--VAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
               EG ++W  V     L      +V +L    +  FRV+A N AG   P  TT  +   
Sbjct: 9371 MQEEGTTDWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPAT 9430

Query: 966  EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP 1025
            +I + P + +    +  +  K G  + +    +G+P P+ +W  +G+     +  + + P
Sbjct: 9431 DIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIP 9490

Query: 1026 TD---------TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTD 1076
             D         +++ I   +R H+G Y +T + +  +  A   ++V+D P PP+DL+V+D
Sbjct: 9491 EDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSD 9550

Query: 1077 AWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYY 1136
                +  L WK P D G   + GY ++K       W  V      T  VVP+L+    Y+
Sbjct: 9551 ITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYF 9610

Query: 1137 FRVFSQNMVGFSD-----RAATTKEPVFIPRPGI 1165
            FRV ++N  G        +  T ++P++ P P I
Sbjct: 9611 FRVRAENRFGIGPPVETIQRTTARDPIYPPDPPI 9644



 Score =  203 bits (516), Expect = 1e-51
 Identities = 156/577 (27%), Positives = 241/577 (41%), Gaps = 75/577 (12%)

Query: 659  IVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLL 718
            I+V+ G KL + VP    P PTV W K                     D  E        
Sbjct: 8024 IIVIEGEKLSIPVPFRAVPVPTVSWHK---------------------DGKE-------- 8054

Query: 719  CETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP 778
             +   R+ ++     +   V  + + D G+YT+T++N +G    ++ VKVI +P      
Sbjct: 8055 VKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDI 8114

Query: 779  KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIE 838
            K S++ + SC + WEPP +DGG PIL Y+LER++     ++ +      +LS   + +I 
Sbjct: 8115 KASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPV-MSGENKLSWTVKDLIP 8173

Query: 839  GVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPER 895
               Y  RV AVN +G         P +   P  PP  P  + V + +   +++ W+PP  
Sbjct: 8174 NGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLY 8233

Query: 896  VGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAP 955
             G   + GY +E   +G   W    + L    +   K L  G    FRVRA N AG   P
Sbjct: 8234 DGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEP 8293

Query: 956  VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
               T P    + +  P++ L    R +++ K G+ + L     G P P +TW K+   + 
Sbjct: 8294 SRATPPTKAVDPIDAPKVIL----RTSLEVKRGDEIALDASISGSPYPTITWIKDENVIV 8349

Query: 1016 GEEVSIRNSPT------------------------------DTILFIRAARRVHSGTYQV 1045
             EE+  R +P                               ++ L +R + R   G Y +
Sbjct: 8350 PEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMI 8409

Query: 1046 TVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKA 1105
             V  ++   KA   + V+D P PP +    D    +V  +W+PP D G +E+  YT++K 
Sbjct: 8410 KVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKK 8469

Query: 1106 D--KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG----FSDRAATTKEPVF 1159
            D  K   EW  V    R     V +LI G  Y FRV ++N  G       +    K+P F
Sbjct: 8470 DKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDP-F 8528

Query: 1160 IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGY 1196
             P P    +P        S    + +P  N S I GY
Sbjct: 8529 GP-PDAPDKPIVEDVTSNSMLVKWNEPKDNGSPILGY 8564



 Score =  202 bits (514), Expect = 2e-51
 Identities = 143/504 (28%), Positives = 223/504 (44%), Gaps = 23/504 (4%)

Query: 727   VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE----DQVNLTVKV-IDVPDAPAAPKIS 781
             V  T  R++  V      +E  + +  +N  G     D   +TVK+    P  P+ P ++
Sbjct: 20248 VSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVT 20307

Query: 782   NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
             NV  +S TV W  P  +GG  ++GY LE K + S  W + N  +I+    +   +  G++
Sbjct: 20308 NVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLI 20367

Query: 842   YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGL 901
             YE RVYA NA G+ +PS  S+P + I     P ++ + D+S  +VSL W+ P   G   +
Sbjct: 20368 YEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKI 20427

Query: 902   DGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGP-GAPVTTTE 960
              GY VE        W  A       T  ++  L   ++  FRV A N  G    P     
Sbjct: 20428 TGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVG 20487

Query: 961   PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEV 1019
             P+T  +    P + LP    + ++ + G  V L     GKP P + W K+ + L     V
Sbjct: 20488 PITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALV 20547

Query: 1020  SIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPP-QDLRVTDAW 1078
              + N+     + I+ A R++SG Y++ +R       AT+ +Q++DKP PP   +      
Sbjct: 20548 CVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVT 20607

Query: 1079  GLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFR 1138
                + L W+PP D G  ++  Y V+K +   + W  V EH         ++I GN Y FR
Sbjct: 20608 AEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFR 20667

Query: 1139  VFSQNMVGF-----SDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVN-RSV 1192
             V + N  G      SD        V    PGI   P   K    S    +++P+ +  S 
Sbjct: 20668 VRAVNKYGIGEPLESDSVVAKNAFVTPGPPGI---PEVTKITKNSMTVVWSRPIADGGSD 20724

Query: 1193  IAGYTAMLCCAVRGSPKPKISWFK 1216
             I+GY       +    K  + WFK
Sbjct: 20725 ISGY------FLEKRDKKSLGWFK 20742



 Score =  202 bits (513), Expect = 2e-51
 Identities = 144/471 (30%), Positives = 207/471 (43%), Gaps = 23/471 (4%)

Query: 683  WQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAE 742
            W+  +  G         +  + T    EW+     L   +  V         +F V    
Sbjct: 8450 WEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAEN 8509

Query: 743  KEDEGVYTVT----VKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYD 798
            +   G   V+     K+P G             PDAP  P + +V  +S  V+W  P  D
Sbjct: 8510 RFGPGPPCVSKPLVAKDPFGP------------PDAPDKPIVEDVTSNSMLVKWNEPK-D 8556

Query: 799  GGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPS 858
             G PILGY LE+++  S  W R+N  L+  L      ++EG+ Y  RV A NA G  + S
Sbjct: 8557 NGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGLTYVFRVCAENAAGPGKFS 8616

Query: 859  PASQP---FMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSE 915
            P S P     PI PP  P    V D S TT+ L+W PP   G G + GY V+    G +E
Sbjct: 8617 PPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNE 8675

Query: 916  WVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQL 975
            W    + + +     VK++  GA    RV A N AG G P   T+PVTV E  + P ++L
Sbjct: 8676 WSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPP-GETQPVTVAEPQEPPAVEL 8734

Query: 976  PRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAA 1035
               ++  IQ   G+ + +     G+P P   WTKE   L  + V I N  T + L I+ A
Sbjct: 8735 DVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDA 8794

Query: 1036 RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
             R   G Y +T         A   ++V D P P  DL+          L W  P+D G +
Sbjct: 8795 LRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGS 8854

Query: 1096 ELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
            E+ G+ +++ D K   W   +E   R+ C +  L+ G  Y FRV ++N  G
Sbjct: 8855 EITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEGQEYKFRVIAKNKFG 8904



 Score =  201 bits (512), Expect = 3e-51
 Identities = 169/574 (29%), Positives = 245/574 (42%), Gaps = 58/574 (10%)

Query: 642  QEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDA 701
            QEPP + LD    +   I ++AG  LR+   ++G P PT +W K                
Sbjct: 8727 QEPPAVELDVS--VKGGIQIMAGKTLRIPAVVTGRPVPTKVWTK---------------- 8768

Query: 702  PEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQ 761
                   +E   DK        RV ++    +S   ++ A ++D G Y +T  N  G   
Sbjct: 8769 -------EEGELDKD-------RVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKF 8814

Query: 762  VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                V+V DVP      K        C + W  P  DGG  I G+I+ERK  K + W + 
Sbjct: 8815 AAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ- 8873

Query: 822  NFDLIQELSH-EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLA 877
               +  E S  +   ++EG  Y+ RV A N  G   P     P +   P+GPP+ P  L 
Sbjct: 8874 --PIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIG-PILAVDPLGPPTSPERLT 8930

Query: 878  VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
              + + +T++L W+ P   G   + GY +E       ++    + L   TS LV++L   
Sbjct: 8931 YTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEH 8990

Query: 938  ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLR-QTIQKKVGEPVNLLIP 996
                FRV+A N  G   P      V +Q+    P ++L   +R  TI+ K GEPV++   
Sbjct: 8991 QMYEFRVKAVNEIGESEPSLPLN-VVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPAD 9049

Query: 997  FQGKPRPQVTWTK---------EGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
              G P P++ W+K         +   +  EEVS   S   T L I  A R   GTY VT 
Sbjct: 9050 VTGLPMPKIEWSKNETVIEKPTDALQITKEEVS--RSEAKTELSIPKAVREDKGTYTVTA 9107

Query: 1048 RIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD- 1106
                      + ++V D+PSPP++L VTD    +  L W  P D G +E+  Y + K D 
Sbjct: 9108 SNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDA 9167

Query: 1107 -KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP--RP 1163
             +K  EW  V          + +LI    Y FRV + N  G SD   + K  +  P   P
Sbjct: 9168 SRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLP 9227

Query: 1164 GITYEPPNYKALDFSEAPSFTQPLVN-RSVIAGY 1196
            G   +P        S   S+T PL N  S I GY
Sbjct: 9228 GPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGY 9261



 Score =  201 bits (511), Expect = 4e-51
 Identities = 166/600 (27%), Positives = 260/600 (43%), Gaps = 71/600 (11%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K GK++ P    +++       LTI   T  D  +Y+            K+  ++V +
Sbjct: 14041 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATN---PFGTKVEHVKVTV 14097

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
                                             LDVP  G P P  I   +     KA   
Sbjct: 14098 --------------------------------LDVP--GPPGPVEI---SNVSAEKATLT 14120

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKD----RSIFT--VEGAEKEDEGVYT 750
               P   +       ++ +K+   ET   +    ++D    R + T  ++G    +E ++ 
Sbjct: 14121 WTPPLEDGGSPIKSYILEKR---ETSRLLWTVVSEDIQSCRHVATKLIQG----NEYIFR 14173

Query: 751   VTVKNPVGEDQV--NLTVKVID---VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILG 805
             V+  N  G+ +   +  VK++D    P  P  P++SNV +++ TV W+ P  DGG  I G
Sbjct: 14174 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 14233

Query: 806   YILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM 865
             Y +ER++KKS RW+R     + +L  +   + EG  YE RV A N  G+  PS AS   +
Sbjct: 14234 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 14293

Query: 866   ------PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAA 919
                   P GPPS P    V D +  + SL W  P   G   + GY VE+   G   W+  
Sbjct: 14294 MKDAAYPPGPPSNP---HVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKD 14350

Query: 920   LQGLT-EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRH 978
               G     T  +V DL T  +  FR+ A N AG G P    + V + E    P  +L   
Sbjct: 14351 TTGTALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPD-VEIVEREMAPDFELDAE 14409

Query: 979   LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRV 1038
             LR+T+  + G  + + +P +G+P P+VTWTK+   L     +I N+ + T+L I    R 
Sbjct: 14410 LRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLK-NRANIENTESFTLLIIPECNRY 14468

Query: 1039  HSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
              +G + +T+     +    + ++V+D P P  +LR TD    +V L W  P   G + + 
Sbjct: 14469 DTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRIT 14528

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
              Y V+K +     + T      +    V  L  G  Y+FRV ++N  G  +   TT EPV
Sbjct: 14529 NYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETT-EPV 14587



 Score =  200 bits (508), Expect = 8e-51
 Identities = 169/607 (27%), Positives = 252/607 (41%), Gaps = 59/607 (9%)

Query: 574   RGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFME 633
             R  W K+G E+     ++++ +     L + D T      Y+   +  + +  A++   +
Sbjct: 21617 RVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEI---K 21673

Query: 634   VKIDFVPRQEPPKIHLDCPGRI--PDTIVVVAGNKLRL--DVPISGDPAPTV--IWQKAI 687
             VK+             D PG++  P     + G K+ L  D P++   AP    I +K  
Sbjct: 21674 VKVQ------------DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRE 21721

Query: 688   TQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEG 747
             T      +R A    ED  ++  +   K L+   E + RV                    
Sbjct: 21722 T------SRLAWALIEDKCEAQSYTAIK-LINGNEYQFRVSA------------------ 21756

Query: 748   VYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYI 807
             V    V  P+  D V   ++   VPDAP  P+ SN+  +S T+ W  P  DGG  I  YI
Sbjct: 21757 VNKFGVGRPLDSDPVVAQIQYT-VPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYI 21815

Query: 808   LERKKKKSYRWMR-LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM- 865
             LER++KKS RW++ ++   I E   +   + EG  YE  V A NA G+   S  S+    
Sbjct: 21816 LERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKC 21875

Query: 866   --PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGL 923
               P+ PP  PT + V D S TTVSL+W  P   G   + GY +E C     +W       
Sbjct: 21876 REPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEA 21935

Query: 924   TEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTI 983
                T   V DL  G    FRV A N AG G     T  +   + L  P L +  + +QT 
Sbjct: 21936 CVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTH 21995

Query: 984   QKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTY 1043
               + G  + L I +QG+P P   W+K    L+     I  + + + L +    R  +G Y
Sbjct: 21996 VVRAGASIRLFIAYQGRPTPTAVWSKPDSNLS-LRADIHTTDSFSTLTVENCNRNDAGKY 22054

Query: 1044  QVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQ 1103
              +TV   +     T  ++V+D P PP  +   D    +  L W  P   G   +  Y V+
Sbjct: 22055 TLTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVE 22114

Query: 1104  KADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             K +     W  + E   R    V +L  G  YYFRV + N  G         EP  +P P
Sbjct: 22115 KREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVG-------EPYEMPEP 22167

Query: 1164  GITYEPP 1170
              +  E P
Sbjct: 22168 IVATEQP 22174



 Score =  199 bits (507), Expect = 1e-50
 Identities = 128/407 (31%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VP  P  P+++ V +DS T+ W  P  DGG PILGY +ERK++    W  ++  L+    
Sbjct: 14886 VPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNI 14945

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
              ++  + +G+ YE RV A N  G S+PS  S+P +   PI PP +P  L   +++  TV+
Sbjct: 14946 FKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPL---NITRHTVT 15002

Query: 888   LKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAH 947
             LKW  PE  G   +  Y VE        W+ A           V  L   A   FRV A 
Sbjct: 15003 LKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAK 15062

Query: 948   NMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
             N AG    P   ++ +T ++ ++ P++++    + T+  K GE   L     G+P P + 
Sbjct: 15063 NAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTME 15122

Query: 1007  WTKEGQPLAG-EEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             W+K+G+ L G  ++ I+ +   T L  + + R  SG Y +T        K    ++V+D+
Sbjct: 15123 WSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDR 15182

Query: 1066  PSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             P PP+  L VT+       L W PP D G  ++  Y VQK +   + W  V    + T  
Sbjct: 15183 PGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKL 15242

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPN 1171
              V +L+ GN Y FRV + N  G  +      EPV    P   Y PP+
Sbjct: 15243 KVTKLLKGNEYIFRVMAVNKYGVGE--PLESEPVLAVNP---YGPPD 15284



 Score =  199 bits (506), Expect = 1e-50
 Identities = 156/565 (27%), Positives = 253/565 (44%), Gaps = 26/565 (4%)

Query: 702   PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
             P+D G S+   ++ +K+     +  V   +   ++ F V    +  E  + V+ +N  G 
Sbjct: 13728 PKDDGGSEITNYILEKRDSVNNKW-VTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGV 13786

Query: 760   DQVNLTVKVI-----DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
              +   +  ++     DVPDAP  P I +V  DS ++ W  P   GG PI GY LE K++ 
Sbjct: 13787 GEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERN 13846

Query: 815   SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPT 874
             S  W R N   I+    +   + EG+ YE RV A+N  G+ +PS  S+P + + P   P 
Sbjct: 13847 SLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPG 13906

Query: 875   HLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDL 934
                V +++  +V+L W  P+  G   L GY VE        W+ A        +  V DL
Sbjct: 13907 KPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDL 13966

Query: 935   PTGARLLFRVRAHNMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNL 993
               G +  FR+RA N AG   AP  +TE +  ++  + P + L   ++  +  K G+ + L
Sbjct: 13967 VEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVL 14026

Query: 994   -LIPFQGKPRPQVTWTKEGQPLAGEEVS-IRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
               I   GKP P+ +W+K G+ +   +++ I ++PT ++L I+ A R  +G Y +T     
Sbjct: 14027 NAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPF 14086

Query: 1052  MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTME 1111
                   + + V+D P PP  + +++       L W PP + G + +  Y ++K +   + 
Sbjct: 14087 GTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLL 14146

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV-----FIPRPGIT 1166
             W  V E  +    V  +LI GN Y FRV + N  G  +      EPV     F P PG  
Sbjct: 14147 WTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE--PVQSEPVKMVDRFGP-PGPP 14203

Query: 1167  YEPPNYKALDFSEAPSFTQPLVN-RSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA 1225
              +P        +   S+ +P+ +  S I GY       V    K  + W +       D 
Sbjct: 14204 EKPEVSNVTKNTATVSWKRPVDDGGSEITGY------HVERREKKSLRWVRAIKTPVSDL 14257

Query: 1226  RFRMFSKQGVLTLEIRKPCPFDGGI 1250
             R ++   Q   T E R       GI
Sbjct: 14258 RCKVTGLQEGSTYEFRVSAENRAGI 14282



 Score =  197 bits (500), Expect = 7e-50
 Identities = 147/509 (28%), Positives = 216/509 (42%), Gaps = 42/509 (8%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP++ LD   R  D I V  G  +R+   + G P P + W K                  
Sbjct: 11533 PPEVELDVTCR--DVITVRVGQTIRILARVKGRPEPDITWTK------------------ 11572

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
                       + K+L   E RV +     R    ++ A + D G Y ++ KN  G  Q +
Sbjct: 11573 ----------EGKVLVR-EKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGS 11621

Query: 764   LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF 823
               V V+D P      K++NV +++CT+ WE P  +GG  I  +I+E +K     W  +  
Sbjct: 11622 AIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVAS 11681

Query: 824   DLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGP---PSEPTHLAVED 880
             D+ + L      ++    Y  RV A N +G+        P + I P   P EP +L + D
Sbjct: 11682 DVTKRLIKA--NLLANNEYYFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIAD 11739

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL 940
                T V LKWR P+  G      Y VE   +G  +W    +G  + T  +V         
Sbjct: 11740 KGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIY 11799

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FRV+  N  G    V T E V V+E LQ+P L L   L   +  K G+ + L    +GK
Sbjct: 11800 EFRVQTKNEGGESDWVKTEE-VVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGK 11856

Query: 1001  PRPQVTWTKEGQPL---AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             P P+V WTK+           V I      +   +  A+R   G Y VT         A 
Sbjct: 11857 PFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAY 11916

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
               + V+DKP P ++L++ D       + W PP+D G  E+  Y ++K + K M W T   
Sbjct: 11917 ATVNVLDKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSA 11976

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
                     V  LI GN Y FRV ++N +G
Sbjct: 11977 TVLTPGTTVTRLIEGNEYIFRVRAENKIG 12005



 Score =  196 bits (498), Expect = 1e-49
 Identities = 146/539 (27%), Positives = 227/539 (42%), Gaps = 73/539 (13%)

Query: 635  KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAP 694
            +I  V  QE P+I LD   ++   + V AG K+ L   ++G P P + W KA        
Sbjct: 7306 EIQAVDTQEAPEIFLDV--KLLAGLTVKAGTKIELPATVTGKPEPKITWTKA-------- 7355

Query: 695  ARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVK 754
                                  ++ + + R+ +E    +S  T+  +++ D G Y +   
Sbjct: 7356 ---------------------DMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAV 7394

Query: 755  NPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKK 814
            N  G     + V V+D P  PAA  I++V  +SC + W PP  DGG  I  Y++ER+   
Sbjct: 7395 NVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATD 7454

Query: 815  SYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRP---SPASQPFMPIGPPS 871
            S  W +L+   +++ + +A ++I    Y  RV A N  G+  P   SP +  +    PP 
Sbjct: 7455 SEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQ-FDPPG 7512

Query: 872  EPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILV 931
             PT L   D++   V+L W  P+  G   + GY VE       +WV   +   + T+  V
Sbjct: 7513 PPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRV 7572

Query: 932  KDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPV 991
            K L    +  FRV A N+AGPG P  +TEP+ +++ +  P                  P 
Sbjct: 7573 KGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPP----------------WPPG 7616

Query: 992  NLLIPFQGKPRPQVTWTKEGQPLAG--EEVSIRNSPTDTILFIRAARRV----------- 1038
               +   GK   ++ WTK         E   I    T T  ++R A  V           
Sbjct: 7617 KPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLM 7676

Query: 1039 HSGTYQVTVRIENMEDKA--------TLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQ 1090
                Y   VR  N   ++         L  + +  PSPP+ L V +       L+W  P+
Sbjct: 7677 EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPE 7736

Query: 1091 DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
              G + +  Y V+K D +   W TV    + T C V  L  G+ Y FRV ++N +G SD
Sbjct: 7737 KDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSD 7795



 Score =  196 bits (498), Expect = 1e-49
 Identities = 162/633 (25%), Positives = 260/633 (41%), Gaps = 83/633 (13%)

Query: 642   QEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDA 701
             QE P++ +D   +  D +V  AG+++R+   I G P P   W+    +  KA      D 
Sbjct: 9433  QEEPEVFIDIGAQ--DCLVCKAGSQIRIPAVIKGRPTPKSSWEFD-GKAKKAMKDGVHDI 9489

Query: 702   PEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQ 761
             PED                     ++ET ++ S+  +   ++   G Y++T KN  G+  
Sbjct: 9490  PEDA--------------------QLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKT 9529

Query: 762   VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              N  VKV+DVP  P   K+S++   SC + W+ P  DGG  I GY++E++      W ++
Sbjct: 9530  ANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKV 9589

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAV 878
             N D     +     ++    Y  RV A N  G+  P    Q      PI PP  P  L +
Sbjct: 9590  NPDC-GSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKI 9648

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVE---YCPEGCSE--WVAALQGLTEHTSILVKD 933
               ++  TV L W+PP+  G   +  Y VE   + P G  +  W    +   E     V+D
Sbjct: 9649  GLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVED 9708

Query: 934   LPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNL 993
             L  G    FRV+A N AG   P  T  P   Q    RP +     L++ ++ + G  VN+
Sbjct: 9709  LVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQ----RPDMPPSIDLKEFMEVEEGTNVNI 9764

Query: 994   LIPFQGKPRPQVTWTK-------EGQPLAGEEVSIRNSPTDTI-LFIRAARRVHSGTYQV 1045
             +   +G P P +TW K         +P+  +    +    DT  L I  +RR  +G Y +
Sbjct: 9765  VAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTI 9824

Query: 1046  TVRIENMEDKATLVLQVVDKPSPPQD-LRVTDAWGLNVALEWKPPQDVGNTELWGYTVQK 1104
             T           + L V+ +P PP   ++        + L W PP+D G +++  Y ++K
Sbjct: 9825  TAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEK 9884

Query: 1105  ADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV--FIPR 1162
              +     W  V    +     +P+L+ G+ Y FR+ +QN  G  +   +  E        
Sbjct: 9885  REANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSV 9944

Query: 1163  PG----------------ITYEPPNYKA--------LDFSEAPSFTQPLVNRSVIAGYTA 1198
             PG                + +E P Y          L+  +  S     VNR  I   T 
Sbjct: 9945  PGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTL 10004

Query: 1199  MLCCAVRGSPKPKISWFKNGLDLGEDARFRMFS 1231
                          +S+   GL  G D +FR+++
Sbjct: 10005 ------------GVSYKVTGLIEGSDYQFRVYA 10025



 Score =  195 bits (495), Expect = 3e-49
 Identities = 127/403 (31%), Positives = 185/403 (45%), Gaps = 20/403 (4%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P+ P++S + +DS  V W  P  DGG  I GYILE++ K+  RW + N   + +L  
Sbjct: 18530 PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRL 18589

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSP------ASQPFMPIGPPSEPTHLAVEDVSDTT 885
                 + EG  YE RV A NA G+  PS       A     P GPPS P    V D S ++
Sbjct: 18590 RVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP---KVTDTSRSS 18646

Query: 886   VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWV-----AALQGLTEHTSILVKDLPTGARL 940
             VSL W  P   G   + GY VE       EW        LQG        V  L      
Sbjct: 18647 VSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQG----KQFTVTKLKENTEY 18702

Query: 941   LFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGK 1000
              FR+ A N  G G P T    V  QE ++ P ++L   LR+ +  +    + L +  +G+
Sbjct: 18703 NFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGR 18762

Query: 1001  PRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVL 1060
             P P+V W K  + +  +   I  + + T+L I    R  SG Y +T+   +    A + +
Sbjct: 18763 PEPEVKWEK-AEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNV 18821

Query: 1061  QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
             +V+D PS P +L + +    +V L W+PP   G  ++  Y V+K +     + T+  +  
Sbjct: 18822 RVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNNCT 18881

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRP 1163
             +T   +  L  G  YYFRV + N  G    A TT EPV +  P
Sbjct: 18882 KTTFRIENLQEGCSYYFRVLASNEYGIGLPAETT-EPVKVSEP 18923



 Score =  191 bits (485), Expect = 4e-48
 Identities = 129/467 (27%), Positives = 213/467 (45%), Gaps = 18/467 (3%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P  P  + + +DS  +QW  P  +GG P++GY LERK++ S  W ++N  +I +   
Sbjct: 17051 PGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQF 17110

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSL 888
             +A+ + EG+ YE RVYA N +G+ + S  S+ ++   P  PP  P  + V+      ++L
Sbjct: 17111 KAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVK---RNEITL 17167

Query: 889   KWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
             +W  P   G   + GY VE        W+ A       T   V  L    R  FRV A N
Sbjct: 17168 QWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKN 17227

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTW 1007
              AG    P  +T P+T ++ ++ PR+ +    R TI    GE   L     GKP P + W
Sbjct: 17228 AAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEW 17287

Query: 1008  TKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT--LVLQVVD 1064
              +  + +       I+N+    +L ++ A R+  G Y   +R  N+    +  + ++V+D
Sbjct: 17288 LRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQY--ILRASNVAGSKSFPVNVKVLD 17345

Query: 1065  KPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTH 1123
             +P PP+  ++VT       +L W PP   G +++  Y V+K +   + W  V        
Sbjct: 17346 RPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNS 17405

Query: 1124  CVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSF 1183
               V +L+ GN Y FR+ + N  G  +   +   PV +  P +   PP  K+L+ +     
Sbjct: 17406 LKVTKLLEGNEYVFRIMAVNKYGVGEPLESA--PVLMKNPFVLPGPP--KSLEVTNIAKD 17461

Query: 1184  TQPLV-NRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRM 1229
             +  +  NR    G + ++   V    +  I W K       D R R+
Sbjct: 17462 SMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 17508



 Score =  189 bits (480), Expect = 1e-47
 Identities = 125/408 (30%), Positives = 194/408 (47%), Gaps = 15/408 (3%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             VP  P  P ++    DS  VQW  P  DGG  ++GY LERK++ S  W++LN   I +  
Sbjct: 15968 VPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTK 16027

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
              +   + EGV YE RV A N +G+ +PS  S+ ++   P  PP  P  +    V+  +V+
Sbjct: 16028 FKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAII---VTRNSVT 16084

Query: 888   LKWRPPERVGAGGLDGYSVE--YCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVR 945
             L+W+ P   G   + GY VE    PEG   W+ A       T   V  L    R  FRV 
Sbjct: 16085 LQWKKPTYDGGSKITGYIVEKKELPEG--RWMKASFTNIIDTHFEVTGLVEDHRYEFRVI 16142

Query: 946   AHNMAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQ 1004
             A N AG    P  +T  +T ++ +  PR+ +    + TI    GE   +     GKP P 
Sbjct: 16143 ARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPT 16202

Query: 1005  VTWTKEGQPLAG-EEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVV 1063
             + W K  Q L+    + I+++   T L ++ A RV SG Y +  +    E   T+ ++V+
Sbjct: 16203 IQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVL 16262

Query: 1064  DKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRT 1122
             D+P PP+  + ++        L WKPP   G +++  Y V++ +   + W  V  + +  
Sbjct: 16263 DRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTL 16322

Query: 1123  HCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPP 1170
              C V +L+ GN Y FR+ + N  G  +      EPV    P +  + P
Sbjct: 16323 SCKVTKLLEGNEYTFRIMAVNKYGVGE--PLESEPVVAKNPFVVPDAP 16368



 Score =  189 bits (479), Expect = 2e-47
 Identities = 129/478 (26%), Positives = 224/478 (46%), Gaps = 24/478 (5%)

Query: 743   KEDEGVYTVTVKNPVG-----EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAY 797
             K +E ++ V   N  G     E +  +      +P  P  P+    G++   +QW  P  
Sbjct: 22834 KNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPES 22893

Query: 798   DGGQPILGYILERKKKKSYRWMRLNFD-LIQELSHEARRMIEGVVYEMRVYAVNAIGMSR 856
             DGG  I  Y++++++KKS RW R+N D ++ +   +   ++EG  Y+ RV AVNA G S 
Sbjct: 22894 DGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSE 22953

Query: 857   PSPAS------QPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
             PS AS      +P    GPPS P    V D +  ++SL W  P   G   + GY +E   
Sbjct: 22954 PSEASNFISCREPSYTPGPPSAPR---VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQE 23010

Query: 911   EGCSEWVAALQGLT-EHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQ 969
             +   +W       T  +T   V DL  G +  FRV A N+ G      +   +   E ++
Sbjct: 23011 KDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIE 23070

Query: 970   RPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTI 1029
              P L+L   L++T+  + G  + L++   G+P P +TW+K+G  LA   + I  + + ++
Sbjct: 23071 IPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSL 23129

Query: 1030  LFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
             L +    R  +G Y +    ++ +  AT++++V D P P   ++V +    +V + W+ P
Sbjct: 23130 LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 23189

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
                G   +  Y V+K +     + TV     +T   +  L+ G  YYFRV  +N+ G  +
Sbjct: 23190 TIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE 23249

Query: 1150  RAATTKEPVFIPRPGITYEPPNYKALDFSEAP---SFTQPLVN-RSVIAGYTAMLCCA 1203
                T+   +    P +   P   + +D +++    ++ +PL +  S + GY    C A
Sbjct: 23250 PCETSDAVLVSEVPLV---PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKA 23304



 Score =  188 bits (477), Expect = 3e-47
 Identities = 139/490 (28%), Positives = 224/490 (45%), Gaps = 24/490 (4%)

Query: 700   DAPEDTGDSDEWVF--DKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPV 757
             D PED G  +   +  +K+   +T  ++ V ++  R+ F V    K+ E  + V  +N  
Sbjct: 21307 DVPEDNGGGEITCYSIEKRETSQTNWKM-VCSSVARTTFKVPNLVKDAEYQFRVRAENRY 21365

Query: 758   GEDQVNLTVKVID-----VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             G  Q  ++  ++      +P  P  P I NV  D  ++ W+ P YDGG  + G+ +E+K+
Sbjct: 21366 GVSQPLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKE 21425

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ---PFMPIGP 869
             + S  W ++N   I    + A  ++EG+ Y+ RVYA N+ G+S PS  S+      P+ P
Sbjct: 21426 RNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDP 21485

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P ++   DV+  T++LKW PP R G   + GYS+E   +G   WV            
Sbjct: 21486 PGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEK-RQGNERWVRCNFTDVSECQY 21541

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTV-QEILQRPRLQLPRHLRQTIQKKVG 988
              V  L  G R  FR+ A N  G  +P + +  + + ++    P ++        +  K G
Sbjct: 21542 TVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSG 21601

Query: 989   EPVNLLIPFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
             E + +    QG+P P+VTW K+G  +     + I +    T LF+R A R H G Y V  
Sbjct: 21602 ESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEA 21661

Query: 1048  RIENMEDKATLVLQVVDKPSP-PQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD 1106
             +  +   KA + ++V D P      +R T+  G  + L W  P + G   +  Y ++K +
Sbjct: 21662 KNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRE 21721

Query: 1107  KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF-----SDRAATTKEPVFIP 1161
                + W  + +          +LI GN Y FRV + N  G      SD      +     
Sbjct: 21722 TSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPD 21781

Query: 1162  RPGITYEPPN 1171
              PGI  EP N
Sbjct: 21782 APGIP-EPSN 21790



 Score =  185 bits (469), Expect = 3e-46
 Identities = 224/932 (24%), Positives = 347/932 (37%), Gaps = 158/932 (16%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            +V +  ++    E+    A+ KW +N + I    SKYI        TL I    L D A 
Sbjct: 6278 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAI-FDSSKYIILQKDLVYTLRIRDAHLDDQAN 6336

Query: 434  YQCVVGGE-----KCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLK 488
            Y   +        K +  L V+E  + I  PL+D   M  + V F C+V+     +KW K
Sbjct: 6337 YNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTK 6396

Query: 489  DGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVY 548
            +G E+  +    YR  K   +H L I +    D G Y +     +++AEL++ E   E  
Sbjct: 6397 NGEEVPFDNRVSYRVDK--YKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFV 6454

Query: 549  QSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTP 608
            + + D  V   D AVF C++S E     W +NG+E+    + K    G +H+L I D   
Sbjct: 6455 EHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRL 6514

Query: 609  ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLR 668
             DE +Y+   E       A+L   E+ ++ +    PP+  L+ PG   D + +   NK +
Sbjct: 6515 DDECEYACGVEDRKSR--ARLFVEEIPVEII---RPPQDILEAPGA--DVVFLAELNKDK 6567

Query: 669  LDVPISGDPAPTVIWQK---AITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRV 725
            ++V           W +    + QG+K                 E    +  +C+ + R 
Sbjct: 6568 VEVQ----------WLRNNMVVVQGDKHQMM------------SEGKIHRLQICDIKPR- 6604

Query: 726  RVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGE 785
                               D+G Y    K+     ++ L           AAPKI    +
Sbjct: 6605 -------------------DQGEYRFIAKDKEARAKLELA----------AAPKIKTADQ 6635

Query: 786  DSCTVQWEPPAYDGGQPILGYI-LERKKKKSYRWMRLNFDLIQEL-----SHEARRMIEG 839
            D           D G+P+   +  +   K    W + N  L  +         + R++E 
Sbjct: 6636 DLVV--------DVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEA 6687

Query: 840  VVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAG 899
               +   Y +        +        I  P    +L V +  D  VSL W  P   G  
Sbjct: 6688 KKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGS 6747

Query: 900  GLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA-RLLFRVRAHNMAGPGAPVTT 958
             + GY VE        WV A     E     V  L  G    LFRV A N  G G PV T
Sbjct: 6748 KIIGYVVERRDIKRKTWVLATDR-AESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVET 6806

Query: 959  TEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPL 1014
              PV       R +  +P           G P+N+ I    +    +TW       G  +
Sbjct: 6807 DNPVEA-----RSKYDVP-----------GPPLNVTITDVNRFGVSLTWEPPEYDGGAEI 6850

Query: 1015 AGEEVSIRNSPT---DTILFIRAARR-------VHSGTYQVTVRIENM-----EDKATLV 1059
                + +R+  +   DT + +RA          V    Y   VR +N         AT  
Sbjct: 6851 TNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPF 6910

Query: 1060 LQVVD---KPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
            ++V D   +PSPP +L  +D    +V L+W+PP   G + + GY +++ ++    W    
Sbjct: 6911 VKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWI--- 6967

Query: 1117 EHYRRTHCVVPELII-------GNGYYFRVFSQNMVGFSDRAAT----TKEPVFIPRPGI 1165
               R    +VPEL         GN Y +RV ++N  G SD +      T +  F+     
Sbjct: 6968 ---RCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFV----- 7019

Query: 1166 TYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDA 1225
              EP     +D S   +F   L    VI      +     G P+P  +W      L    
Sbjct: 7020 --EP----TMDLS---AFKDGL---EVIVPNPITILVPSTGYPRPTATWCFGDKVLETGD 7067

Query: 1226 RFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
            R +M +      L I      D GIY  +  N
Sbjct: 7068 RVKMKTLSAYAELVISPSERSDKGIYTLKLEN 7099



 Score =  184 bits (467), Expect = 5e-46
 Identities = 128/483 (26%), Positives = 224/483 (46%), Gaps = 20/483 (4%)

Query: 702  PEDTGDSD--EWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG- 758
            PE  G S    ++ +K+ +   +G   V+TT   +  TV    +    V+ V  +N +G 
Sbjct: 7735 PEKDGGSPITNYIVEKRDV-RRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQ 7793

Query: 759  ------EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
                  ED V L       P  P A  + +V +    ++WEPP  DGG+PI  Y++E+K+
Sbjct: 7794 SDYTEIEDSV-LAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKE 7852

Query: 813  KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGP 869
            +   RW++       + +     +IEG   + +V A N  G+  PS  ++      P  P
Sbjct: 7853 RLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSP 7912

Query: 870  PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
            PS P  L V D     +++ W+PPE+ G   + GY VE CP G  +W+       +    
Sbjct: 7913 PSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKF 7972

Query: 930  LVKD-LPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVG 988
             V++ +      + RVRA N  G   P   +E V  ++   +P + L  H    I+   G
Sbjct: 7973 KVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIE---G 8029

Query: 989  EPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTV 1047
            E +++ +PF+  P P V+W K+G+ + A + ++++N      L +  + R  +G Y +T+
Sbjct: 8030 EKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITL 8089

Query: 1048 RIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADK 1107
              +     A++ ++V+  P P +D++ +D    +  L W+PP+  G T +  Y +++ + 
Sbjct: 8090 ENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREA 8149

Query: 1108 KTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITY 1167
                +  V+    +    V +LI    Y+FRV + N VG        K PV    P    
Sbjct: 8150 GRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVG-GGEYIELKNPVIAQDPKQPP 8208

Query: 1168 EPP 1170
            +PP
Sbjct: 8209 DPP 8211



 Score =  183 bits (465), Expect = 8e-46
 Identities = 119/406 (29%), Positives = 184/406 (45%), Gaps = 15/406 (3%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P  P  P ++++ +D   VQW  P  DGG  I+GY LE+K+K S  W++LN   IQ+   
Sbjct: 18133 PGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKF 18192

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSL 888
             +   + EG+ YE +V A N +G+ +PS  S+ F+   P  PP  P  +    ++   V+L
Sbjct: 18193 KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIV---ITRNNVTL 18249

Query: 889   KWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
             KW+ P   G   + GY VE        W+ A       T   V  L    R  FRV A N
Sbjct: 18250 KWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARN 18309

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTW 1007
              AG    P  ++  +T ++ +  P   L    +  I    GE   L    +GKP P V W
Sbjct: 18310 AAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVW 18369

Query: 1008  TKEGQPL--AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             +K+G+ L      + I+++   T L ++   R   G Y + +          + ++V+D+
Sbjct: 18370 SKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDR 18429

Query: 1066  PSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHC 1124
             P PP+  L+VT        L W PP   G   +  Y ++K +   + W  V    +  + 
Sbjct: 18430 PGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNY 18489

Query: 1125  VVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPP 1170
              V +L+ GN Y FRV + N  G  +       PV    P   Y+PP
Sbjct: 18490 KVTKLLPGNEYIFRVMAVNKYGIGE--PLESGPVTACNP---YKPP 18530



 Score =  183 bits (465), Expect = 8e-46
 Identities = 149/599 (24%), Positives = 245/599 (40%), Gaps = 43/599 (7%)

Query: 577   WLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKI 636
             W K+G+ L   +R+ VS    V  L+I + +  D   Y       A +++     + + I
Sbjct: 19056 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSIT-----VPITI 19110

Query: 637   DFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPAR 696
               + R  PP                     +R+D  +S D   T+ W      G    + 
Sbjct: 19111 IVLDRPGPP-------------------GPIRID-EVSCDSI-TISWNPPEYDGGCQISN 19149

Query: 697   PAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNP 756
                +  E T  S  W    + +  T  ++   TT     F V    +  +  Y+      
Sbjct: 19150 YIVEKKETT--STTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYS------ 19201

Query: 757   VGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSY 816
               E    +       P  P  PK+ +  + +  V W+ P  DGG  ++GY LE K++ S 
Sbjct: 19202 --ESSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSI 19259

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHL 876
              W + N  LI +   +   + EG++YE RVYA N  G+ + S + +P     P   P   
Sbjct: 19260 LWSKANKILIADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQP 19319

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V +++  +VSLKW  P   G   + GY VE        W+       + T   V +L  
Sbjct: 19320 EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTE 19379

Query: 937   GARLLFRVRAHNMA-GPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI 995
               R  FRV A N A     P  +T P+ V++ ++ PR+ +    R  I  K GE + +  
Sbjct: 19380 DQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINA 19439

Query: 996   PFQGKPRPQVTWTKEGQPLAGE-EVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMED 1054
                G+P P ++W K+G  +       I ++   T+L ++   R  +G Y +T++      
Sbjct: 19440 DIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTR 19499

Query: 1055  KATLVLQVVDKPSPPQ-DLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWF 1113
                +  +V+DKP PP   L +        +L W  PQ+ G  ++  Y V+K +   + W 
Sbjct: 19500 SVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWT 19559

Query: 1114  TVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR----AATTKEPVFIPRPGITYE 1168
                   + T C V +L+ GN Y FRV   N  G  +     A    +P  +P P  + E
Sbjct: 19560 ICEGELQMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLE 19618



 Score =  182 bits (462), Expect = 2e-45
 Identities = 114/380 (30%), Positives = 178/380 (46%), Gaps = 5/380 (1%)

Query: 771   VPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELS 830
             +P  P + +++N+ +DS TV W  P  DGG  I+GYI+E++ +   RW++ N   I +L 
Sbjct: 17446 LPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLR 17505

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVS 887
                  + E   YE RV A NA G+  PSPA+  +    P+  P  PT+  + D +  +++
Sbjct: 17506 LRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSIT 17565

Query: 888   LKWRPPERVGAGGLDGYSVEYCPEGCSEW-VAALQGLTEHTSILVKDLPTGARLLFRVRA 946
             L W  P   G   + GY VE C     EW +   Q     T   +  L        RV A
Sbjct: 17566 LAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCA 17625

Query: 947   HNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVT 1006
              N  G G   +    V  ++ L+ P L L   LR+ I  + G    + IPF+G+P P++T
Sbjct: 17626 LNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEIT 17685

Query: 1007  WTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKP 1066
             W++E      ++V I      T L I    R  +G Y + +   +    A + ++V+D P
Sbjct: 17686 WSREEGEFT-DKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTP 17744

Query: 1067  SPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVV 1126
              PPQ+L V +    +  L W+PP   G  ++  Y + K +     +  V     +T   V
Sbjct: 17745 GPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKV 17804

Query: 1127  PELIIGNGYYFRVFSQNMVG 1146
               L  G  YYFRV ++N  G
Sbjct: 17805 ENLTEGAIYYFRVMAENEFG 17824



 Score =  180 bits (456), Expect = 9e-45
 Identities = 116/381 (30%), Positives = 183/381 (48%), Gaps = 6/381 (1%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSH 831
             P AP  P++ +V  ++ +++WE P +DGG  I+GY +E+K++ +  W++ N     E ++
Sbjct: 22469 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 22528

Query: 832   EARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWR 891
             +   ++EG+ Y+ R YA+NA G+S+ S AS+P M   P   P    V DV+ +TVSL W 
Sbjct: 22529 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 22588

Query: 892   PPERVGAGGLDGYSVEYCP---EGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHN 948
              P   G   + GY +E  P    G   W+     +       V  L  G    FRV A N
Sbjct: 22589 APAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKN 22648

Query: 949   MAGP-GAPVTTTEPVTVQEILQRPRLQLPRHLR-QTIQKKVGEPVNLLIPFQGKPRPQVT 1006
              AG       +T PVT ++    P+ +L   L    +  + G  + L     GKP P++ 
Sbjct: 22649 AAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKII 22708

Query: 1007  WTKEGQPL-AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDK 1065
             WTK  + L   E+VS++ +       I+   R  SG Y +TV+  +     +++++V+D 
Sbjct: 22709 WTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDS 22768

Query: 1066  PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCV 1125
             P P   L V+        L W  PQ+ G  E+  Y V++ +   + W  V         V
Sbjct: 22769 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYV 22828

Query: 1126  VPELIIGNGYYFRVFSQNMVG 1146
             V  LI  N Y FRV + N  G
Sbjct: 22829 VTRLIKNNEYIFRVRAVNKYG 22849



 Score =  171 bits (432), Expect = 5e-42
 Identities = 157/594 (26%), Positives = 238/594 (40%), Gaps = 72/594 (12%)

Query: 707  DSDEWVFDKKL-LCETEGRVRVETTKDRSIFTV-----EGAEKEDEGVYTVTVKNPVGED 760
            D+D+WV   K+ + +T  RV+  T K +  F V      G  K  +    + +K+P    
Sbjct: 7553 DTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDP---- 7608

Query: 761  QVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMR 820
                    ID P  P  P + +VG+ S  + W  P +DGG  I  Y++E  K  +  W+R
Sbjct: 7609 --------IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVR 7660

Query: 821  LNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLA 877
            +  + +    H    ++EG  Y  RV AVN  G S PS  S P +    + PPS P  L 
Sbjct: 7661 VA-EGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLE 7719

Query: 878  VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
            V +++  T  LKW  PE+ G   +  Y VE        W   +    + T   V  L  G
Sbjct: 7720 VINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW-QTVDTTVKDTKCTVTPLTEG 7778

Query: 938  ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV---------- 987
            +  +FRV A N  G        + V  ++    P       +    ++ V          
Sbjct: 7779 SLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKND 7838

Query: 988  -GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP----TDTILFIRAARRVHSGT 1042
             G P+   +  + K R    W K G+  AG + + R +     T+    +RA      G 
Sbjct: 7839 GGRPIQRYV-IEKKERLGTRWVKAGKT-AGPDCNFRVTDVIEGTEVQFQVRAENEAGVGH 7896

Query: 1043 YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
                  I ++ED  +        PSPP DL VTDA   ++A+ WKPP+  G + + GY V
Sbjct: 7897 PSEPTEILSIEDPTS-------PPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHV 7949

Query: 1103 QKADKKTMEWFTVLEH------YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKE 1156
            +     T +W  V         ++    VVP+      Y  RV + N +G S       E
Sbjct: 7950 EMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPD----KEYVLRVRAVNAIGVS-------E 7998

Query: 1157 PVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFK 1216
            P  I    +  +P     +D       T  ++   VI G    +    R  P P +SW K
Sbjct: 7999 PSEISENVVAKDPDCKPTIDLE-----THDII---VIEGEKLSIPVPFRAVPVPTVSWHK 8050

Query: 1217 NGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
            +G ++    R  M +      LE+ K    D GIY     N  G A     ++V
Sbjct: 8051 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 8104



 Score =  151 bits (381), Expect = 4e-36
 Identities = 127/445 (28%), Positives = 198/445 (44%), Gaps = 36/445 (8%)

Query: 750   TVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILE 809
             T  + +P+    V +     + P AP  P I+ V +DSC V W+PPA DGG  I  Y LE
Sbjct: 24431 TFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLE 24490

Query: 810   RKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPF----- 864
             +++KK  +W+ +  + I+E     + +IEG+ YE RV   N  G S  S  S+P      
Sbjct: 24491 KREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSD 24550

Query: 865   MPIGPP---SEPTHLAVEDVSDTTVSLK-WRPPERVGAGGLDGYSVEYCPEGCSEWVAAL 920
             +PI  P    E  +L V   S+ T+  K    P+ +      G   E   +G    +   
Sbjct: 24551 VPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQG--KEIIADGLKYRIQEF 24608

Query: 921   QGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLR 980
             +G   +  +++  +      +++VRA N  G      +       E+    ++ LP+ L 
Sbjct: 24609 KG--GYHQLIIASVTDDDATVYQVRATNQGG------SVSGTASLEVEVPAKIHLPKTLE 24660

Query: 981   --QTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGE----EVSIRNSPTDTILFIRA 1034
                 +    GE V++ IPF GKP P +TW K GQ L       +V +  S T +++F   
Sbjct: 24661 GMGAVHALRGEVVSIKIPFSGKPDPVITWQK-GQDLIDNNGHYQVIVTRSFT-SLVFPNG 24718

Query: 1035  ARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGN 1094
               R  +G Y V  +     D+ T+ L V D P PP+ ++V+D    +V L W  P   G 
Sbjct: 24719 VERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGG 24778

Query: 1095  TELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATT 1154
             +++  Y V+K       W  V    R T   V  L     Y FRV ++N  G S      
Sbjct: 24779 SKITNYIVEKCATTAERWLRV-GQARETRYTVINLFGKTSYQFRVIAENKFGLS------ 24831

Query: 1155  KEPVFIPRPGITYEPPNYKALDFSE 1179
              +P     P IT E    +A+++ E
Sbjct: 24832 -KPSEPSEPTITKEDKT-RAMNYDE 24854



 Score =  144 bits (364), Expect = 4e-34
 Identities = 106/366 (28%), Positives = 162/366 (44%), Gaps = 48/366 (13%)

Query: 640   PRQEPPKI--------HLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGN 691
             PR+  P I         LD  G     ++  AG+ +++++P+ G P PTV W+K      
Sbjct: 14676 PRESRPVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKK------ 14729

Query: 692   KAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTV 751
                           GD        ++L +T+ RV  ETT   +I  +    + D G Y +
Sbjct: 14730 --------------GD--------QILKQTQ-RVNFETTATSTILNINECVRSDSGPYPL 14766

Query: 752   TVKNPVGEDQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILER 810
             T +N VGE    +T++V D+P  P  P K   V  D  T  W+PP  DGG PI  Y++E 
Sbjct: 14767 TARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEM 14826

Query: 811   KKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFM 865
             ++  S  W+ L   +I+  +++A R+  G+ Y+ RV A N  G+     S    A+ PF 
Sbjct: 14827 RQTDSTTWVELATTVIRT-TYKATRLTTGLEYQFRVKAQNRYGVGPGITSACIVANYPFK 14885

Query: 866   PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
               GPP  P    V  V+  ++++ W  P   G   + GY VE        W    + L  
Sbjct: 14886 VPGPPGTPQ---VTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVP 14942

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHL-RQTIQ 984
                     L  G    FRV A NMAG   P   +EP+   + +  P   +P ++ R T+ 
Sbjct: 14943 GNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVT 15002

Query: 985   KKVGEP 990
              K  +P
Sbjct: 15003 LKWAKP 15008



 Score =  142 bits (357), Expect = 3e-33
 Identities = 105/345 (30%), Positives = 153/345 (44%), Gaps = 43/345 (12%)

Query: 635   KIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNK-LRLDVPISGDPAPTVIWQKAITQGNKA 693
             +I  V R +     LD  G +PD   +   N   RL +PI G PAP+V W+K        
Sbjct: 13596 EITVVARDDVVAPDLDLKG-LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG------- 13647

Query: 694   PARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
                      ED                T+ RV VE++   +   V   +K D G YT+T+
Sbjct: 13648 ---------EDP-------------LATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITL 13685

Query: 754   KNPVGEDQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKK 812
             KN  G  +  +++KV+  P  P  P K   V  ++ T++W PP  DGG  I  YILE++ 
Sbjct: 13686 KNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRD 13745

Query: 813   KKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPF-MP 866
               + +W+      +Q+ +    R+ EG+ Y  RV A N  G+     S P  A  PF +P
Sbjct: 13746 SVNNKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 13804

Query: 867   IGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH 926
               PP  P ++   DV   +VSL W  P++ G   + GY +E+       W  A +     
Sbjct: 13805 DAPP--PPNIV--DVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRM 13860

Query: 927   TSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
                 V  L  G    FRV A N+AG G P   +EPV   + +  P
Sbjct: 13861 RDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 13905



 Score =  140 bits (352), Expect = 1e-32
 Identities = 120/428 (28%), Positives = 177/428 (41%), Gaps = 58/428 (13%)

Query: 375  VSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAY 434
            V+ G       EL+  D  V+W   G++++ S  K +  S G   TLT+    L D    
Sbjct: 5835 VTAGETATFDCELSYEDIPVEWYLKGKKLEPS-DKVVPRSEGKVHTLTLRDVKLEDAGEV 5893

Query: 435  QCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELT 494
            Q      K    LFVKEPPV  T+PLEDQ V  G     ECEVS E A+VKW K+G E+ 
Sbjct: 5894 QLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEIL 5953

Query: 495  REETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADL 554
            + +  KY    DG+   L+I++   ED   Y       +    L V    +E  + + DL
Sbjct: 5954 KSK--KYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDL 6011

Query: 555  MVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
             V  K+ A F+CE+S EN +  W K+G E+    +  +   G V  L I+     DEA+Y
Sbjct: 6012 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6071

Query: 615  SFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPIS 674
            S   E      S  L  +E +  F                    I V   + ++L   +S
Sbjct: 6072 SC--EVRTARTSGMLTVLEEEAVFTKNLA--------------NIEVSETDTIKLVCEVS 6115

Query: 675  GDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRS 734
              P   VIW K                    GD +        + ET GR  + T   + 
Sbjct: 6116 -KPGAEVIWYK--------------------GDEE--------IIET-GRYEILTEGRKR 6145

Query: 735  IFTVEGAEKEDEGVYTVTVKNPVGEDQV---NLTVKVIDVP------DAPAAPKISNVGE 785
            I  ++ A  ED G Y   + +   + +V    L  + I  P      +   A  + ++ +
Sbjct: 6146 ILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISK 6205

Query: 786  DSCTVQWE 793
            +S  VQW+
Sbjct: 6206 ESFPVQWK 6213



 Score =  137 bits (345), Expect = 7e-32
 Identities = 127/511 (24%), Positives = 201/511 (39%), Gaps = 87/511 (17%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             + P   LD   +  D IVV AG    L+  I G P P V+W K                 
Sbjct: 18331 DAPNASLD--PKYKDVIVVHAGETFVLEADIRGKPIPDVVWSK----------------- 18371

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D K L ET  R+ +++T  ++   V+   + D G Y + + N  G   +
Sbjct: 18372 -----------DGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSI 18420

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              +TVKV+D P  P  P K++ V  + C + W PP  DGG  I  YI+E+++     W ++
Sbjct: 18421 PITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQV 18480

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFMPIGPPSEPTHL 876
             + + +Q L+++  +++ G  Y  RV AVN  G+     S P  A  P+ P GPPS P   
Sbjct: 18481 STE-VQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTP--- 18536

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              V  ++  ++ + W  P   G   ++GY +E   +    W    +       + V  L  
Sbjct: 18537 EVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTE 18596

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G    FRV A N AG G P   +      + L  P                G P N  + 
Sbjct: 18597 GHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPP----------------GPPSNPKVT 18640

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM 1052
                +    + W+K     G P+ G  V ++ +  D          +    + VT   EN 
Sbjct: 18641 DTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENT 18700

Query: 1053  E--------------DKATLVLQVV--DKPSPPQ-----------DLRVTDAWGLNVALE 1085
             E              + ATL   VV  ++  PP+            LR +    L V ++
Sbjct: 18701 EYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIK 18760

Query: 1086  WKPPQDVGNTELWGYTVQKADKKTMEWFTVL 1116
              +P  +V   +  G    +A  +    FT+L
Sbjct: 18761 GRPEPEVKWEKAEGILTDRAQIEVTSSFTML 18791



 Score =  135 bits (340), Expect = 2e-31
 Identities = 215/933 (23%), Positives = 349/933 (37%), Gaps = 118/933 (12%)

Query: 378  GHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV 437
            G  +    EL     EV+WL+N   + + G K+   S G    L I      D   Y+ +
Sbjct: 6554 GADVVFLAELNKDKVEVQWLRNNMVV-VQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI 6612

Query: 438  VGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSE-EGAQVKWLKDGVELTRE 496
               ++   +L +   P + T   +D +V VG+ +           A+ +W K+   L+ +
Sbjct: 6613 AKDKEARAKLELAAAPKIKTAD-QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTK 6671

Query: 497  ETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMV 556
                       ++    I EA   D G Y +        AE  +  K ++V   + +L V
Sbjct: 6672 T-----IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEV 6726

Query: 557  GAKDQAVFKCEVSDENVRGVW---LKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
                      E  D  V   W   L +G   +    ++   I R   +   D   + E  
Sbjct: 6727 ---------TETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFT 6777

Query: 614  YSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPI 673
             + + +G       +  F     + V   EP  +  D P        V A +K   DVP 
Sbjct: 6778 VTGLQKG-----GVEYLFRVSARNRVGTGEP--VETDNP--------VEARSKY--DVP- 6819

Query: 674  SGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSD--EWVFDKK----LLCETEGRVRV 727
             G P    I     T  N+       + PE  G ++   +V + +    +  +T   VR 
Sbjct: 6820 -GPPLNVTI-----TDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRA 6873

Query: 728  ETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLT---VKVIDVPDAPAAP---KIS 781
            E         VEG E      + V  +N +G  + +     VKV D  + P+ P     S
Sbjct: 6874 EDLSATVTDVVEGQEYS----FRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSS 6929

Query: 782  NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
            +  + S  ++WEPP  DGG PILGYI+ER ++    W+R N  L+ EL+++   + +G  
Sbjct: 6930 DQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNK 6989

Query: 842  YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGA-GG 900
            Y  RV A N  G+S PS    P        EPT     D+S     L+   P  +     
Sbjct: 6990 YLYRVSAENKAGVSDPSEILGPLTADDAFVEPTM----DLSAFKDGLEVIVPNPITILVP 7045

Query: 901  LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960
              GY     P   + W    + L     + +K L   A L+      +  G         
Sbjct: 7046 STGY-----PRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENR 7100

Query: 961  PVTVQ-----EILQRPRLQLPRHLR-------------QTIQKKVGEPVNLLIPFQGKPR 1002
              T+       ++ RP    P+ L+             +      G P+   +  + +  
Sbjct: 7101 VKTISGEIDVNVIARP--SAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYV-VEKREV 7157

Query: 1003 PQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIE--NMEDKATLVL 1060
             + TWTK    +   E ++ +         +   R   G  +     E  NM   AT+  
Sbjct: 7158 SRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATV-- 7215

Query: 1061 QVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR 1120
                 P PP++++  D    ++ L W PP++ G + + GY V++  + + +W    E   
Sbjct: 7216 -----PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVA 7270

Query: 1121 RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
             T   V  L  G  Y +RV + N  G S  +  T+E                +A+D  EA
Sbjct: 7271 ETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEE---------------IQAVDTQEA 7315

Query: 1181 PSF---TQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
            P      + L   +V AG    L   V G P+PKI+W K  + L +D R  + +     T
Sbjct: 7316 PEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKST 7375

Query: 1238 LEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
            + I      D G Y+  A N+ G A     + V
Sbjct: 7376 VTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7408



 Score =  134 bits (338), Expect = 4e-31
 Identities = 121/458 (26%), Positives = 200/458 (43%), Gaps = 38/458 (8%)

Query: 708   SDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVK 767
             +D+WV   K         ++ TT    ++TV G   + E  + +  +N VG  + +   +
Sbjct: 24001 TDKWVRHNK--------TQITTT----MYTVTGLVPDAEYQFRIIAQNDVGLSETSPASE 24048

Query: 768   VI------DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              +      D P  P   +I ++ +DS T+QWE P  DGG+ ILGY +E ++     W + 
Sbjct: 24049 PVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKS 24108

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
             N + I++       ++E   YE RV+A N  G+SRP   +          E   +  E +
Sbjct: 24109 NKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKE-M 24167

Query: 882   SDTTVSLKWRPPERVGAGGLDGYSVEYCPEG-----CSEWVAALQGLTEHTSILVKDLPT 936
              D T  L           G     +++   G       ++  +  G T   +++ ++   
Sbjct: 24168 KDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQED 24227

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
                 ++   A N  G    V T+  + +Q     P+      L++     VG  + L + 
Sbjct: 24228 EG--VYTCIATNEVGE---VETSSKLLLQAT---PQFHPGYPLKEKYYGAVGSTLRLHVM 24279

Query: 997   FQGKPRPQVTWTKEGQPLA--GEEVSIRNSPTDTILFIR-AARRVHSGTYQVTVRIENME 1053
             + G+P P +TW   GQ L    E ++I N+   T L ++   R+ H+G Y+V +      
Sbjct: 24280 YIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGT 24338

Query: 1054  DKATLVLQVVDKPSPPQDLRVTDAWGLNVA-LEWKPPQDVGNTELWGYTVQKAD-KKTME 1111
               A L +++ DKP  P    V +A   N A + WKPP D G + +  Y V+K + K+  E
Sbjct: 24339 VDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAE 24398

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             W  V      T C +  L    GYYFRV +QN  G SD
Sbjct: 24399 WQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISD 24436



 Score =  134 bits (337), Expect = 6e-31
 Identities = 115/412 (27%), Positives = 167/412 (40%), Gaps = 57/412 (13%)

Query: 654   RIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVF 713
             ++   + V AG+ +RL+  + G P P V W K              DA + T        
Sbjct: 11834 KLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKD------------KDATDLTRSP----- 11876

Query: 714   DKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPD 773
                       RV+++T  D S F++  A++ D G Y VT  N  G      TV V+D P 
Sbjct: 11877 ----------RVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPG 11926

Query: 774   APAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEA 833
                  KI +V  D CTV W+PP  DGG  I  YILE+ + K   W   +  ++       
Sbjct: 11927 PVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTP-GTTV 11985

Query: 834   RRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKW 890
              R+IEG  Y  RV A N IG   P+  S+P +       P  P    V  VS   +++ W
Sbjct: 11986 TRLIEGNEYIFRVRAENKIGTGPPT-ESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVW 12044

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
              PPE  G   + GY +E   +  + WV   +       + V++L       FRV+A N  
Sbjct: 12045 NPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEI 12104

Query: 951   GPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE 1010
             G G P   + PV  ++ ++ P                G P N  +    K    + W K 
Sbjct: 12105 GIGEPSLPSRPVVAKDPIEPP----------------GPPTNFRVVDTTKHSITLGWGKP 12148

Query: 1011  ----GQPLAGEEVSIR-----NSPTDTILFIRAARRVHSGTYQVTVRIENME 1053
                 G P+ G  V +R      SP +      AA ++    + VT   EN E
Sbjct: 12149 VYDGGAPIIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQE 12200



 Score =  132 bits (333), Expect = 2e-30
 Identities = 101/340 (29%), Positives = 154/340 (45%), Gaps = 19/340 (5%)

Query: 649  LDCPGRIPDT-IVVVAGNKLRLDVPISGDPAPTVIWQKA--ITQGNKAPARPAPDAPEDT 705
            +D P  I  T + V  G+++ LD  ISG P PT+ W K   +    +   R AP      
Sbjct: 8306 IDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRK 8365

Query: 706  GDSDEWVFDKKLLCETEGRVRVETTKD-RSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNL 764
            G+  E   ++  +     R+ ++ +K   S   V  + + D G+Y + V+N  G  +   
Sbjct: 8366 GEVQE---EEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPC 8422

Query: 765  TVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILER--KKKKSYRWMRLN 822
            TV V+D P  P      ++ + S   +WEPP  DGG  I+ Y LE+  K K    W+ + 
Sbjct: 8423 TVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVT 8482

Query: 823  FDLIQELSHEARRMIEGVVYEMRVYAVNAIG-----MSRPSPASQPFMPIGPPSEPTHLA 877
               ++   +   ++IEG  Y  RV A N  G     +S+P  A  PF   GPP  P    
Sbjct: 8483 -STLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPF---GPPDAPDKPI 8538

Query: 878  VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTG 937
            VEDV+  ++ +KW  P+  G+  L GY +E      + W    + L       V  L  G
Sbjct: 8539 VEDVTSNSMLVKWNEPKDNGSPIL-GYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEG 8597

Query: 938  ARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPR 977
               +FRV A N AGPG     ++P T  + +  P   +PR
Sbjct: 8598 LTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPR 8637



 Score =  132 bits (331), Expect = 3e-30
 Identities = 116/487 (23%), Positives = 193/487 (39%), Gaps = 56/487 (11%)

Query: 547   VYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIGRVHKLTIDD 605
             + + + D+     + A   C++    +  + W + GKEL+   + K+S  GR H LT+  
Sbjct: 24163 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMT 24222

Query: 606   VTPADEADYSFVP--EGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVA 663
                 DE  Y+ +   E      S+KL            Q  P+ H   P  + +      
Sbjct: 24223 EEQEDEGVYTCIATNEVGEVETSSKLLL----------QATPQFHPGYP--LKEKYYGAV 24270

Query: 664   GNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEG 723
             G+ LRL V   G P P + W                             F  + L +   
Sbjct: 24271 GSTLRLHVMYIGRPVPAMTW-----------------------------FHGQKLLQNSE 24301

Query: 724   RVRVETTKDRSIFTVEGAEKEDE-GVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP-KIS 781
              + +E T+  +   ++  +++   G Y V + N  G     L V++ D PD P  P  I 
Sbjct: 24302 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIE 24361

Query: 782   NVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
              + ++S  + W+PPA DGG  I  Y++E+ + K     +L    I   +     + E   
Sbjct: 24362 ALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAG 24421

Query: 842   YEMRVYAVNAIGMSRPSPAS------QPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPER 895
             Y  RV A N  G+S P   S       PF   G P +PT  AV    D+ V + W+PP  
Sbjct: 24422 YYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAV--TKDSCV-VAWKPPAS 24478

Query: 896   VGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAP 955
              G   +  Y +E   +  ++W++        T   VK+L  G    FRV+  N+ G    
Sbjct: 24479 DGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEW 24538

Query: 956   VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
                +EP+T +  +          LR  +  +      L+    G P+P V W ++G+ + 
Sbjct: 24539 SEISEPITPKSDVPIQAPHFKEELR-NLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEII 24597

Query: 1016  GEEVSIR 1022
              + +  R
Sbjct: 24598 ADGLKYR 24604



 Score =  131 bits (329), Expect = 5e-30
 Identities = 95/310 (30%), Positives = 133/310 (42%), Gaps = 39/310 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             +T  V+AG  L++DVP  G P P V W K                            D  
Sbjct: 15783 NTFTVLAGEDLKVDVPFIGRPTPAVTWHK----------------------------DNV 15814

Query: 717   LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPA 776
              L +T  RV  E+T++ S+ T++ A +ED G Y V + N  GE    L V V+D P  P 
Sbjct: 15815 PLKQTT-RVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPT 15873

Query: 777   AP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
              P K+  V  DS T+ W PP YDGG  I  YI+E++   +  W  ++   +   + +A R
Sbjct: 15874 GPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSAT-VARTTIKACR 15932

Query: 836   MIEGVVYEMRVYAVNAIGMS-----RPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKW 890
             +  G  Y+ R+ A N  G S      P+ A  PF   GPP  P    V   S  ++ ++W
Sbjct: 15933 LKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPV---VTLSSRDSMEVQW 15989

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
               P   G   + GY +E        WV   +     T      L  G    FRV A N+ 
Sbjct: 15990 NEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIV 16049

Query: 951   GPGAPVTTTE 960
             G G P   +E
Sbjct: 16050 GIGKPSKVSE 16059



 Score =  130 bits (328), Expect = 6e-30
 Identities = 94/317 (29%), Positives = 141/317 (44%), Gaps = 37/317 (11%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             +PP+I +D   +  DTIVV AG   ++D  I G P PT+ W K                 
Sbjct: 16167 DPPRISMD--PKYKDTIVVHAGESFKVDADIYGKPIPTIQWIK----------------- 16207

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                GD +              R+ +++T   +  +V+ A + D G Y +  KN  GE  V
Sbjct: 16208 ---GDQE---------LSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSV 16255

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              + VKV+D P  P  P  IS V  + CT+ W+PP  DGG  I+ YI+ER++     W  +
Sbjct: 16256 TVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVV 16315

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGP---PSEPTHLAV 878
             + + +Q LS +  +++EG  Y  R+ AVN  G+  P   S+P +   P   P  P    V
Sbjct: 16316 DAN-VQTLSCKVTKLLEGNEYTFRIMAVNKYGVGEPL-ESEPVVAKNPFVVPDAPKAPEV 16373

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
               V+  ++ + W  P   G   + GY +E   +    W    + L     + V  L    
Sbjct: 16374 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 16433

Query: 939   RLLFRVRAHNMAGPGAP 955
                FRV A N AG   P
Sbjct: 16434 DYEFRVSAENAAGLSEP 16450



 Score =  128 bits (321), Expect = 4e-29
 Identities = 99/421 (23%), Positives = 172/421 (40%), Gaps = 64/421 (15%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP+I L     +   + V AG  + LD  + G P PTV W+K                  
Sbjct: 12920 PPRIDLSVA--MKSLLTVKAGTNVCLDATVFGKPMPTVSWKK------------------ 12959

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE--GAEKEDEGVYTVTVKNPVGEDQ 761
                       D  LL   EG   ++    R++ T+E     ++D G YT+T +N  G   
Sbjct: 12960 ----------DGTLLKPAEG---IKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKS 13006

Query: 762   VNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
               + +KV+D P  PA+ KI+ +  D   + WEPP  DGG  I  YI+++++     W ++
Sbjct: 13007 ATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQV 13066

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGM-----SRPSPASQPFMPIGPPSEPTHL 876
             +   +   S    ++IEG  Y+ R+ A N  G+     + P+ A  P+ P G    P   
Sbjct: 13067 S-ATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPP--- 13122

Query: 877   AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPT 936
              + +++   +++ W+PP   G   + GY +E        W    +      ++    L  
Sbjct: 13123 VISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQE 13182

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             G    FRV A N AGPG P   ++    ++    P                G P    + 
Sbjct: 13183 GTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP----------------GPPAFPKVY 13226

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM 1052
                +    ++W K     G P+ G  V ++ + +D  +     + +    ++VT  +E+ 
Sbjct: 13227 DTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLMEDT 13286

Query: 1053  E 1053
             +
Sbjct: 13287 Q 13287



 Score =  127 bits (320), Expect = 5e-29
 Identities = 107/389 (27%), Positives = 163/389 (41%), Gaps = 50/389 (12%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
            F K LE    V +G    L  E++  +A+VKW KNG EI +   KY   + G  R L I 
Sbjct: 5915 FTKPLEDQ-TVEEGATAVLECEVSRENAKVKWFKNGTEI-LKSKKYEIVADGRVRKLVIH 5972

Query: 425  QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
             C+  D   Y C     K S  L V  P V   RPL D  V   +   FECE+S E A+V
Sbjct: 5973 DCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKV 6032

Query: 485  KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
            KW KDG E+ + +  KY     G    L+IN+ +L+D   Y+      +    L V E++
Sbjct: 6033 KWFKDGAEIKKGK--KYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEE 6090

Query: 545  LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
                +++A++ V   D     CEVS      +W K  +E++   R ++   GR   L I 
Sbjct: 6091 AVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQ 6150

Query: 605  DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAG 664
            +    D  +Y+        +   K+H  E+  +F+ +              P  + ++ G
Sbjct: 6151 NAHLEDAGNYNCRLPSSRTDGKVKVH--ELAAEFISK--------------PQNLEILEG 6194

Query: 665  NKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGR 724
             K      IS +  P V W++              D   ++GD  + + D        G+
Sbjct: 6195 EKAEFVCSISKESFP-VQWKR-------------DDKTLESGDKYDVIAD--------GK 6232

Query: 725  VRVETTKDRSIFTVEGAEKEDEGVYTVTV 753
             RV   KD ++        +D G Y V V
Sbjct: 6233 KRVLVVKDATL--------QDMGTYVVMV 6253



 Score =  127 bits (318), Expect = 9e-29
 Identities = 91/356 (25%), Positives = 152/356 (42%), Gaps = 39/356 (10%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E P+I +D   R  DTIVV AG   RL+  + G P PT+ W +                 
Sbjct: 17249 ELPRISMDPKFR--DTIVVNAGETFRLEADVHGKPLPTIEWLRG---------------- 17290

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        DK++  E   R  ++ T  +++  V+ A + D G Y +   N  G    
Sbjct: 17291 -----------DKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSF 17337

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
              + VKV+D P  P  P +++ V  + C++ W PP  DGG  I  Y++E+++     W  +
Sbjct: 17338 PVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVV 17397

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM--PIGPPSEPTHLAVE 879
               +++   S +  +++EG  Y  R+ AVN  G+  P  ++   M  P   P  P  L V 
Sbjct: 17398 ASEVVTN-SLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVT 17456

Query: 880   DVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
             +++  ++++ W  P+  G   + GY VE        W+   +       + V  L     
Sbjct: 17457 NIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHE 17516

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV----GEPV 991
               FRV A N AG G P   T      + + +P      H+  T +  +    G+P+
Sbjct: 17517 YEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPI 17572



 Score =  127 bits (318), Expect = 9e-29
 Identities = 97/336 (28%), Positives = 144/336 (42%), Gaps = 38/336 (11%)

Query: 640   PRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAP 699
             P+ EP     D  G     I   AG+   +DVPISG PAP V W+               
Sbjct: 22269 PQIEPTA---DLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWK--------------- 22310

Query: 700   DAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
                           ++  L ET+ RV + TTKDR+  TV+ + + D G Y +T++N  G 
Sbjct: 22311 -------------LEEMRLKETD-RVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGV 22356

Query: 760   DQVNLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRW 818
                ++TV VI  P     P ++S+V  +SC + W  P   GG  I  YI+E+++  +  W
Sbjct: 22357 KTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAW 22416

Query: 819   MRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTH 875
               +N   ++    +   + + + Y  RV + N  G+S+P   S P +   P  PPS PT 
Sbjct: 22417 QLVNSS-VKRTQIKVTHLTKYMEYSFRVSSENRFGVSKPLE-SAPIIAEHPFVPPSAPTR 22474

Query: 876   LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLP 935
               V  VS   +S++W  P   G   + GY VE        WV   +      +  V  L 
Sbjct: 22475 PEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLV 22534

Query: 936   TGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
              G    FR  A N AG       + P+  Q  +  P
Sbjct: 22535 EGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAP 22570



 Score =  124 bits (312), Expect = 4e-28
 Identities = 103/421 (24%), Positives = 167/421 (39%), Gaps = 57/421 (13%)

Query: 643   EPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAP 702
             E PKI +D   +  DT+++ AG   RL+  +SG P PT+ W K                 
Sbjct: 15085 EAPKIKVDV--KFKDTVILKAGEAFRLEADVSGRPPPTMEWSK----------------- 15125

Query: 703   EDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                        D K L E   ++ ++     +    + + + D G YT+T  NP G  + 
Sbjct: 15126 -----------DGKEL-EGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKH 15173

Query: 763   NLTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                VKV+D P  P  P  ++ V  + C + W PP  DGG  I  YI+++++     W  +
Sbjct: 15174 IFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNV 15233

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAV 878
               + +Q    +  ++++G  Y  RV AVN  G+  P   S+P +   P GPP  P +  V
Sbjct: 15234 ASE-VQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPL-ESEPVLAVNPYGPPDPPKNPEV 15291

Query: 879   EDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGA 938
               ++  ++ + W  P+  G   +  Y VE   +    W+   +         V  L  G 
Sbjct: 15292 TTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGH 15351

Query: 939   RLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQ 998
                FR+ A N AG  AP  T+      + + +P                G P N  +   
Sbjct: 15352 EYEFRIMAENAAGISAPSPTSPFYKACDTVFKP----------------GPPGNPRVLDT 15395

Query: 999   GKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMED 1054
              +    + W K     G  + G  V I     D    +     + + +Y +T   EN E 
Sbjct: 15396 SRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEY 15455

Query: 1055  K 1055
             K
Sbjct: 15456 K 15456



 Score =  123 bits (309), Expect = 1e-27
 Identities = 133/548 (24%), Positives = 211/548 (38%), Gaps = 60/548 (10%)

Query: 739   EGAEKEDEGVYTVTVKNPVGEDQVNLTVKVID------VPDAPAAPKISNVGEDSCTVQW 792
             EG E E    Y V  +N  G    + T  +I       +P  P+ PKI + G+ + T+ W
Sbjct: 19677 EGCEYE----YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAW 19732

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
               P +DGG PI GY +E KK     W + +   ++   +    +  G  Y  RV +VN +
Sbjct: 19733 VKPLFDGGAPITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKV 19791

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDT-----------TVSLKWRPPERV--GAG 899
             G S PS +S P +      EP      ++  T           TV  + RP   V     
Sbjct: 19792 GASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKP 19851

Query: 900   GLDGYSVEYCPEGCSEWVAALQGLTEHTS----ILVKDLPTGARLLFRVRAHNMAGPGAP 955
               D  +  Y     S     ++    + S    + ++++ + A L   V+  +  GP   
Sbjct: 19852 DTDLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTN 19911

Query: 956   VTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
             +T  +      +L      +P       +   G PV      + +   +  W        
Sbjct: 19912 ITVQDVTKESAVLS---WDVP-------ENDGGAPVKNY-HIEKREASKKAWVSVTNNCN 19960

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVT 1075
                  + N     I + R +     G   V +  E  E      +++ +KPSPP+ L VT
Sbjct: 19961 RLSYKVTNLQEGAIYYFRVSGENEFG---VGIPAETKEG-----VKITEKPSPPEKLGVT 20012

Query: 1076  DAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGY 1135
                  +V+L W  P+  G + +  Y V+  +K    W       + TH VV  L   + Y
Sbjct: 20013 SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVA-KSTHHVVSGLRENSEY 20071

Query: 1136  YFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAG 1195
             +FRVF++N  G SD       PV I       EPP    +D    PS T       V AG
Sbjct: 20072 FFRVFAENQAGLSDPRELLL-PVLIKEQ---LEPPE---IDMKNFPSHTV-----YVRAG 20119

Query: 1196  YTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRA 1255
                 +   + G P PK++  ++G+ L    RF        LT+ +++    D G Y   A
Sbjct: 20120 SNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITA 20179

Query: 1256  TNLQGEAR 1263
              N  G  +
Sbjct: 20180 ANSSGTTK 20187



 Score =  121 bits (304), Expect = 4e-27
 Identities = 84/310 (27%), Positives = 131/310 (42%), Gaps = 39/310 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             +T  + AG  L++++P+ G P P + W K                            D +
Sbjct: 17947 NTYSIQAGEDLKIEIPVIGRPRPNISWVK----------------------------DGE 17978

Query: 717   LLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPA 776
              L +T  RV VE T   ++  ++   K+D G YTVT  N  G    NL+V V++ P  P 
Sbjct: 17979 PLKQTT-RVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPV 18037

Query: 777   AP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
              P +   V  D   + WEPPAY GG  I  YI+E++   +  W  ++   +   + +  +
Sbjct: 18038 GPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSAT-VARTTIKITK 18096

Query: 836   MIEGVVYEMRVYAVNAIGMSRPSPASQ-----PFMPIGPPSEPTHLAVEDVSDTTVSLKW 890
             +  G  Y+ R++A N  G S P  +       PF   GPP  P    V  +S   + ++W
Sbjct: 18097 LKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPGPPGTPF---VTSISKDQMLVQW 18153

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMA 950
               P   G   + GY +E   +    WV   +   + T      L  G    F+V A N+ 
Sbjct: 18154 HEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIV 18213

Query: 951   GPGAPVTTTE 960
             G G P   +E
Sbjct: 18214 GIGKPSKVSE 18223



 Score =  121 bits (304), Expect = 4e-27
 Identities = 89/349 (25%), Positives = 156/349 (44%), Gaps = 15/349 (4%)

Query: 738   VEGAEKEDEGVYTVTVKNPVG-----EDQVNLTVKV-IDVPDAPA-APKISNVGEDSCTV 790
             V+G ++  E  + V+ +N  G     + +  +T K  ++ P+ P+  P++ +V + S ++
Sbjct: 23917 VKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSL 23976

Query: 791   QWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVN 850
              W  P  DGG  + GY +ERK+  + +W+R N   I    +    ++    Y+ R+ A N
Sbjct: 23977 SWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQN 24036

Query: 851   AIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVE 907
              +G+S  SPAS+P +   P   PS+P  L +  +S  +V+L+W  PE  G   + GY VE
Sbjct: 24037 DVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVE 24096

Query: 908   YCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEI 967
             Y   G S W  + +   +     +  L       FRV A N  G   P  T   ++++  
Sbjct: 24097 YRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTA--MSIKTK 24154

Query: 968   LQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPL-AGEEVSIRNSPT 1026
             L        R   + +  K+GE   L     G+P P + W + G+ L    +  + +   
Sbjct: 24155 LTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGR 24214

Query: 1027  DTILFIRAARRVHSGTYQ--VTVRIENMEDKATLVLQVVDKPSPPQDLR 1073
                L +    +   G Y    T  +  +E  + L+LQ   +  P   L+
Sbjct: 24215 THTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLK 24263



 Score =  121 bits (303), Expect = 5e-27
 Identities = 99/388 (25%), Positives = 160/388 (41%), Gaps = 45/388 (11%)

Query: 480   EGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELI 539
             E  Q KW+    E  RE  F  +   +G  +   +    L     ++  +      +++ 
Sbjct: 24493 EKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVP 24552

Query: 540   VQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDS-RIKVSHI-G 596
             +Q    +  + + +L V  +  A   C+V+      V W + GKE++ D  + ++    G
Sbjct: 24553 IQAPHFK--EELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKG 24610

Query: 597   RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIP 656
               H+L I  VT  D   Y         ++S     +EV++       P KIHL       
Sbjct: 24611 GYHQLIIASVTDDDATVYQVRATNQGGSVSGTAS-LEVEV-------PAKIHLPKTLEGM 24662

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
               +  + G  + + +P SG P P + WQK                              +
Sbjct: 24663 GAVHALRGEVVSIKIPFSGKPDPVITWQKG-----------------------------Q 24693

Query: 717   LLCETEGRVRVETTKD-RSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAP 775
              L +  G  +V  T+   S+    G E++D G Y V  KN  G DQ  + + V DVPD P
Sbjct: 24694 DLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 24753

Query: 776   AAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARR 835
                K+S+V  DS  + W  PA DGG  I  YI+E+    + RW+R+     +E  +    
Sbjct: 24754 RGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVG--QARETRYTVIN 24811

Query: 836   MIEGVVYEMRVYAVNAIGMSRPSPASQP 863
             +     Y+ RV A N  G+S+PS  S+P
Sbjct: 24812 LFGKTSYQFRVIAENKFGLSKPSEPSEP 24839



 Score =  120 bits (301), Expect = 8e-27
 Identities = 94/330 (28%), Positives = 139/330 (42%), Gaps = 42/330 (12%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PPK  LD      D + + AG+ L LD  + G P P +IW K                  
Sbjct: 22671 PPKAELDARLH-GDLVTIRAGSDLVLDAAVGGKPEPKIIWTKG----------------- 22712

Query: 704   DTGDSDEWVFDKKL-LCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQV 762
                       DK+L LCE   +V ++ T  R+   ++  ++ D G YT+TVKN  G   V
Sbjct: 22713 ----------DKELDLCE---KVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAV 22759

Query: 763   NLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
             ++ VKV+D P       +S V ++ CT+ W  P  DGG  I  YI+ER++     W+ + 
Sbjct: 22760 SVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVE 22819

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIG-----MSRPSPASQPFMPIGPPSEPTHLA 877
              +    LS+   R+I+   Y  RV AVN  G      S P  A   F    PP  P  + 
Sbjct: 22820 GE-CPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGIPEEVG 22878

Query: 878   VEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH-TSILVKDLPT 936
                     + ++W  PE  G   +  Y V+   +    W    +    + T + V  L  
Sbjct: 22879 ---TGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 22935

Query: 937   GARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             G    FRV A N AG   P   +  ++ +E
Sbjct: 22936 GCDYQFRVTAVNAAGNSEPSEASNFISCRE 22965



 Score =  119 bits (298), Expect = 2e-26
 Identities = 80/274 (29%), Positives = 134/274 (48%), Gaps = 6/274 (2%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
            F  KL+    V K   I L  E++  DA VKW K+G+EI+ S +  I ++ G KR L + 
Sbjct: 5648 FTGKLQDYTGVEKDEVI-LQCEISKADAPVKWFKDGKEIKPSKNAVI-KADGKKRMLILK 5705

Query: 425  QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
            +   +D   Y C  G +K S +L +++  + + RPL    VM  +   FE E+SE+    
Sbjct: 5706 KALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHA 5765

Query: 485  KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
             W   G  L   +T     K++G+ H L+++   L+  G      +  ++ A L V+ + 
Sbjct: 5766 NWKLKGEALL--QTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRV 5823

Query: 545  LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
            + + + + D+ V A + A F CE+S E++   W   GK+L P  ++     G+VH LT+ 
Sbjct: 5824 IGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLR 5883

Query: 605  DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDF 638
            DV   D  +     + F  +  A L   E  ++F
Sbjct: 5884 DVKLEDAGEVQLTAKDFKTH--ANLFVKEPPVEF 5915



 Score =  119 bits (297), Expect = 2e-26
 Identities = 81/306 (26%), Positives = 131/306 (42%), Gaps = 39/306 (12%)

Query: 661   VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE 720
             V  G  L+++VPISG P PT+ W K                            D   L +
Sbjct: 16869 VQVGQDLKIEVPISGRPKPTITWTK----------------------------DGLPLKQ 16900

Query: 721   TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAP-K 779
             T  R+ V  + D +  +++   K+D G Y +TV N VG+   ++ +  +D PD P  P K
Sbjct: 16901 TT-RINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVK 16959

Query: 780   ISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEG 839
               +V  +S T+ W PP Y GG  I  YI++++   +  W  ++   +   + +  ++  G
Sbjct: 16960 FDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT-VARTTLKVTKLKTG 17018

Query: 840   VVYEMRVYAVNAIGMS-----RPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPE 894
               Y+ R++A N  G S      P  A  P+   GPP  P   A+   S  ++ ++W  P 
Sbjct: 17019 TEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAI---SKDSMVIQWHEPV 17075

Query: 895   RVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGA 954
               G   + GY +E        W    + +   T    ++L  G    FRV A N+ G G 
Sbjct: 17076 NNGGSPVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGK 17135

Query: 955   PVTTTE 960
                 +E
Sbjct: 17136 ASKNSE 17141



 Score =  118 bits (295), Expect = 4e-26
 Identities = 111/440 (25%), Positives = 189/440 (42%), Gaps = 60/440 (13%)

Query: 395  KWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPV 454
            KWLKNG EI+ S  K    +     +L I      D A Y  V G    +  L+V+   +
Sbjct: 2954 KWLKNGVEIK-STDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHI 3012

Query: 455  LITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLII 514
               + ++D  V+  +R  FECEVSE    V+W+KD  EL  + T + + +K+   H L+I
Sbjct: 3013 EFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRIKIQKEKYVHRLLI 3070

Query: 515  NEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVR 574
                + DAG Y +   G  + A+L V+ + + +     ++ V  K +AV + EV++++V 
Sbjct: 3071 PSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVD 3130

Query: 575  GVWLKNGKEL--VPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFM 632
              W K+G E+      R K     R+H++ I +   +D  +Y+FV      +++      
Sbjct: 3131 AHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL----- 3185

Query: 633  EVKIDFVPRQEPPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNK 692
                 +V   EPP++  +        + V +G   R    ISG P P + W K       
Sbjct: 3186 -----YVNAPEPPQVLQEL-----QPVTVQSGKPARFCAVISGRPQPKISWYK------- 3228

Query: 693  APARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVT 752
                            +E +      C+      +   ++ ++  +E A  ED  VYT  
Sbjct: 3229 ----------------EEQLLSTGFKCKF-----LHDGQEYTLLLIE-AFPEDAAVYTCE 3266

Query: 753  VKNPVG--EDQVNLTVKVIDV--PDAPA---APKISNVGEDSCTVQWEPPAY----DGGQ 801
             KN  G      +L+V+V +V  PD       P I    +D+ T + +P  +     G  
Sbjct: 3267 AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3326

Query: 802  PILGYILERKKKKSYRWMRL 821
              + +  + KK K  R+ R+
Sbjct: 3327 LKVSWYSKDKKIKPSRFFRM 3346



 Score =  118 bits (295), Expect = 4e-26
 Identities = 86/275 (31%), Positives = 130/275 (47%), Gaps = 7/275 (2%)

Query: 365  FQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTIS 424
            F  KL     V K  +I L  E++  D  VKW K+G+EI  S  KY  ++ G +R L I 
Sbjct: 5293 FTVKLHDKTAVEKD-EITLKCEVSK-DVPVKWFKDGEEIVPS-PKYSIKADGLRRILKIK 5349

Query: 425  QCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQV 484
            +  L D   Y C  G +K    + V+   + + +PL    V VG+   FE E+SE     
Sbjct: 5350 KADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHG 5409

Query: 485  KWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKK 544
            +W   G  LT     +    +DG++H LI++   L   G  +   +  ++ A L V+E  
Sbjct: 5410 QWKLKGQPLTASPDCE--IIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELP 5467

Query: 545  LEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTID 604
            L     ++D+ V  KD+A F+CEVS E     WLK  +E+  D R ++   G  H + I 
Sbjct: 5468 LIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIK 5527

Query: 605  DVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFV 639
                 DEA Y F  E    + S KL    +++ F+
Sbjct: 5528 SAAFEDEAKYMFEAED--KHTSGKLIIEGIRLKFL 5560



 Score =  117 bits (294), Expect = 5e-26
 Identities = 82/248 (33%), Positives = 119/248 (47%), Gaps = 8/248 (3%)

Query: 386  ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCST 445
            E++  +    WLKNG EI+MS  K+     G    L I   S  D A Y  V G ++ S 
Sbjct: 2858 EVSHFNVPSMWLKNGVEIEMS-EKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSA 2916

Query: 446  ELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKK 505
             L V   P++IT  L+D        + FE  V+ EG   KWLK+GVE+   +  + R KK
Sbjct: 2917 TLTVT--PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK 2974

Query: 506  DGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFK 565
                H L I      DA  Y        + A L V+ + +E  + I D+ V  K +A+F+
Sbjct: 2975 --LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFE 3032

Query: 566  CEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNL 625
            CEVS+ ++   W+K+ +EL    RIK+     VH+L I     +D   Y+ V  G   N+
Sbjct: 3033 CEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG---NV 3089

Query: 626  SAKLHFME 633
            S    F+E
Sbjct: 3090 STAKLFVE 3097



 Score =  117 bits (294), Expect = 5e-26
 Identities = 76/266 (28%), Positives = 117/266 (43%), Gaps = 7/266 (2%)

Query: 370  EPAY--QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCS 427
            +P Y  +V  G      +EL++ D   +W   GQ +  S    I E  G K  L +  C 
Sbjct: 5383 KPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIED-GKKHILILHNCQ 5441

Query: 428  LADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWL 487
            L             K +  L VKE P++   PL D  V      +FECEVS E    +WL
Sbjct: 5442 LGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWL 5501

Query: 488  KDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEV 547
            K   E+T ++ F+    KDG +H ++I  A  ED   Y           +LI++  +L+ 
Sbjct: 5502 KGTQEITGDDRFE--LIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKF 5559

Query: 548  YQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVT 607
               + D+    K+ AVF  E+S +N+R  W KN + L     + +   G+ H +T  D++
Sbjct: 5560 LTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLS 5619

Query: 608  PADEADYSFVPEGFACNLSAKLHFME 633
              D +      E    +  AKL  +E
Sbjct: 5620 IDDTSQIRV--EAMGMSSEAKLTVLE 5643



 Score =  115 bits (289), Expect = 2e-25
 Identities = 84/310 (27%), Positives = 138/310 (44%), Gaps = 12/310 (3%)

Query: 360  KKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKR 419
            K+   F ++L+      K        E ++   +VKW K+G E+   G KY   S     
Sbjct: 2125 KQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVH-EGDKYRMHSDRKVH 2183

Query: 420  TLTISQCSLADDAAYQCVVGGE---KCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECE 476
             L+I     +D   Y CV+  +   K + +L V+   V   + L+D  V      E EC 
Sbjct: 2184 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 477  VSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALA 536
            VS E  + KW  + VEL  +   KY       R +L + +   ED G Y+    G +   
Sbjct: 2244 VSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTC 2301

Query: 537  ELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIG 596
            +L ++ + + + Q ++D  V   D    + +VS E+V GVW+K+G+E+ P  R+ +    
Sbjct: 2302 KLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDK 2361

Query: 597  RVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQ-----EPPKIHLDC 651
            + H L I+D+T  D  +YSF       + S ++    V +   P +     E  K  L+C
Sbjct: 2362 QSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV-ITPLKDVNVIEGTKAVLEC 2420

Query: 652  PGRIPDTIVV 661
               +PD   V
Sbjct: 2421 KVSVPDVTSV 2430



 Score =  114 bits (285), Expect = 6e-25
 Identities = 99/408 (24%), Positives = 161/408 (39%), Gaps = 59/408 (14%)

Query: 649   LDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDS 708
             +D P    + +   AG  ++L   ISG PAPT+ W K                       
Sbjct: 20500 IDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKD---------------------- 20537

Query: 709   DEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKV 768
                  DK+L  +T   V VE T D +   ++ A++ + G Y + ++N +G     + V++
Sbjct: 20538 -----DKEL--QTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQI 20590

Query: 769   IDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQ 827
             +D P  P  P +   V  +  T+ W PPA DGG  I  YI+E+++     W  ++ + ++
Sbjct: 20591 LDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVS-EHLE 20649

Query: 828   ELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP-----ASQPFMPIGPPSEPTHLAVEDVS 882
             E      ++I+G  Y  RV AVN  G+  P       A   F+  GPP  P    V  ++
Sbjct: 20650 ECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIP---EVTKIT 20706

Query: 883   DTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLF 942
               ++++ W  P   G   + GY +E   +    W   L+     T   V  L   +   +
Sbjct: 20707 KNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQY 20766

Query: 943   RVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPR 1002
             RV A N AG G     +E     + +  P                G P  + I    K  
Sbjct: 20767 RVCAVNAAGQGPFSEPSEFYKAADPIDPP----------------GPPAKIRIADSTKSS 20810

Query: 1003  PQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT 1046
               + W+K     G  + G  V IR    +    +     V +  Y V+
Sbjct: 20811 ITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVS 20858



 Score =  112 bits (281), Expect = 2e-24
 Identities = 106/428 (24%), Positives = 172/428 (40%), Gaps = 58/428 (13%)

Query: 867   IGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
             IG P+ P   L  +D+   +V + WRPP   G   + GY +E      + W   +     
Sbjct: 23853 IGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYT-IDSRVR 23911

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQK 985
              TS++VK L       FRV A N  G   P+ + EPVT +  L  P  + P +  + +  
Sbjct: 23912 GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPP--EPPSNPPEVLDV 23969

Query: 986   KVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAAR-RVHS 1040
                           K    ++W++     G  + G  +  + + TD   ++R  + ++ +
Sbjct: 23970 T-------------KSSVSLSWSRPKDDGGSRVTGYYIERKETSTDK--WVRHNKTQITT 24014

Query: 1041  GTYQVTVRIENMEDKATLVLQ-------------------VVDKPSPPQDLRVTDAWGLN 1081
               Y VT  + + E +  ++ Q                     DKPS P +L +      +
Sbjct: 24015 TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDS 24074

Query: 1082  VALEWKPPQDVGNTELWGYTVQKADKKTMEWF-TVLEHYRRTHCVVPELIIGNGYYFRVF 1140
             V L+W+ P+  G  E+ GY V+        W  +  E  +     +  L+    Y FRVF
Sbjct: 24075 VTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVF 24134

Query: 1141  SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200
             ++N  G S             RP  T      K L   EAP   + + + +   G  A L
Sbjct: 24135 AENETGLS-------------RPRRTAMSIKTK-LTSGEAPGIRKEMKDVTTKLGEAAQL 24180

Query: 1201  CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
              C + G P P I W++ G +L +  +++M S     TL +      D G+Y C ATN  G
Sbjct: 24181 SCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVG 24240

Query: 1261  EARCECRL 1268
             E     +L
Sbjct: 24241 EVETSSKL 24248



 Score =  112 bits (280), Expect = 2e-24
 Identities = 127/527 (24%), Positives = 203/527 (38%), Gaps = 79/527 (14%)

Query: 769   IDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFD-LIQ 827
             I  P  P  PK+ +   ++  + W  P  DGG PILGY++E +K  + +W R+N D LI+
Sbjct: 11429 IKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIR 11488

Query: 828   ELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPPSEPTHLAVEDVSDT 884
             + +     +IEG  Y  R+ A N +G   P   ++  +    + PP     +   DV   
Sbjct: 11489 QCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITV 11548

Query: 885   TVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI-LVKDLPTGARLLFR 943
              V    R   RV             PE    W    + L     + L++DLP   R+  +
Sbjct: 11549 RVGQTIRILARVKGR----------PEPDITWTKEGKVLVREKRVDLIQDLP---RVELQ 11595

Query: 944   VRAHNMAGPGAPVTTTEPVT-------VQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIP 996
             ++    A  G  + + +  +       +  +L RP                G   NL + 
Sbjct: 11596 IKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRP----------------GPCQNLKVT 11639

Query: 997   FQGKPRPQVTWTKE----GQPLAGEEVSIRNS--------PTDTILFIRAARRVHSGTYQ 1044
                K    ++W       G  +    V  R           +D    +  A  + +  Y 
Sbjct: 11640 NVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIKANLLANNEYY 11699

Query: 1045  VTVRIEN-------MEDKAT-LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               V  EN       +E K   L +  +D+P  P++L + D     V L+W+ P   G + 
Sbjct: 11700 FRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSP 11759

Query: 1097  LWGYTVQKADKKTMEWFTVLE-HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK 1155
                Y V++  K + +W  V +   + TH +V   +    Y FRV ++N  G SD   T +
Sbjct: 11760 NLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESDWVKTEE 11819

Query: 1156  EPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWF 1215
                      +  E      LD   +   T       V AG T  L   VRG P P+++W 
Sbjct: 11820 V--------VVKEDLQKPVLDLKLSGVLT-------VKAGDTIRLEAGVRGKPFPEVAWT 11864

Query: 1216  --KNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
               K+  DL    R ++ ++       + K    DGG YV  ATN  G
Sbjct: 11865 KDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG 11911



 Score =  110 bits (274), Expect = 1e-23
 Identities = 148/625 (23%), Positives = 238/625 (38%), Gaps = 79/625 (12%)

Query: 684   QKAITQGNKAPARPAPDAPEDTGDS-DEWVFDKKLLCETEGRVRVETTKD--------RS 734
             Q  +T+  K  A    + P D G     ++ +K+   ET  +     TKD        R 
Sbjct: 10645 QPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR---ETMSKRWARVTKDPIHPYTKFRV 10701

Query: 735   IFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDV------PDAPAAPKISNVGEDSC 788
                +EG + E    + V+ +N +G    +   K +        P  P  P+  +   +S 
Sbjct: 10702 PDLLEGCQYE----FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSV 10757

Query: 789   TVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNF--DLIQELSHEARRMIEGVVYEMRV 846
              + W+PP +DGG  ILGYI+E +K     W R N   +   E  ++   + +G  Y+ RV
Sbjct: 10758 DLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRV 10817

Query: 847   YAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSV 906
              AVNA G S P+   +P + +    EP  L ++        +K     R+ A       +
Sbjct: 10818 LAVNAAGESDPAHVPEPVL-VKDRLEPPELILDANMAREQHIKVGDTLRLSA------II 10870

Query: 907   EYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQE 966
             +  P     W    +     T   +   P G++L  R  AH   G  + +T   P   + 
Sbjct: 10871 KGVPFPKVTW--KKEDRDAPTKARIDVTPVGSKLEIRNAAHEDGGIYS-LTVENPAGSKT 10927

Query: 967   ILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIR 1022
             +           ++  +  K G P +L +    K    +TW +     G  +    V  R
Sbjct: 10928 V----------SVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERR 10977

Query: 1023  N------SPTDTILFIRA--ARRVHSGT-YQVTVRIENMEDKATLV--------LQVVDK 1065
             +      SP       ++  A+ ++ G  Y   V  EN   +   V        L  +  
Sbjct: 10978 DVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP 11037

Query: 1066  PSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCV 1125
             P PP+DL   D     V+L W  P   G + + GY V+  ++ T +W    +      CV
Sbjct: 11038 PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-FKTVTNLECV 11096

Query: 1126  VPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQ 1185
             V  L  G  Y FRV ++N+VG       T  P+      +   PP+ + LD        +
Sbjct: 11097 VTGLQQGKTYRFRVKAENIVGLG--LPDTTIPIECQEKLV---PPSVE-LDV----KLIE 11146

Query: 1186  PLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCP 1245
              LV   V AG T      +RG P P   W  +G ++  D  + + +      L I+    
Sbjct: 11147 GLV---VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLR 11203

Query: 1246  FDGGIYVCRATNLQGEARCECRLEV 1270
              D G Y    +N  G       L V
Sbjct: 11204 RDTGEYQITVSNAAGSKTVAVHLTV 11228



 Score =  109 bits (272), Expect = 2e-23
 Identities = 185/803 (23%), Positives = 284/803 (35%), Gaps = 153/803 (19%)

Query: 542   EKKLEVYQSIADLMVGAKDQAVFK-CEVSDENVRGVWLKN--GKELVPDSRIKVSHIGRV 598
             +K+L++ + ++    G +  AV K C+ SD     + +KN  G + V      +   G  
Sbjct: 22713 DKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPC 22772

Query: 599   HKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIH-LDCPGRIPD 657
              KLT+  VT              A +L  +    E+    V R+E  +++ +   G  P 
Sbjct: 22773 GKLTVSRVTQEKCT--------LAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPT 22824

Query: 658   TIVVV--------------AGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
                VV              A NK    VP+  +P         I   N       P  PE
Sbjct: 22825 LSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEP---------IVARNSFTIPSPPGIPE 22875

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVET----------------TKDRSIFT--------VE 739
             + G   E +  +    E++G   +                   KD  ++         +E
Sbjct: 22876 EVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLME 22935

Query: 740   GAEKEDEGVYTVTVKNPVGEDQVNLTVKVID------VPDAPAAPKISNVGEDSCTVQWE 793
             G + +    + VT  N  G  + +     I        P  P+AP++ +  + S ++ W 
Sbjct: 22936 GCDYQ----FRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWT 22991

Query: 794   PPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYAVNAI 852
              P YDGG  I+GY+LE ++K + +W R++ +  I+        +  G  Y  RV AVN  
Sbjct: 22992 KPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVK 23051

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT-----------VSLKWRPPERVGAGGL 901
             GMS  S +     P+     P     +D+  T            VS+  RPP        
Sbjct: 23052 GMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPP------- 23104

Query: 902   DGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARL-LFRVRAHNMAGPGAPVTTTE 960
                 + +  +G      A+   TE  S+L+ D         + + A N +G  +     +
Sbjct: 23105 ---VITWSKQGIDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVK 23161

Query: 961   PVTVQEILQRPRLQLPRHLRQTIQKKV-----GEPVNLLIPFQGKPRPQVTWTKEGQPLA 1015
                        +++       TI  ++     G PVN  I  +          +E    A
Sbjct: 23162 VYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEK----------REAAMRA 23211

Query: 1016  GEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM--------EDKATLVLQVVDKPS 1067
              + V+ + S T      R +  V    Y   V  EN+           A LV +V   P 
Sbjct: 23212 FKTVTTKCSKT----LYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEV---PL 23264

Query: 1068  PPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWF-------TVLEHYR 1120
              P  L V D     V L W+ P   G + L GY ++     T  W        TVLEH  
Sbjct: 23265 VPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEH-- 23322

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEA 1180
                  V  L  G  Y FR+ +QN  G S+           PR  +T         D    
Sbjct: 23323 ----TVTSLNEGEQYLFRIRAQNEKGVSE-----------PRETVTA----VTVQDLRVL 23363

Query: 1181  PSF---TQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             P+    T P     V AG    L   + G P P  SWF  G  L E  R  + +   V  
Sbjct: 23364 PTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAK 23423

Query: 1238  LEIRKPCPFDGGIYVCRATNLQG 1260
             L IR+    D G Y     N+ G
Sbjct: 23424 LTIRETTIRDTGEYTLELKNVTG 23446



 Score =  108 bits (270), Expect = 3e-23
 Identities = 83/275 (30%), Positives = 134/275 (48%), Gaps = 11/275 (4%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            ++ +G K      ++     V+W ++ + ++ SG KY   + G KR L +   +L D   
Sbjct: 6190 EILEGEKAEFVCSISKESFPVQWKRDDKTLE-SGDKYDVIADGKKRVLVVKDATLQDMGT 6248

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
            Y  +VG  + +  L V E  + I  PL+D  V   Q V F CEV+ EGA+ KW ++  E 
Sbjct: 6249 YVVMVGAARAAAHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRN--EE 6305

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHY--ALCTSGGQ---ALAELIVQEKKLEVY 548
               ++ KY   +    + L I +A L+D  +Y  +L    G+   + A LIV+E+ L + 
Sbjct: 6306 AIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIV 6365

Query: 549  QSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTP 608
            + + D+    K    F C+V+  NV   W KNG+E+  D+R+        H LTI D   
Sbjct: 6366 EPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGF 6425

Query: 609  ADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQE 643
             DE +Y  V  G   ++ A+L  +E   +FV   E
Sbjct: 6426 PDEGEY-IVTAGQDKSV-AELLIIEAPTEFVEHLE 6458



 Score =  107 bits (268), Expect = 6e-23
 Identities = 72/235 (30%), Positives = 117/235 (49%), Gaps = 8/235 (3%)

Query: 384  TVELADHDAE-VKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEK 442
            TVEL   + + V+W+KNG  ++ S  KY     G   +L I  C++ D++ Y   +G   
Sbjct: 2681 TVELTHPNVKGVQWIKNGVVLE-SNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2739

Query: 443  CSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYR 502
             S  L V+   V I +  +D   +    V FE  VS +   VKW    VE+   +  K+R
Sbjct: 2740 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSD--KHR 2795

Query: 503  FKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQA 562
               + + H L++      DAG Y       +  A+L V+   L + +++ ++ V     A
Sbjct: 2796 LVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVET--LHITKTMKNIEVPETKTA 2853

Query: 563  VFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFV 617
             F+CEVS  NV  +WLKNG E+    + K+   G++H+L I + +  D A+Y+FV
Sbjct: 2854 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV 2908



 Score =  107 bits (268), Expect = 6e-23
 Identities = 98/412 (23%), Positives = 161/412 (39%), Gaps = 41/412 (9%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P ++   DV+   +++ W+PP+  G   +  Y VE        W     G ++ T
Sbjct: 11233 GPPTGPINIL--DVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSK-T 11289

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
              + +  L  G   +FRVRA N  G G P+ +T  V       + +   P    + +   +
Sbjct: 11290 KLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVA------KHKFSPPSPPGKPVVTDI 11343

Query: 988   GE---PVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQ 1044
              E    V+  +P      P   +  E + + G+ V +  +P   + F R        TY+
Sbjct: 11344 TENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKF-RVTGLYEGNTYE 11402

Query: 1045  VTVRIENM--------EDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTE 1096
               V  EN+                + +  P PP + ++ D       L W  P   G + 
Sbjct: 11403 FRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSP 11462

Query: 1097  LWGYTVQKADKKTMEWFTVLEHYRRTHCV--VPELIIGNGYYFRVFSQNMVGFSDRAATT 1154
             + GY V+     T +W  + +      C   VP LI GN Y FR+ + N+VG  +     
Sbjct: 11463 ILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELA 11522

Query: 1155  KEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIA---GYTAMLCCAVRGSPKPK 1211
             +  +               A D    P     +  R VI    G T  +   V+G P+P 
Sbjct: 11523 ESVI---------------AKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPD 11567

Query: 1212  ISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             I+W K G  L  + R  +      + L+I++    D G Y+  A N  G A+
Sbjct: 11568 ITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 11619



 Score =  106 bits (265), Expect = 1e-22
 Identities = 124/571 (21%), Positives = 216/571 (37%), Gaps = 99/571 (17%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLT---VKVIDV---PDAPAAPKISNVGEDSCT 789
             + V G  +  E  + +  +N  G    + T    K  D    P  P  P++ +    S +
Sbjct: 15342 YKVSGLTEGHEYEFRIMAENAAGISAPSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSIS 15401

Query: 790   VQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYA 848
             + W  P YDGG  I GY++E    +   W  +     ++  S+    + E   Y++R+YA
Sbjct: 15402 IAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYA 15461

Query: 849   VNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT----------------VSLKWRP 892
             +N+ G+  P+      +P  P +E   L  E   D                  V +K RP
Sbjct: 15462 MNSEGLGEPA-----LVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRP 15516

Query: 893   PERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGP 952
                V      G S++          A+++  + +T ++V ++       + +   N +G 
Sbjct: 15517 APEVKWARDHGESLDK---------ASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGS 15567

Query: 953   GAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQ 1012
              +            +L  P                G P +L +    K    +TW     
Sbjct: 15568 KSAFVNVR------VLDTP----------------GPPQDLKVKEVTKTSVTLTWDP--- 15602

Query: 1013  PLAGEEVSIRNSPTDTILFIRAA-RRVHSGTYQVTVRIENMEDKATLVLQVV-------- 1063
             PL      I+N   +     R A   V +  ++ + +++ +++  +   +V+        
Sbjct: 15603 PLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIG 15662

Query: 1064  ------------DKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTME 1111
                         ++P PP  + + D    +V+L W+ P+  G + + GY V+   K + +
Sbjct: 15663 LPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDK 15722

Query: 1112  WFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPN 1171
             W T     + T   +  LI G  Y FRV +QN  G SD       P  +  P I      
Sbjct: 15723 WATCAT-VKVTEATITGLIQGEEYSFRVSAQNEKGISD-------PRQLSVPVI------ 15768

Query: 1172  YKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFS 1231
               A D    P+F       +V+AG    +     G P P ++W K+ + L +  R    S
Sbjct: 15769 --AKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAES 15826

Query: 1232  KQGVLTLEIRKPCPFDGGIYVCRATNLQGEA 1262
              +    L I+  C  D G YV + TN  GEA
Sbjct: 15827 TENNSLLTIKDACREDVGHYVVKLTNSAGEA 15857



 Score =  105 bits (263), Expect = 2e-22
 Identities = 87/330 (26%), Positives = 141/330 (42%), Gaps = 40/330 (12%)

Query: 644  PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
            PP I L    R  DTI V AG  + +   ++G P P + W K     N+       DA +
Sbjct: 9022 PPTIKLRLSVR-GDTIKVKAGEPVHIPADVTGLPMPKIEWSK-----NETVIEKPTDALQ 9075

Query: 704  DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
             T +                   V  ++ ++  ++  A +ED+G YTVT  N +G    N
Sbjct: 9076 ITKEE------------------VSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRN 9117

Query: 764  LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERK--KKKSYRWMRL 821
            + V+V D P  P    ++++  +SC + W+ P  +GG  I  Y+++++   +K   W  +
Sbjct: 9118 VHVEVYDRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEV 9177

Query: 822  NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQ-----PFMPIGPPSEPTHL 876
                + E  +   ++I    YE RV AVN  G+S    + +     P+   GPP +P  L
Sbjct: 9178 TNTAV-EKRYGIWKLIPNGQYEFRVRAVNKYGISDECKSDKVVIQDPYRLPGPPGKPKVL 9236

Query: 877  AVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSIL-----V 931
            A    +  ++ + W PP   G   + GY +E   EG   W    +       +      V
Sbjct: 9237 A---RTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGLKGVEFNV 9293

Query: 932  KDLPTGARLLFRVRAHNMAGPGAPVTTTEP 961
              L  G +  FR  A N AG G P   ++P
Sbjct: 9294 PRLLEGVKYQFRAMAINAAGIGPPSEPSDP 9323



 Score =  105 bits (263), Expect = 2e-22
 Identities = 85/322 (26%), Positives = 132/322 (40%), Gaps = 40/322 (12%)

Query: 657   DTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKK 716
             D +++ +G  LR+   + G P P V W K    G                          
Sbjct: 21594 DGLIIKSGESLRIKALVQGRPVPRVTWFK---DG-------------------------- 21624

Query: 717   LLCETEGRVRVETTK---DRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPD 773
                E E R+ +E T      S+F V  A ++  GVYTV  KN  G  +  + VKV D P 
Sbjct: 21625 --VEIEKRMNMEITDVLGSTSLF-VRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPG 21681

Query: 774   APAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHE 832
                 P + +N+  +  T+ W+ P  DG  PI  YI+E+++     W  +  D  +  S+ 
Sbjct: 21682 KVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYT 21740

Query: 833   ARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPI--GPPSEPTHLAVEDVSDTTVSLKW 890
             A ++I G  Y+ RV AVN  G+ RP  +      I    P  P      +++  +++L W
Sbjct: 21741 AIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTW 21800

Query: 891   RPPERVGAGGLDGYSVEYCPEGCSEWVAAL-QGLTEHTSILVKDLPTGARLLFRVRAHNM 949
               PE  G   +  Y +E   +  + WV  + +     T   V  L  G    F V A N 
Sbjct: 21801 ARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENA 21860

Query: 950   AGPGAPVTTTEPVTVQEILQRP 971
             AG G     +  +  +E +  P
Sbjct: 21861 AGVGPASGISRLIKCREPVNPP 21882



 Score =  105 bits (261), Expect = 4e-22
 Identities = 130/548 (23%), Positives = 207/548 (37%), Gaps = 57/548 (10%)

Query: 738   VEGAEKEDEGVYTVTVKNPVGEDQ---VNLTVKVIDV---PDAPAAPKISNVGEDSCTVQ 791
             V G  ++ E  + V+ +N  G  +     +  K  D    P  P    I +  ++S T+ 
Sbjct: 17508 VTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLA 17567

Query: 792   WEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELSHEARRMIEGVVYEMRVYAVN 850
             W  P YDGG  ILGY++E  K     W  +     ++    E  ++ E   Y++RV A+N
Sbjct: 17568 WGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALN 17627

Query: 851   AIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCP 910
              +G+   +       P      P         +  +  + R    V AGG     + +  
Sbjct: 17628 KVGLGEATSVPGTVKPEDKLEAP---------ELDLDSELRKGIVVRAGGSARIHIPFKG 17678

Query: 911   EGCSE--WVAALQGLTE---------HTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTT 959
                 E  W       T+         +T + + +        + ++  N +G  +   T 
Sbjct: 17679 RPTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVT- 17737

Query: 960   EPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEV 1019
               V V +    P+    + +R+     V EP   +I    K +  V   +E    A   V
Sbjct: 17738 --VKVLDTPGPPQNLAVKEVRKDSAFLVWEPP--IIDGGAKVKNYVIDKRESTRKAYANV 17793

Query: 1020  SIRNSPTDTILFIRAARRVHSGTYQVTVRIEN-----MEDKATLVLQVVDKPSPPQDLRV 1074
             S + S T      +         Y   V  EN     +  +    ++  + PSPP  + +
Sbjct: 17794 SSKCSKTS----FKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTL 17849

Query: 1075  TDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNG 1134
             TD    + +L W+ P+  G + + GY V+   K T +W  V E  +  + VV  L  G  
Sbjct: 17850 TDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAVVTGLSSGQE 17908

Query: 1135  YYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIA 1194
             Y FRV + N  G SD       P  +  P I        A D +  PS   P    S+ A
Sbjct: 17909 YQFRVKAYNEKGKSD-------PRVLGVPVI--------AKDLTIQPSLKLPFNTYSIQA 17953

Query: 1195  GYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCR 1254
             G    +   V G P+P ISW K+G  L +  R  +        L I++    D G Y   
Sbjct: 17954 GEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVT 18013

Query: 1255  ATNLQGEA 1262
             ATN  G A
Sbjct: 18014 ATNSAGTA 18021



 Score =  104 bits (260), Expect = 5e-22
 Identities = 129/579 (22%), Positives = 235/579 (40%), Gaps = 81/579 (13%)

Query: 725   VRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVG 784
             + V   K++S+       K ++G+       P+   ++ +T +V D+ D P A     +G
Sbjct: 21148 IEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEV-DLSDIPGAQVTVRIG 21206

Query: 785   EDSCTVQWEPPAYDGGQPILGYI---LERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV 841
              +   V  E P     +P + ++   L  K+ +  R+ +    +   + + A++   G  
Sbjct: 21207 HN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKN-AKKEHGGKY 21262

Query: 842   YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGG 900
               +   AV  I +    P +   + +GPPS+P   +  +++   +V L W  PE  G G 
Sbjct: 21263 TVILDNAVCRIAV----PIT--VITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGE 21316

Query: 901   LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE 960
             +  YS+E      + W      +   T+  V +L   A   FRVRA N  G       ++
Sbjct: 21317 ITCYSIEKRETSQTNWKMVCSSVAR-TTFKVPNLVKDAEYQFRVRAENRYG------VSQ 21369

Query: 961   PVTVQEILQRPRLQLPRHL-RQTIQKKVGEPVNLL--------------IPFQGKPRPQV 1005
             P+    I+ + + ++P    +  I     + ++L                  + K R  +
Sbjct: 21370 PLVSSIIVAKHQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSI 21429

Query: 1006  TWTKEG-QPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENME--------DKA 1056
              W K    P++G E              RA   V    YQ  V  EN           K 
Sbjct: 21430 LWQKVNTSPISGREY-------------RATGLVEGLDYQFRVYAENSAGLSSPSDPSKF 21476

Query: 1057  TLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEW---- 1112
             TL +  VD P  P  + VT      + L+W PP   G +++ GY+++K       W    
Sbjct: 21477 TLAVSPVDPPGTPDYIDVTRE---TITLKWNPPLRDGGSKIVGYSIEKRQGNE-RWVRCN 21532

Query: 1113  FTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNY 1172
             FT +   + T   V  L  G+ Y FR+ ++N VG     + +   +      +   PP  
Sbjct: 21533 FTDVSECQYT---VTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENV---PP-- 21584

Query: 1173  KALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSK 1232
               ++F   P +   L+ +S   G +  +   V+G P P+++WFK+G+++ +     +   
Sbjct: 21585 -IVEFG--PEYFDGLIIKS---GESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDV 21638

Query: 1233  QGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVR 1271
              G  +L +R       G+Y   A N  G A+ E +++V+
Sbjct: 21639 LGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21677



 Score =  103 bits (257), Expect = 1e-21
 Identities = 124/529 (23%), Positives = 187/529 (35%), Gaps = 95/529 (17%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  PA PK+ +    S ++ W  PAYDGG PI+GY++E K+  S  W+R N    +Q+  
Sbjct: 13217 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13276

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTT----- 885
              E   ++E   Y+ RVYAVN IG S PS       P      P      D+  T      
Sbjct: 13277 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13336

Query: 886   ------VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
                   V +K RPP ++                   W      L +   + +K   T   
Sbjct: 13337 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKS--TDFD 13376

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV----GEPVNLLI 995
                R    N    G  + T E    ++               TI  KV    G PVN+ +
Sbjct: 13377 TFLRCENVNKYDAGKYILTLENSCGKK-------------EYTIVVKVLDTPGPPVNVTV 13423

Query: 996   PFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN 1051
                 K    VTW       G P+    V  R++        ++   V +   + + R+ N
Sbjct: 13424 KEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAER------KSWSTVTTECSKTSFRVAN 13477

Query: 1052  MEDKATLVLQVVDK--------------------PSPPQDLRVTDAWGLNVALEWKPPQD 1091
             +E+  +   +V  +                    P P  DL+V      + ++ WK P  
Sbjct: 13478 LEEGKSYFFRVFAENEYGIGDPGETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHS 13537

Query: 1092  VGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRA 1151
              G + + GY V    ++  +W  V++     +    +L  G  Y FRV ++N  G     
Sbjct: 13538 DGGSRIIGYVVDFLTEEN-KWQRVMKSLSLQYSA-KDLTEGKEYTFRVSAENENG----E 13591

Query: 1152  ATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPK 1211
              T  E   + R  +         LD    P         S        L   ++G P P 
Sbjct: 13592 GTPSEITVVARDDVVAPD-----LDLKGLPDLCYLAKENS-----NFRLKIPIKGKPAPS 13641

Query: 1212  ISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             +SW K    L  D R  + S     TL +      D G Y     N+ G
Sbjct: 13642 VSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 13690



 Score =  102 bits (255), Expect = 2e-21
 Identities = 114/505 (22%), Positives = 205/505 (40%), Gaps = 45/505 (8%)

Query: 704  DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
            D G   E    + L   T+  VRV      +   + G  +  E  + V   N  GE + +
Sbjct: 7638 DGGAKIESYVIEMLKTGTDEWVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPS 7697

Query: 764  ------LTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYR 817
                  L  + +  P  P   ++ N+ +++  ++W  P  DGG PI  YI+E++  +   
Sbjct: 7698 EPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKG 7757

Query: 818  WMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPPSEPT 874
            W  ++   +++       + EG +Y  RV A NAIG S  +      +       P  P 
Sbjct: 7758 WQTVD-TTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTPGPPY 7816

Query: 875  HLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDL 934
             LAV DV+   V LKW PP+  G   +  Y +E      + WV A +      +  V D+
Sbjct: 7817 ALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDV 7876

Query: 935  PTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLL 994
              G  + F+VRA N AG G P   TE +++++    P   L  H+    +K +   +   
Sbjct: 7877 IEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIA--IAWK 7934

Query: 995  IPFQGKPRPQVTWTKEGQPLAGEE-VSIRNSPTDTILFIRAARRVHSGTYQVTVRIEN-- 1051
             P +    P + +  E  P+  E+ + + + P   + F      V    Y + VR  N  
Sbjct: 7935 PPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAI 7994

Query: 1052 -MEDKATLVLQVVDKPS--------PPQDLRVTDAWGLNVALEWKP-PQDVGNTELWGYT 1101
             + + + +   VV K             D+ V +   L++ + ++  P    +    G  
Sbjct: 7995 GVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKE 8054

Query: 1102 VQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP 1161
            V+ +D+ TM+       +   H  VP+ +  +   + +  +N +G S  A+   + + +P
Sbjct: 8055 VKASDRLTMK-----NDHISAHLEVPKSVRADAGIYTITLENKLG-SATASINVKVIGLP 8108

Query: 1162 RP--------------GITYEPPNY 1172
             P               +T+EPP +
Sbjct: 8109 GPCKDIKASDITKSSCKLTWEPPEF 8133



 Score =  102 bits (255), Expect = 2e-21
 Identities = 86/332 (25%), Positives = 131/332 (39%), Gaps = 39/332 (11%)

Query: 644   PPKIHLDCPGRIPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPE 703
             PP +HLD      D + +  G    L    SG P P V W K                  
Sbjct: 10445 PPTLHLD----FRDKLTIRVGEAFALTGRYSGKPKPKVSWFK------------------ 10482

Query: 704   DTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVN 763
             D  D  E           + R  ++TT          A++ D G Y V V+N  G  +  
Sbjct: 10483 DEADVLE-----------DDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGF 10531

Query: 764   LTVKVIDVPDAPAAP-KISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLN 822
               V V+D P  P  P     V +D   + W+PP  DGG  I  YI+E+K+     WM + 
Sbjct: 10532 CQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVT 10591

Query: 823   FDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRP--SPASQPFMPIGPPSEPTHLAVED 880
                  + + +  +++EG  Y  R++A N  G+S P  S + +       P  P    V +
Sbjct: 10592 -SASAKTTCKVSKLLEGKDYIFRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTE 10650

Query: 881   VSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQG-LTEHTSILVKDLPTGAR 939
             V+  +  + W  P   G   +  Y +E        W    +  +  +T   V DL  G +
Sbjct: 10651 VTKDSALVTWNKPHD-GGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQ 10709

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRP 971
               FRV A N  G G P   ++PV  ++ + +P
Sbjct: 10710 YEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 10741



 Score =  102 bits (253), Expect = 3e-21
 Identities = 150/635 (23%), Positives = 235/635 (37%), Gaps = 110/635 (17%)

Query: 680   TVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVE 739
             TV+W           +RP  D   D         DKK L     +V  ET +D     V 
Sbjct: 20711 TVVW-----------SRPIADGGSDISGYFLEKRDKKSLGWF--KVLKETIRDTRQ-KVT 20756

Query: 740   GAEKEDEGVYTVTVKNPVGE------DQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWE 793
             G  +  +  Y V   N  G+       +       ID P  PA  +I++  + S T+ W 
Sbjct: 20757 GLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWS 20816

Query: 794   PPAYDGGQPILGYILERKKKKSYRWMRLNFD-LIQELSHEARRMIEGVVYEMRVYAVNAI 852
              P YDGG  + GY++E ++ +   W  ++    ++   +    +  GV Y  RV AVN  
Sbjct: 20817 KPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCA 20876

Query: 853   GMSRPSPASQPFMP---IGPPSEPTHLAV---------EDVSDTTVSLKWRPPERV---- 896
             G   P   ++P      +  P     +A+         EDV    +  K RPP  V    
Sbjct: 20877 GQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQ-VLIPFKGRPPPTVTWRK 20935

Query: 897   ---GAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSIL----VKDLPTGARLLFRVRAHNM 949
                  G    YS+E                T+ +S+L    V    TG  +L        
Sbjct: 20936 DEKNLGSDARYSIEN---------------TDSSSLLTIPQVTRNDTGKYILTIEN---- 20976

Query: 950   AGPGAPVTTTEPVTVQEILQRP----RLQLPRHLRQTIQKKVGEP--------VNLLIPF 997
              G G P ++T  V   ++L  P    +LQ+    R T+      P        +N +I  
Sbjct: 20977 -GVGEPKSSTVSV---KVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI-- 21030

Query: 998   QGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKAT 1057
             + +   + TW+      +     + +    T  F R       G  +          + T
Sbjct: 21031 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPC--------ETT 21082

Query: 1058  LVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLE 1117
               ++  + P+P +DL + D+   +V L W  P   G + +  Y V++  K    W +   
Sbjct: 21083 EPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW-SHAG 21141

Query: 1118  HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDF 1177
               +     V +L   +   FRVF++N  G SD    T  P+ +    IT E      +D 
Sbjct: 21142 ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSD--PVTIGPITVKELIITPE------VDL 21193

Query: 1178  SEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLT 1237
             S+ P         +V  G+   L    +G PKP ISW K+GL L E    R    +  +T
Sbjct: 21194 SDIPG-----AQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT 21248

Query: 1238  LEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272
             L I+      GG Y     N        CR+ V +
Sbjct: 21249 LSIKNAKKEHGGKYTVILDN------AVCRIAVPI 21277



 Score =  101 bits (252), Expect = 4e-21
 Identities = 134/560 (23%), Positives = 208/560 (37%), Gaps = 74/560 (13%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPP 795
             +TV+G ++ D   Y V+  N VG+ + +   K I   D  A P +     D  T++    
Sbjct: 10404 YTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRV--- 10460

Query: 796   AYDGGQPILGYILERKKKKSYRWMRLNFDLIQE-LSH-------------EARRMIEG-- 839
                G    L      K K    W +   D++++  +H             +A+R   G  
Sbjct: 10461 ---GEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKY 10517

Query: 840   -VVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGA 898
              VV E    +    G  + +   +P  P+GP S       ++V+   + + W+PP   G 
Sbjct: 10518 CVVVENSTGSRK--GFCQVNVVDRPGPPVGPVS------FDEVTKDYMVISWKPPLDDGG 10569

Query: 899   GGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTT 958
               +  Y +E    G   W+       + T+  V  L  G   +FR+ A N+ G       
Sbjct: 10570 SKITNYIIEKKEVGKDVWMPVTSASAK-TTCKVSKLLEGKDYIFRIHAENLYG------I 10622

Query: 959   TEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI---PFQG-KPRPQVTWTKEGQPL 1014
             ++P+    +  + R ++P    Q I  +V +   L+    P  G KP       K  + +
Sbjct: 10623 SDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGGKPITNYILEKR-ETM 10681

Query: 1015  AGEEVSIRNSPTDTILFIRAARRVHSGTYQVTVRIENM--------EDKATLVLQVVDKP 1066
             +     +   P       R    +    Y+  V  EN           K       + KP
Sbjct: 10682 SKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKP 10741

Query: 1067  SPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVL---EHYRRTH 1123
             SPP +    D    +V L W+PP+  G +++ GY V+       EW       E    T 
Sbjct: 10742 SPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPETK 10801

Query: 1124  CVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGIT---YEPPNYKALDFSEA 1180
               V  L  G  Y FRV + N  G SD       P  +P P +     EPP    LD + A
Sbjct: 10802 YKVTGLRDGQTYKFRVLAVNAAGESD-------PAHVPEPVLVKDRLEPPEL-ILDANMA 10853

Query: 1181  PSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEI 1240
                      + +  G T  L   ++G P PK++W K   D    AR  +        LEI
Sbjct: 10854 RE-------QHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEI 10904

Query: 1241  RKPCPFDGGIYVCRATNLQG 1260
             R     DGGIY     N  G
Sbjct: 10905 RNAAHEDGGIYSLTVENPAG 10924



 Score =  101 bits (251), Expect = 5e-21
 Identities = 79/286 (27%), Positives = 133/286 (46%), Gaps = 11/286 (3%)

Query: 359  EKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAK 418
            E+    F K LE    V KG  + L+ EL + + +V W K+G+ +     + +   IG  
Sbjct: 4836 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 4894

Query: 419  RTLTISQCSLADDAAYQCVVGGE---KCSTELFVKEPPVL---ITRPLEDQLVMVGQRVE 472
            R LTI+     D   Y   V      +CS+   VK   V+   + +P+ DQ V       
Sbjct: 4895 RALTINDADDTDAGTYTVTVENANNLECSS--CVKVVEVIRDWLVKPIRDQHVKPKGTAI 4952

Query: 473  FECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGG 532
            F C+++++   +KW K   E+  E   K    +DG   +L I  AM ED   YA+   G 
Sbjct: 4953 FACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGK 5012

Query: 533  QALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKV 592
            +  A+L + E+++E+ + I D+ +  K+ A F  E+S+ ++ G W   G+ L P    ++
Sbjct: 5013 RYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEI 5072

Query: 593  SHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDF 638
               G    LT+  V   D+A    + +      +A L   E+++DF
Sbjct: 5073 KAEGGKRFLTLHKV-KLDQAG-EVLYQALNAITTAILTVKEIELDF 5116



 Score =  101 bits (251), Expect = 5e-21
 Identities = 142/653 (21%), Positives = 242/653 (37%), Gaps = 78/653 (11%)

Query: 661   VVAGNKLRLDVPISGDP-----------APTVIWQKAITQGNKAPARPAPDAPEDTGDSD 709
             ++A NK  +  P+  +P           AP      ++T+ +       P+    +  + 
Sbjct: 9919  IMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG 9978

Query: 710   EWVFDKKLLCETEGRVRVETTKDRSI---FTVEGAEKEDEGVYTVTVKNPVGEDQVNL-- 764
              W+  K    +   RV  +  K  ++   + V G  +  +  + V   N  G    +L  
Sbjct: 9979  YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPS 10038

Query: 765   ---TVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRL 821
                T +    P  P  PK+++  + S  ++W PP  DGG  + GYI+E K++    W + 
Sbjct: 10039 DPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKG 10098

Query: 822   NFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDV 881
                 ++        + EG  Y+ RV AVN  G+  P   +           P       V
Sbjct: 10099 KDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASV 10158

Query: 882   SDTTVSLKWRPPERVGAGGLDGYS--VEYCPEGCSEW---------VAALQGLTEHTSIL 930
              D  V         V AGG+      V   P     W          A ++     +S++
Sbjct: 10159 RDRIV---------VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMV 10209

Query: 931   VKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV--- 987
             +K+     + ++ + A N AG        + + V   +  P L    +L     K     
Sbjct: 10210 IKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLA--HNLTNESCKLTWFS 10267

Query: 988   -----GEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGT 1042
                  G P+   +  + +   +  WT     +  +  +++        F R A     G 
Sbjct: 10268 PEDDGGSPITNYV-IEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGM 10326

Query: 1043  YQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTV 1102
                   +E  E  A ++ + +  P  P+DL V +     V L W PP+  G +E+  Y +
Sbjct: 10327 GPF---VETSE--ALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVL 10381

Query: 1103  QKADKKTMEWFTVL-EHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIP 1161
             +     T ++  V  ++       V  L  G+ Y +RV + N+VG         +P F  
Sbjct: 10382 ESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQG-------KPSFCT 10434

Query: 1162  RPGITYE----PPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKN 1217
             +P IT +    PP    LDF +           ++  G    L     G PKPK+SWFK+
Sbjct: 10435 KP-ITCKDELAPPTLH-LDFRD---------KLTIRVGEAFALTGRYSGKPKPKVSWFKD 10483

Query: 1218  GLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
               D+ ED R  + +    L LE  K    D G Y     N  G  +  C++ V
Sbjct: 10484 EADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 10536



 Score =  100 bits (250), Expect = 7e-21
 Identities = 118/495 (23%), Positives = 197/495 (39%), Gaps = 46/495 (9%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVG---EDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQW 792
             F   G E+  E  + V+ +N VG     +V+      D  D P  P+   V  +S T+QW
Sbjct: 16028 FKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQW 16087

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
             + P YDGG  I GYI+E+K+    RWM+ +F  I +   E   ++E   YE RV A NA 
Sbjct: 16088 KKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAA 16147

Query: 853   GMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEG 912
             G+      S   +      +P  ++++     T+ +      +V A   D Y     P  
Sbjct: 16148 GVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDA---DIYGK---PIP 16201

Query: 913   CSEWVAALQGLTEHTSILVKDLPTGARL----LFRVRAHNMAGPGAPVTTTEPVTVQ-EI 967
               +W+   Q L+    + +K       L      RV + N       V     VTV  ++
Sbjct: 16202 TIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 16261

Query: 968   LQRPRLQLPRHLRQTIQKKVGEPVNLL--IPFQGKPRPQVTWTKEGQPLAGEEVSIRNSP 1025
             L RP    P      I     E   L    P Q      + +  E +  +    ++ ++ 
Sbjct: 16262 LDRPG---PPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDAN 16318

Query: 1026  TDTILFIRAARRVHSGTYQVTVRIEN-------MEDKATLVLQVVDKPSPPQDLRVTDAW 1078
               T L  +  + +    Y   +   N       +E +  +       P  P+   VT   
Sbjct: 16319 VQT-LSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVT 16377

Query: 1079  GLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYR---RTHCVVPELIIGNGY 1135
               ++ + W+ P   G +E+ GY ++K DK+ + W     H R        V  LI  + Y
Sbjct: 16378 KDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRC--HKRLIGELRLRVTGLIENHDY 16435

Query: 1136  YFRVFSQNMVGFSDRAATTK-----EPVFIPRPGITYEPPNYKALDFSEAP---SFTQPL 1187
              FRV ++N  G S+ +  +      +P++ P P     P N K +D + +    S+++P+
Sbjct: 16436 EFRVSAENAAGLSEPSPPSAYQKACDPIYKPGP-----PNNPKVIDITRSSVFLSWSKPI 16490

Query: 1188  VNRSV-IAGYTAMLC 1201
              +    I GY    C
Sbjct: 16491 YDGGCEIQGYIVEKC 16505



 Score =  100 bits (248), Expect = 1e-20
 Identities = 107/487 (21%), Positives = 186/487 (38%), Gaps = 42/487 (8%)

Query: 800   GQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSP 859
             G+P+    L R        MR N ++  E  +    + E V  +   Y + A   S  + 
Sbjct: 20130 GKPLPKVTLSRDGVPLKATMRFNTEITAE--NLTINLKESVTADAGRYEITAANSSGTTK 20187

Query: 860   ASQPFMPIGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVA 918
             A    + +  P  PT  + + D+++ +V+LKW PP+  G   +  Y +       + W  
Sbjct: 20188 AFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTE 20247

Query: 919   ALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG-----PGAPVTTTEPVTVQEILQRPRL 973
              +      T + V  L TG    FR++A N  G       A VT   P T       P  
Sbjct: 20248 -VSATVARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTP-- 20304

Query: 974   QLPRHLRQTIQKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTD 1027
              +    R++I     EPV+      +    + K R  + W K        ++ IR +   
Sbjct: 20305 WVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK------ANKLVIRTTHFK 20358

Query: 1028  TILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWK 1087
              +  I A        Y             +  +  +D   PP+++R+TD    +V+L W+
Sbjct: 20359 -VTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQ 20417

Query: 1088  PPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVG 1146
              P   G +++ GY V++ D     W      +   T  ++  L   + Y FRVF++N VG
Sbjct: 20418 QPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVG 20477

Query: 1147  FSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCA 1203
                  +    P+                +D    P    PL    V+   AG +  L   
Sbjct: 20478 SISNPSEVVGPI--------------TCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAG 20523

Query: 1204  VRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             + G P P I W+K+  +L  +A   + +   + ++ I+     + G Y  +  N  G A 
Sbjct: 20524 ISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSAS 20583

Query: 1264  CECRLEV 1270
                R+++
Sbjct: 20584 ATIRVQI 20590



 Score = 99.4 bits (246), Expect = 2e-20
 Identities = 77/249 (30%), Positives = 111/249 (44%), Gaps = 13/249 (5%)

Query: 391  DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCV---VGGEKCSTEL 447
            D E +W KNG +I+ S   Y +        L I   +  D A+       + GE  S   
Sbjct: 2060 DPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAF 2119

Query: 448  FVKEPPVLITRPLEDQLVMVGQR---VEFECEVSEEGAQVKWLKDGVELTREETFKYRFK 504
             + +   LIT   E Q V+  ++     FECE SE   +VKW KDG+E+   E  KYR  
Sbjct: 2120 LLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEV--HEGDKYRMH 2177

Query: 505  KDGQRHHLIINEAMLEDAGHYALC---TSGGQALAELIVQEKKLEVYQSIADLMVGAKDQ 561
             D + H L I      DA  Y+         +  A+LIV+   +E  + + D+ V     
Sbjct: 2178 SDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYS 2237

Query: 562  AVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEG- 620
               +C VS EN+ G W  N  EL  + +  ++       LT+ DVT  D+ +YSFV +G 
Sbjct: 2238 GELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK 2297

Query: 621  -FACNLSAK 628
               C L  K
Sbjct: 2298 KTTCKLKMK 2306



 Score = 99.0 bits (245), Expect = 3e-20
 Identities = 116/522 (22%), Positives = 200/522 (38%), Gaps = 83/522 (15%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  P+ PK+++    S ++ W  P YDGG P+ GY++E K+  +  W        +Q   
Sbjct: 18631 PGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQ 18690

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP---IGPP-----SEPTHLAVEDVS 882
                 ++ E   Y  R+ A+N+ G+  P+      +    I PP     ++   + V   S
Sbjct: 18691 FTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRAS 18750

Query: 883   DTT---VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
              T    V++K RP   V     +G   +          A ++  +  T +++ ++     
Sbjct: 18751 ATLRLFVTIKGRPEPEVKWEKAEGILTDR---------AQIEVTSSFTMLVIDNVTRFDS 18801

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
               + +   N +G     + T  V V+ +L  P                  PVNL I    
Sbjct: 18802 GRYNLTLENNSG-----SKTAFVNVR-VLDSP----------------SAPVNLTIREVK 18839

Query: 1000  KPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAA-RRVHSGTYQVTVRIENMED---- 1054
             K    ++W     PL      I N   +     R A   + +   + T RIEN+++    
Sbjct: 18840 KDSVTLSWEP---PLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSY 18896

Query: 1055  ----------------KATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELW 1098
                             + T  ++V + P PP  + + D       ++W+ P+  G +++ 
Sbjct: 18897 YFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKIT 18956

Query: 1099  GYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPV 1158
             GY V+   K + +W T  +  +     +  L  G  Y FRV + N  G SD       P 
Sbjct: 18957 GYVVEMQTKGSEKWSTCTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSD-------PR 19008

Query: 1159  FIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNG 1218
              +  P I        A D    PS   P    +V A     +    +G P+  ++W K+G
Sbjct: 19009 QLGVPVI--------ARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDG 19060

Query: 1219  LDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
               L E  R  + S + V +L I++    D G Y    +N  G
Sbjct: 19061 QTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG 19102



 Score = 99.0 bits (245), Expect = 3e-20
 Identities = 115/467 (24%), Positives = 176/467 (37%), Gaps = 65/467 (13%)

Query: 824   DLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSD 883
             DL   L  +A R+  G  YE+++   NA+G +  +   Q     GPP  P  +  + V+ 
Sbjct: 20554 DLASILIKDADRLNSGC-YELKLR--NAMGSASATIRVQILDKPGPPGGP--IEFKTVTA 20608

Query: 884   TTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFR 943
               ++L WRPP   G   +  Y VE        W    + L E   I    +  G   +FR
Sbjct: 20609 EKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL-EECIITTTKIIKGNEYIFR 20667

Query: 944   VRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRP 1003
             VRA N  G G P+ +   V     +      +P   + T                 K   
Sbjct: 20668 VRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKIT-----------------KNSM 20710

Query: 1004  QVTWTKE----GQPLAGEEVSIRNSPT--------DTILFIR--AARRVHSGTYQVTVRI 1049
              V W++     G  ++G  +  R+  +        +TI   R        +  YQ  V  
Sbjct: 20711 TVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCA 20770

Query: 1050  ENMEDKATL--------VLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYT 1101
              N   +               +D P PP  +R+ D+   ++ L W  P   G + + GY 
Sbjct: 20771 VNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYV 20830

Query: 1102  VQKADKKTMEWFTVLE--HYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVF 1159
             V+    +  EW TV      R T  VV  L  G  YYFRV + N  G         EP+ 
Sbjct: 20831 VEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQG-------EPIE 20883

Query: 1160  IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVRGSPKPKISWFK 1216
             +  P         +A D  EAP     +  R+ +   AG    +    +G P P ++W K
Sbjct: 20884 MNEP--------VQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRK 20935

Query: 1217  NGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEAR 1263
             +  +LG DAR+ + +      L I +    D G Y+    N  GE +
Sbjct: 20936 DEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPK 20982



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 116/522 (22%), Positives = 197/522 (37%), Gaps = 81/522 (15%)

Query: 772   PDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDL-IQELS 830
             P  P  PK+ ++   S  + W  P YDGG  I GYI+E+       W        I + +
Sbjct: 16466 PGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTN 16525

Query: 831   HEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFM---PIGPPSEPTHLAVEDVSDTT-- 885
              E  +++E   Y  R+ A+N  G+   +    P +    +  P     L +  + +    
Sbjct: 16526 IEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAG 16585

Query: 886   ------VSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGAR 939
                   V +K RP   V  G +DG   +          A +   +  TS+++ ++     
Sbjct: 16586 GSLRLFVPIKGRPTPEVKWGKVDGEIRD---------AAIIDVTSSFTSLVLDNVNRYDS 16636

Query: 940   LLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQG 999
               + +   N +G     T +  VTV+ +L  P                  PVNL +    
Sbjct: 16637 GKYTLTLENSSG-----TKSAFVTVR-VLDTP----------------SPPVNLKVTEIT 16674

Query: 1000  KPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT--------- 1046
             K    +TW       G  +    V  R +   +  +       H  ++++          
Sbjct: 16675 KDSVSITWEPPLLDGGSKIKNYIVEKREATRKS--YAAVVTNCHKNSWKIDQLQEGCSYY 16732

Query: 1047  --VRIEN-----MEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWG 1099
               V  EN     +  +    ++V + P PP  + V D    +V+L W  P+  G +++  
Sbjct: 16733 FRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQ 16792

Query: 1100  YTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVF 1159
             Y V+   K + +W +     +    V+  L  G  Y FRV + N  G SD  +     V 
Sbjct: 16793 YIVEMQAKHSEKW-SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLA---VP 16848

Query: 1160  IPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGL 1219
             I    +  EP           P+F+    + SV  G    +   + G PKP I+W K+GL
Sbjct: 16849 IVAKDLVIEP--------DVKPAFS----SYSVQVGQDLKIEVPISGRPKPTITWTKDGL 16896

Query: 1220  DLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
              L +  R  +     + TL I++    DGG Y     N+ G+
Sbjct: 16897 PLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQ 16938



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 125/521 (23%), Positives = 208/521 (39%), Gaps = 94/521 (18%)

Query: 736   FTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVI---DVPDAPAAPKISNVGEDSCTVQW 792
             F  +  E+  E  + V  +N VG  + +   +     D  D P  P+   V  +  T+QW
Sbjct: 17110 FKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGTPEPIMVKRNEITLQW 17169

Query: 793   EPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAI 852
               P YDGG  I GYI+E++     RWM+ +F  + E       + E   YE RV A NA 
Sbjct: 17170 TKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAA 17229

Query: 853   G-MSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSL--KWRPPERVGAGGLDGYSVEYC 909
             G +S+PS ++ P             A ++V    +S+  K+R    V AG  + + +E  
Sbjct: 17230 GAISKPSDSTGPI-----------TAKDEVELPRISMDPKFRDTIVVNAG--ETFRLEAD 17276

Query: 910   PEG----CSEWVAALQGLTEHTSILVKDLPTGARLLFR-----------VRAHNMAGPGA 954
               G      EW+   + + E     +K+    A L+ +           +RA N+AG   
Sbjct: 17277 VHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAG--- 17333

Query: 955   PVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN-LLIPFQGKPRPQVTWTKEGQP 1013
               + + PV V ++L RP                G P   + +      +  +TW+   Q 
Sbjct: 17334 --SKSFPVNV-KVLDRP----------------GPPEGPVQVTGVTSEKCSLTWSPPLQD 17374

Query: 1014  LAGEEVS---IRNSPTDTILFIRAARRVHSGTYQVTVRIEN------------------M 1052
               G ++S   +    T  + +   A  V + + +VT  +E                   +
Sbjct: 17375 -GGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPL 17433

Query: 1053  EDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEW 1112
             E    L+      P PP+ L VT+    ++ + W  P   G +E+ GY V+K D+  + W
Sbjct: 17434 ESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRW 17493

Query: 1113  FTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTK-----EPVFIPRPGIT 1166
                           V  L   + Y FRV ++N  G  + +  T      +PVF P P   
Sbjct: 17494 IKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGP--- 17550

Query: 1167  YEPPNYKALDFSE---APSFTQPLVN-RSVIAGYTAMLCCA 1203
               P N   +D ++     ++ +P+ +  S I GY   +C A
Sbjct: 17551 --PTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKA 17589



 Score = 97.4 bits (241), Expect = 8e-20
 Identities = 105/411 (25%), Positives = 162/411 (39%), Gaps = 57/411 (13%)

Query: 876   LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLP 935
             L V  V+    +L W  P+  G   +  Y VE        WV  ++G     S +V  L 
Sbjct: 22775 LTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVI-VEGECPTLSYVVTRLI 22833

Query: 936   TGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLI 995
                  +FRVRA N  GPG PV + EP+  +     P           I ++VG       
Sbjct: 22834 KNNEYIFRVRAVNKYGPGVPVES-EPIVARNSFTIPS-------PPGIPEEVGT------ 22879

Query: 996   PFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPT--------DTILF---IRAARRVHS 1040
                GK    + WTK     G  ++   V  R   +        D +++   ++    +  
Sbjct: 22880 ---GKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEG 22936

Query: 1041  GTYQVTVRIENME-----DKATLVLQVVDK---PSPPQDLRVTDAWGLNVALEWKPPQDV 1092
               YQ  V   N        +A+  +   +    P PP   RV D    +++L W  P   
Sbjct: 22937 CDYQFRVTAVNAAGNSEPSEASNFISCREPSYTPGPPSAPRVVDTTKHSISLAWTKPMYD 22996

Query: 1093  GNTELWGYTVQKADKKTMEWFTVLEH--YRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
             G T++ GY ++  +K T +W+ V  +   R T   VP+L +G  Y FRV + N+ G S+ 
Sbjct: 22997 GGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEY 23056

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKP 1210
             + +  E   + R  I          D   A    + +  R   AG +  L  +V G P P
Sbjct: 23057 SESIAEIEPVERIEIP---------DLELADDLKKTVTIR---AGASLRLMVSVSGRPPP 23104

Query: 1211  KISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGE 1261
              I+W K G+DL   A         +L ++  K   +D G Y   A N  G+
Sbjct: 23105 VITWSKQGIDLASRAIIDTTESYSLLIVD--KVNRYDAGKYTIEAENQSGK 23153



 Score = 95.1 bits (235), Expect = 4e-19
 Identities = 68/224 (30%), Positives = 97/224 (43%), Gaps = 4/224 (1%)

Query: 391  DAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVK 450
            +A V W K G +I  S  K+   + G K  L I+     D+  Y   V G+K S  LFV 
Sbjct: 5140 EANVIWSK-GPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVT 5198

Query: 451  EPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRH 510
               +    PLEDQ V  G+   F CE+S E   V W K+  +L    T       +G+ H
Sbjct: 5199 GIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVL--ISSEGKTH 5256

Query: 511  HLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCEVSD 570
             L + E  L+D            + A+L V E        + D     KD+   KCEVS 
Sbjct: 5257 KLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVS- 5315

Query: 571  ENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADY 614
            ++V   W K+G+E+VP  +  +   G    L I      D+ +Y
Sbjct: 5316 KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEY 5359



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 97/413 (23%), Positives = 161/413 (38%), Gaps = 53/413 (12%)

Query: 870   PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSI 929
             P  P  + +++VS  ++++ W PPE  G   +  Y VE      + W    Q +   TSI
Sbjct: 19116 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVAR-TSI 19174

Query: 930   LVKDLPTGARLLFRVRAHNMAGPGA-----------PVTTTEPVTVQEILQRPRLQLPRH 978
              +  L TG+   FRV A N  G  +           P +   P    +++   +  +   
Sbjct: 19175 KIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPKVVHATKSTM--- 19231

Query: 979   LRQTIQKKVGEPVNLLIPF--QGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAAR 1036
                T Q  V +  + +I +  + K R  + W+K  + L  +   ++ S  D  L      
Sbjct: 19232 -LVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIAD-TQMKVSGLDEGLM----- 19284

Query: 1037  RVHSGTYQVTVRIENME-----DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQD 1091
                   Y+  V  EN+       K+   +   D   PP    VT+    +V+L+W  P  
Sbjct: 19285 ------YEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHY 19338

Query: 1092  VGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
              G  ++ GY V++ +     W      + + T+  V EL     Y FRVF++N       
Sbjct: 19339 DGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSE 19398

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVI---AGYTAMLCCAVRGS 1207
              + +  P+ +               D  E P     +  R VI   AG    +   + G 
Sbjct: 19399 PSESTGPIIVK--------------DDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGR 19444

Query: 1208  PKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             P P ISW K+G+++ E AR  + S      L ++     D G YV    N+ G
Sbjct: 19445 PLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG 19497



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 98/428 (22%), Positives = 164/428 (38%), Gaps = 61/428 (14%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP+ P  +  ++V+  +++L W PP+  G   ++ Y VE      + W   +      T
Sbjct: 15870 GPPTGPVKM--DEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVART 15926

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQ----LPRHLRQTI 983
             +I    L TG    FR+ A N  G    + + EP   Q   + P       +    R ++
Sbjct: 15927 TIKACRLKTGCEYQFRIAAENRYGKSTYLNS-EPTVAQYPFKVPGPPGTPVVTLSSRDSM 15985

Query: 984   QKKVGEPVN------LLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARR 1037
             + +  EP++      +    + K R  + W K           +  +P     F +    
Sbjct: 15986 EVQWNEPISDGGSRVIGYHLERKERNSILWVK-----------LNKTPIPQTKF-KTTGL 16033

Query: 1038  VHSGTYQVTVRIENME--------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPP 1089
                  Y+  V  EN+          +  +     D P  P+ + VT     +V L+WK P
Sbjct: 16034 EEGVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRN---SVTLQWKKP 16090

Query: 1090  QDVGNTELWGYTVQKADKKTMEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGF- 1147
                G +++ GY V+K +     W      +   TH  V  L+  + Y FRV ++N  G  
Sbjct: 16091 TYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVF 16150

Query: 1148  -----SDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCC 1202
                  S  A T ++ V  PR               S  P +   +V   V AG +  +  
Sbjct: 16151 SEPSESTGAITARDEVDPPR--------------ISMDPKYKDTIV---VHAGESFKVDA 16193

Query: 1203  AVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEA 1262
              + G P P I W K   +L   AR  + S     +L ++     D G Y+ +A N+ GE 
Sbjct: 16194 DIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGER 16253

Query: 1263  RCECRLEV 1270
                  ++V
Sbjct: 16254 SVTVNVKV 16261



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 114/418 (27%), Positives = 156/418 (37%), Gaps = 43/418 (10%)

Query: 870  PSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGC--SEWVAALQGLTEHT 927
            P  P +   ED+  T+V  KW PP   G   +  Y++E   +    SEW+     L  H 
Sbjct: 8430 PGPPINFVFEDIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTL-RHC 8488

Query: 928  SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
               V  L  G   LFRVRA N  GPG P  + +P+  ++    P             K +
Sbjct: 8489 KYSVTKLIEGKEYLFRVRAENRFGPGPPCVS-KPLVAKDPFGPP---------DAPDKPI 8538

Query: 988  GEPV--NLLIPFQGKPR----PQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSG 1041
             E V  N ++    +P+    P + +  E + +     S  N      L       +   
Sbjct: 8539 VEDVTSNSMLVKWNEPKDNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVDGLLEGL 8598

Query: 1042 TYQVTVRIENMEDKATL--------VLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVG 1093
            TY   V  EN                   +  P PP   RVTD     + LEW+PP   G
Sbjct: 8599 TYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIP-RVTDTSSTTIELEWEPPAFNG 8657

Query: 1094 NTELWGYTVQKADKKTMEWFTVLEHYRRTH-CVVPELIIGNGYYFRVFSQNMVGFSDRAA 1152
              E+ GY V K    T EW    E   +     V E+  G  Y  RV + N  G      
Sbjct: 8658 GGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGE 8717

Query: 1153 TTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKI 1212
            T  +PV +  P    EPP  + LD S             ++AG T  +   V G P P  
Sbjct: 8718 T--QPVTVAEP---QEPPAVE-LDVSVKGGI-------QIMAGKTLRIPAVVTGRPVPTK 8764

Query: 1213 SWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEV 1270
             W K   +L +D R  + +      L I+     D G YV  ATN  G      R+EV
Sbjct: 8765 VWTKEEGELDKD-RVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 8821



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 101/405 (24%), Positives = 158/405 (39%), Gaps = 35/405 (8%)

Query: 867   IGPPSEPTH-LAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTE 925
             +G P  PT  +  ++V+   ++LKW PP+  G   +  Y +E      ++WV     + +
Sbjct: 13701 VGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAV-Q 13759

Query: 926   HTSILVKDLPTGARLLFRVRAHNMAGPGA-----PVTTTEPVTVQEILQRPRLQLPRH-- 978
              T+  V  L  G    FRV A N  G G      P+    P  V +    P +   RH  
Sbjct: 13760 KTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVRHDS 13819

Query: 979   --LRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQ-PLAGEEVSIRNSPTDTILFIRAA 1035
               L  T  KK G         + K R  + W +  + P+   +  +           R  
Sbjct: 13820 VSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVM 13879

Query: 1036  RRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNT 1095
                 +G     V   ++  +  + L  +D P  P+ + +T     +V L W  P+  G  
Sbjct: 13880 AINLAG-----VGKPSLPSEPVVALDPIDPPGKPEVINITRN---SVTLIWTEPKYDGGH 13931

Query: 1096  ELWGYTVQKADKKTMEWFTVLEHYRRTHCV--VPELIIGNGYYFRVFSQNMVGFSDRAAT 1153
             +L GY V+K D  +  W     H     C   V +L+ G  Y FR+ ++N  G     + 
Sbjct: 13932 KLTGYIVEKRDLPSKSWMKA-NHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSE 13990

Query: 1154  TKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML-CCAVRGSPKPKI 1212
             + E +        YE P    LD    P+    L   ++ AG T +L   ++ G P PK 
Sbjct: 13991 STETIICKDE---YEAPTI-VLD----PTIKDGL---TIKAGDTIVLNAISILGKPLPKS 14039

Query: 1213  SWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATN 1257
             SW K G D+      ++ S      L I+     D G Y   ATN
Sbjct: 14040 SWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATN 14084



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 65/244 (26%), Positives = 113/244 (46%), Gaps = 6/244 (2%)

Query: 374  QVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            +V +G  ++L V+++    E  W+K+GQE+Q S   +I         L I   +  D   
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID-KQSHMLLIEDMTKEDAGN 2378

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVS-EEGAQVKWLKDGVE 492
            Y   +     ST   V    V +  PL+D  V+ G +   EC+VS  +   VKW  +  +
Sbjct: 2379 YSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQ 2438

Query: 493  LTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIA 552
            +  ++  +   K  G +  L+IN     D G Y L     +    L V+  K+++ + + 
Sbjct: 2439 IKPDDRVQAIVK--GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLR 2494

Query: 553  DLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEA 612
            DL        VF+ E+S   +  +W    KE+ P S+ K+   G+++KLT+ ++   DE 
Sbjct: 2495 DLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEG 2554

Query: 613  DYSF 616
             Y+F
Sbjct: 2555 KYTF 2558



 Score = 91.3 bits (225), Expect = 5e-18
 Identities = 107/447 (23%), Positives = 169/447 (37%), Gaps = 74/447 (16%)

Query: 846   VYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYS 905
             V A N+ G +  + +       GPP  P     ++VS   V + W PP   G   +  Y 
Sbjct: 18012 VTATNSAGTATENLSVIVLEKPGPPVGPVRF--DEVSADFVVISWEPPAYTGGCQISNYI 18069

Query: 906   VEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQ 965
             VE      + W   +      T+I +  L TG    FR+ A N  G  AP+ + + V VQ
Sbjct: 18070 VEKRDTTTTTW-HMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDS-KAVIVQ 18127

Query: 966   EILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSI 1021
                + P                G P    +    K +  V W +     G  + G  +  
Sbjct: 18128 YPFKEP----------------GPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQ 18171

Query: 1022  RNSPTDTILFIRAARRVHSGT------------YQVTVRIENME--------DKATLVLQ 1061
             +    ++IL+++  +     T            Y+  V  EN+          +  +   
Sbjct: 18172 KEK--NSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARD 18229

Query: 1062  VVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTV-LEHYR 1120
               D P  P+ + +T     NV L+WK P   G +++ GY V+K D     W      +  
Sbjct: 18230 PCDPPGRPEAIVITRN---NVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVL 18286

Query: 1121  RTHCVVPELIIGNGYYFRVFSQNMVGF------SDRAATTKEPVFIPRPGITYEPPNYKA 1174
              T   V  L+    Y FRV ++N  G       S  A T ++ +  P   +    P YK 
Sbjct: 18287 ETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLD---PKYKD 18343

Query: 1175  LDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGED-ARFRMFSKQ 1233
             +                V AG T +L   +RG P P + W K+G +L E  AR  + S  
Sbjct: 18344 VIV--------------VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTI 18389

Query: 1234  GVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                TL ++     DGG Y+ + +N+ G
Sbjct: 18390 QKTTLVVKDCIRTDGGQYILKLSNVGG 18416



 Score = 90.9 bits (224), Expect = 7e-18
 Identities = 68/227 (29%), Positives = 112/227 (49%), Gaps = 8/227 (3%)

Query: 386  ELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSL--ADDAAYQCVVGGEKC 443
            E+++ D   +W   G+ ++ S +  I ++ G KR LT+ +  L  A +  YQ +      
Sbjct: 5047 EISEADIPGQWKLKGELLRPSPTCEI-KAEGGKRFLTLHKVKLDQAGEVLYQAL--NAIT 5103

Query: 444  STELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRF 503
            +  L VKE  +    PL+D  V   ++  FEC ++ E A V W K G ++ +    K+  
Sbjct: 5104 TAILTVKEIELDFAVPLKDVTVPERRQARFECVLTRE-ANVIWSK-GPDIIKSSD-KFDI 5160

Query: 504  KKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAV 563
              DG++H L+IN++  +D G Y     G +  A L V   +L+    + D  V   + A 
Sbjct: 5161 IADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETAT 5220

Query: 564  FKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPAD 610
            F CE+S E +  VW KN  +L     + +S  G+ HKL + +VT  D
Sbjct: 5221 FVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDD 5267



 Score = 90.5 bits (223), Expect = 9e-18
 Identities = 108/430 (25%), Positives = 157/430 (36%), Gaps = 64/430 (14%)

Query: 868   GPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHT 927
             GPP  P    + D+     SL W  P   G   +  Y VE C     +WV AL  +T+ T
Sbjct: 12621 GPPQPP--FDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTK-T 12677

Query: 928   SILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKV 987
             S  V  L  G   +FRVRA N  G   P+T+                 P+ + Q      
Sbjct: 12678 SCRVGKLIPGQEYIFRVRAENRFGISEPLTS-----------------PKMVAQFPFGVP 12720

Query: 988   GEPVNLLIPFQGKPRPQVTWTKE----GQPLAGEEVSIRNSPTDTILFIRAARR-VHSGT 1042
              EP N  +    K    V W +     G P+ G    I     +++L+++A    V S  
Sbjct: 12721 SEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG--YLIERKERNSLLWVKANDTLVRSTE 12778

Query: 1043  YQVTVRIENME----------------DKATLVLQVVDKPSPPQDLRVTDAWGLNVALEW 1086
             Y     +E +E                 K T  +       PP    V D     V+L W
Sbjct: 12779 YPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIW 12838

Query: 1087  KPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNG------YYFRVF 1140
               P+  G +++ GY V+       +W   +      H +  E     G      Y FR  
Sbjct: 12839 ARPKHDGGSKIIGYFVEACKLPGDKW---VRCNTAPHQIPQEEYTATGLEEKAQYQFRAI 12895

Query: 1141  SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML 1200
             ++  V  S  +  + +PV I    +   PP    +D S A          +V AG    L
Sbjct: 12896 ARTAVNISPPSEPS-DPVTILAENV---PPR---IDLSVAMKSLL-----TVKAGTNVCL 12943

Query: 1201  CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
                V G P P +SW K+G  L      +M  ++ + TLE+      D G Y   A N  G
Sbjct: 12944 DATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSG 13003

Query: 1261  EARCECRLEV 1270
                   +L+V
Sbjct: 13004 SKSATIKLKV 13013



 Score = 90.5 bits (223), Expect = 9e-18
 Identities = 111/461 (24%), Positives = 182/461 (39%), Gaps = 71/461 (15%)

Query: 727   VETTKDRSIFTVEGAEKEDEGVYTVTVKNPVG---EDQVNLTVKVIDVPDAPAAPKISNV 783
             ++ TK ++    EG E E    + V+ +N VG     +V+      D  D P  P+   +
Sbjct: 18187 IQDTKFKTTGLDEGLEYE----FKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVI 18242

Query: 784   GEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYE 843
               ++ T++W+ PAYDGG  I GYI+E+K     RWM+ +F  + E       ++E   YE
Sbjct: 18243 TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYE 18302

Query: 844   MRVYAVNAIG-MSRPSPASQPFM---PIGPPSEPTHLAVEDV-----SDTTV---SLKWR 891
              RV A NA G  S PS +S        I  P+       +DV      +T V    ++ +
Sbjct: 18303 FRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGK 18362

Query: 892   PPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAG 951
             P   V     DG  +E            ++   + T+++VKD        + ++  N+ G
Sbjct: 18363 PIPDV-VWSKDGKELEETAARME-----IKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 18416

Query: 952   PGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKKVGEPVN-LLIPFQGKPRPQVTWTKE 1010
                  T + P+TV ++L RP                G P   L +      +  + W   
Sbjct: 18417 -----TKSIPITV-KVLDRP----------------GPPEGPLKVTGVTAEKCYLAWNPP 18454

Query: 1011  GQPLAGEEVS---IRNSPTDTILFIRAARRVHSGTYQVTVRI------------------ 1049
              Q   G  +S   I    T  + + + +  V +  Y+VT  +                  
Sbjct: 18455 LQD-GGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIG 18513

Query: 1050  ENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKADKKT 1109
             E +E            P PP    V+     ++ + W  P D G TE+ GY ++K DK+ 
Sbjct: 18514 EPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEG 18573

Query: 1110  MEWFTV-LEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSD 1149
             + W     +        V  L  G+ Y FRV ++N  G  +
Sbjct: 18574 VRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGE 18614



 Score = 89.0 bits (219), Expect = 3e-17
 Identities = 135/650 (20%), Positives = 234/650 (36%), Gaps = 98/650 (15%)

Query: 661   VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPD------------APEDTGDS 708
             V A NK  +  P+  DP   V+ Q   T  + AP  P P              PE  G S
Sbjct: 21754 VSAVNKFGVGRPLDSDP---VVAQIQYTVPD-APGIPEPSNITGNSITLTWARPESDGGS 21809

Query: 709   D--EWVFDKKLLCETEGRVRVETTKDRSI----FTVEGAEKEDEGVYTVTVKNPVGEDQV 762
             +  +++ +++   E +    V+    R I    F V G  + +E  + V  +N  G    
Sbjct: 21810 EIQQYILERR---EKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPA 21866

Query: 763   NLTVKVI------DVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSY 816
             +   ++I      + P  P   K+++  + + +++W  P +DGG  I+GYI+E  K    
Sbjct: 21867 SGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLG 21926

Query: 817   RWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIG----------MSRPSPASQPFMP 866
              W ++N +   +  +    +  G  Y+ RV A+N  G          +      + P + 
Sbjct: 21927 DWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELD 21986

Query: 867   IGPPSEPTHLAVEDVS---------DTTVSLKWRPPE-----RVGAGGLDGYSVEYCPEG 912
             I    + TH+     S           T +  W  P+     R      D +S     E 
Sbjct: 21987 IDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTTDSFST-LTVEN 22045

Query: 913   CSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQ--R 970
             C+   A    LT      V++      + F V+  +  GP  P+T  +       L    
Sbjct: 22046 CNRNDAGKYTLT------VENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDA 22099

Query: 971   PRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTIL 1030
             P L     +   + +K             +   + +W    +    +   + +       
Sbjct: 22100 PLLDGGARIHHYVVEK-------------REASRRSWQVISEKCTRQIFKVNDLAEGVPY 22146

Query: 1031  FIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQ 1090
             + R +       Y V    E  E      +   ++P+PP+ L V D    +  L W  P 
Sbjct: 22147 YFRVSA---VNEYGVGEPYEMPEP-----IVATEQPAPPRRLDVVDTSKSSAVLAWLKPD 22198

Query: 1091  DVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDR 1150
               G + + GY ++   K +  W     H ++    V  L+    Y FRV ++N  G+S+ 
Sbjct: 22199 HDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEP 22257

Query: 1151  AATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKP 1210
                    V I  P I  EP        ++    T  L+     AG    +   + G P P
Sbjct: 22258 REAFSS-VIIKEPQI--EPT-------ADLTGITNQLITCK--AGSPFTIDVPISGRPAP 22305

Query: 1211  KISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG 1260
             K++W    + L E  R  + + +   TL ++     D G Y     N  G
Sbjct: 22306 KVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAG 22355



 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 96/405 (23%), Positives = 160/405 (39%), Gaps = 38/405 (9%)

Query: 359  EKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAK 418
            E +   F+K ++    + K  +     E+++ D  V+W+K+ QE+Q++    I +     
Sbjct: 3008 EARHIEFRKHIKDIKVLEK-KRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVH 3066

Query: 419  RTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVS 478
            R L I    ++D   Y  V GG   + +LFV+   V I    ++  V+  QR   E EV+
Sbjct: 3067 RLL-IPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVN 3125

Query: 479  EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAEL 538
            E+     W KDG+E+  +   ++++  + + H + I+E    DAG Y       ++   L
Sbjct: 3126 EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL 3185

Query: 539  IVQ-EKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGV-WLKNGKELVPDSRIKVSHIG 596
             V   +  +V Q +  + V +   A F   +S      + W K  + L    + K  H G
Sbjct: 3186 YVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDG 3245

Query: 597  RVHKLTIDDVTPADEADYSFVPEG--FACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGR 654
            + + L + +  P D A Y+   +        SA L  +EV     P QE P         
Sbjct: 3246 QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLS-VEVPEVVSPDQEMPVYPPAIITP 3304

Query: 655  IPDTIVVVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFD 714
            + DT V   G   R    +SG       + K                            D
Sbjct: 3305 LQDT-VTSEGQPARFQCRVSGTDLKVSWYSK----------------------------D 3335

Query: 715  KKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGE 759
            KK+  +     R+   +D     +  A  EDEG YT    N VG+
Sbjct: 3336 KKI--KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3378



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 71/263 (26%), Positives = 119/263 (45%), Gaps = 10/263 (3%)

Query: 375  VSKGHKIRLTVELADHDA-EVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAA 433
            V +G K  L  +++  D   VKW  N ++I+           G K+ L I++   +D+  
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVK-GTKQRLVINRTHASDEGP 2468

Query: 434  YQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVEL 493
            Y+ +VG  + +  L V++  + I R L D      Q V FE E+S  G  V W     E+
Sbjct: 2469 YKLIVGRVETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEI 2526

Query: 494  TREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIAD 553
              + + KY+ +  G+ + L +   M +D G Y           +L V    +   + + D
Sbjct: 2527 --KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPLTD 2582

Query: 554  LMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEAD 613
              V    +AVF+CEV++ + +G WL++GK L   + I+    G   +L I      D  +
Sbjct: 2583 QTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGE 2642

Query: 614  YSFVPEGFACNLSAKLHFMEVKI 636
            Y++  +      SAKL    VKI
Sbjct: 2643 YTY--KVATSKTSAKLKVEAVKI 2663



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 156/799 (19%), Positives = 296/799 (37%), Gaps = 121/799 (15%)

Query: 1     MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASN--KYGLA 58
             +P      ++ F K   S E+A  +  V E+   RA  +V W + G  +  +   ++  +
Sbjct: 26340 LPVSAPPKITQFLKAEASKEIAKLT-CVVESSVLRAK-EVTWYKDGKKLKENGHFQFHYS 26397

Query: 59    TEGTRHTLTVREVGPADQGSYAVI----AGSSKVKFDLKVIEAEKAEPMLAPAPAPAEAT 114
              +GT + L +  +  +DQG Y        G+SK                        +A 
Sbjct: 26398 ADGT-YELKINNLTESDQGEYVCEISGEGGTSKTNLQFM-----------------GQAF 26439

Query: 115   GAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIG---LFVMRPQDGEVTVGGS 171
              +  E  +  +E  +S    K + S       P AP+ PI    + V   QD  V+    
Sbjct: 26440 KSIHEKVSKISETKKS--DQKTTESTVTRKTEPKAPE-PISSKPVIVTGLQDTTVSSDSV 26496

Query: 172   ITFSARVAGASLLKPPVVKWFK-GKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQ 230
               F+ +  G      P   W K GK +    K         S D+    +  E+H TD  
Sbjct: 26497 AKFAVKATGEPR---PTAIWTKDGKAITQGGKYKL------SEDKGG--FFLEIHKTDTS 26545

Query: 231   PAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDT 290
              +  G Y C V        S+  LT+ +A+   +   +S  + + +    + +       
Sbjct: 26546 DS--GLYTCTVKNSAGSVSSSCKLTI-KAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQ 26602

Query: 291   GILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLK 350
               L  S  +K  ++    + +  E  ++  + E ++++  +  E+      +T       
Sbjct: 26603 KALR-SEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKT----- 26656

Query: 351   RLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKY 410
                    +E ++ A  K       +++G ++ L   +A    +VKW+ NG E+  S  +Y
Sbjct: 26657 ---SQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA-TDVKWVLNGVELTNS-EEY 26711

Query: 411   IFESIGAKRTLTISQCSLADDAAYQCV----VGGEKCSTELF----VKEPPVLITRPLED 462
              +   G+ +TLTI Q S  D+    C+     G  KC  +L     + + P  I++P   
Sbjct: 26712 RYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQP-RS 26770

Query: 463   QLVMVGQRVEFECEVS-EEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLED 521
             Q +  GQ V F CE+S E   +++W K+ + ++          +    + L I  A + D
Sbjct: 26771 QNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS--ISRSRNVYSLEIRNASVSD 26828

Query: 522   AGHYAL--------CTSGGQALAELIVQEKKLEVYQSIADLMVG