Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 144226847

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|144226847 obscurin-like 1 [Homo sapiens]
         (1896 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|144226847 obscurin-like 1 [Homo sapiens]                          3848   0.0  
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   858   0.0  
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   858   0.0  
gi|110349719 titin isoform N2-A [Homo sapiens]                        461   e-129
gi|110349717 titin isoform novex-2 [Homo sapiens]                     461   e-129
gi|110349713 titin isoform novex-1 [Homo sapiens]                     461   e-129
gi|110349715 titin isoform N2-B [Homo sapiens]                        461   e-129
gi|169178458 PREDICTED: hemicentin 2 [Homo sapiens]                   321   4e-87
gi|169177000 PREDICTED: hemicentin 2 [Homo sapiens]                   321   5e-87
gi|118572606 hemicentin 1 [Homo sapiens]                              301   3e-81
gi|110349721 titin isoform novex-3 [Homo sapiens]                     291   4e-78
gi|239749684 PREDICTED: hemicentin 2 [Homo sapiens]                   251   6e-66
gi|126012571 heparan sulfate proteoglycan 2 [Homo sapiens]            224   8e-58
gi|157785645 SPEG complex locus [Homo sapiens]                        164   6e-40
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     145   4e-34
gi|239755187 PREDICTED: similar to hemicentin 2 [Homo sapiens]        143   1e-33
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       125   5e-28
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         124   7e-28
gi|193083163 roundabout, axon guidance receptor, homolog 2 isofo...   117   1e-25
gi|61888896 roundabout, axon guidance receptor, homolog 2 isofor...   117   1e-25
gi|48476182 roundabout, axon guidance receptor, homolog 3 [Homo ...   117   1e-25
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   116   2e-25
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   116   2e-25
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   116   2e-25
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   116   2e-25
gi|19743806 roundabout 1 isoform b [Homo sapiens]                     112   3e-24
gi|4506569 roundabout 1 isoform a [Homo sapiens]                      112   3e-24
gi|126517478 peroxidasin homolog-like [Homo sapiens]                  111   6e-24
gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]      110   1e-23
gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]       110   1e-23

>gi|144226847 obscurin-like 1 [Homo sapiens]
          Length = 1896

 Score = 3848 bits (9979), Expect = 0.0
 Identities = 1896/1896 (100%), Positives = 1896/1896 (100%)

Query: 1    MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF 60
            MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF
Sbjct: 1    MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF 60

Query: 61   PADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS 120
            PADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS
Sbjct: 61   PADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS 120

Query: 121  PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQ 180
            PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQ
Sbjct: 121  PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQ 180

Query: 181  PGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEA 240
            PGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEA
Sbjct: 181  PGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEA 240

Query: 241  PAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG 300
            PAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG
Sbjct: 241  PAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG 300

Query: 301  GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL 360
            GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL
Sbjct: 301  GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL 360

Query: 361  ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT 420
            ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT
Sbjct: 361  ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT 420

Query: 421  VANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMH 480
            VANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMH
Sbjct: 421  VANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMH 480

Query: 481  ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP 540
            ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP
Sbjct: 481  ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP 540

Query: 541  PEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR 600
            PEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR
Sbjct: 541  PEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR 600

Query: 601  SPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPE 660
            SPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPE
Sbjct: 601  SPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPE 660

Query: 661  GQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSP 720
            GQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSP
Sbjct: 661  GQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSP 720

Query: 721  QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKV 780
            QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKV
Sbjct: 721  QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKV 780

Query: 781  QDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRW 840
            QDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRW
Sbjct: 781  QDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRW 840

Query: 841  YKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIV 900
            YKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIV
Sbjct: 841  YKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIV 900

Query: 901  YPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV 960
            YPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV
Sbjct: 901  YPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV 960

Query: 961  QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV 1020
            QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV
Sbjct: 961  QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV 1020

Query: 1021 RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER 1080
            RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER
Sbjct: 1021 RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER 1080

Query: 1081 IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL 1140
            IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL
Sbjct: 1081 IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL 1140

Query: 1141 PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA 1200
            PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA
Sbjct: 1141 PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA 1200

Query: 1201 GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV 1260
            GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV
Sbjct: 1201 GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV 1260

Query: 1261 QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA 1320
            QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA
Sbjct: 1261 QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA 1320

Query: 1321 GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR 1380
            GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR
Sbjct: 1321 GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR 1380

Query: 1381 CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA 1440
            CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA
Sbjct: 1381 CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA 1440

Query: 1441 RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ 1500
            RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ
Sbjct: 1441 RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ 1500

Query: 1501 DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ 1560
            DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ
Sbjct: 1501 DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ 1560

Query: 1561 LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA 1620
            LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA
Sbjct: 1561 LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA 1620

Query: 1621 RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG 1680
            RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG
Sbjct: 1621 RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG 1680

Query: 1681 TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC 1740
            TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC
Sbjct: 1681 TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC 1740

Query: 1741 TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLAL 1800
            TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLAL
Sbjct: 1741 TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLAL 1800

Query: 1801 LEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG 1860
            LEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG
Sbjct: 1801 LEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG 1860

Query: 1861 PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEGN 1896
            PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEGN
Sbjct: 1861 PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEGN 1896


>gi|58331253 obscurin, cytoskeletal calmodulin and titin-interacting
            RhoGEF isoform a [Homo sapiens]
          Length = 6620

 Score =  858 bits (2217), Expect = 0.0
 Identities = 585/1939 (30%), Positives = 896/1939 (46%), Gaps = 112/1939 (5%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLL 71
            P FL  P+   V  G +A L C ++G P P V WEK  Q +AA  R     DG  + L +
Sbjct: 10   PRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQDGDLYRLTI 69

Query: 72   TAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFL 131
                  D+G YVCRARNA GEA+AA  + V      D E   AE+          AP FL
Sbjct: 70   LDLALGDSGQYVCRARNAIGEAFAAVGLQV------DAEAACAEQ----------APHFL 113

Query: 132  TGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP--- 188
              P S  V  G+E    CR GG P P + W KDG  L E               DGP   
Sbjct: 114  LRPTSIRVREGSEATFRCRVGGSPRPAVSWSKDGRRLGE--------------PDGPRVR 159

Query: 189  ----GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPV 244
                G + ALRI AAR  D G Y   A N  G A A A L V        + P  + A +
Sbjct: 160  VEELGEASALRIRAARPRDGGTYEVRAENPLGAASAAAALVVDSDAADTASRPGTSTAAL 219

Query: 245  V-----------------EPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLL 287
            +                  P     +T  V EGKHA+  CYV G+P+PE  W  +G+ + 
Sbjct: 220  LAHLQRRREAMRAEGAPASPPSTGTRTCTVTEGKHARLSCYVTGEPKPETVWKKDGQLVT 279

Query: 288  PDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPL 347
              RR ++Y D    FVLK+L+C+  DRGLY C A N  GQT S+V + V+EP + F + L
Sbjct: 280  EGRRHVVYEDAQENFVLKILFCKQSDRGLYTCTASNLVGQTYSSVLVVVREPAVPFKKRL 339

Query: 348  QDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDD 407
            QD+E RE   A   C+VP      AWF+E+ RL    KY   EEGT RRL +  + ADDD
Sbjct: 340  QDLEVREKESATFLCEVPQPSTEAAWFKEETRLWASAKYGIEEEGTERRLTVRNVSADDD 399

Query: 408  GIYLCEMRGRVRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEE 467
             +Y+CE     RTVA + V+G +L++LPRK  V  G+ A+  VE         W R+ EE
Sbjct: 400  AVYICETPEGSRTVAELAVQGNLLRKLPRKTAVRVGDTAMFCVELAVPVGPVHWLRNQEE 459

Query: 468  LPV---ICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILA 524
            +     +  S+ G  H L +     ED G+V F  G+ +T+T   V   +  P  PP+  
Sbjct: 460  VVAGGRVAISAEGTRHTLTISQCCLEDVGQVAFMAGDCQTSTQFCVSAPRKPPLQPPVDP 519

Query: 525  EMFKGHKNTVLLTWKPPEPAPETPFI---YRLERQEVGSEDWIQCFSIEKAGAVEVPGDC 581
             +    +++V+L+W PP P  E P     Y +E++++G+  WI+C   E     E+    
Sbjct: 520  VVKARMESSVILSWSPP-PHGERPVTIDGYLVEKKKLGTYTWIRCHEAEWVATPELTVAD 578

Query: 582  VPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLST 641
            V  EG+++FR+  ++  G+SP++ F G+ HL P   +   L+ VQ  +G +  FS+DL+ 
Sbjct: 579  VAEEGNFQFRVSALNSFGQSPYLEFPGTVHLAPKLAVRTPLKAVQAVEGGEVTFSVDLTV 638

Query: 642  IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPG 701
               G WFL+G+ LK++            Y I     +H L +  V     GA + F   G
Sbjct: 639  ASAGEWFLDGQALKASSV----------YEIHCDRTRHTLTIREVPASLHGAQLKFVANG 688

Query: 702  VQDSAALTIQESPVHILSPQDRVS---LTFTTSERVVLTCELSRVDFPATWYKDGQKVEE 758
            ++ S  + ++ +P    +     +   +     E   L  ELS      TW KDG+ +  
Sbjct: 689  IESSIRMEVRAAPGLTANKPPAAAAREVLARLHEEAQLLAELSDQAAAVTWLKDGRTLSP 748

Query: 759  SELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVH 818
                 V+    +  L++ +    D+G +EC + G    + ++VQ     +        V 
Sbjct: 749  GPKYEVQASAGRRVLLVRDVARDDAGLYECVSRGGRIAYQLSVQGLARFLHKDMAGSCVD 808

Query: 819  AITSECVMLACEVDREDAPVRWYKDGQEVEES-DFVVLENEGPHRRLVLPATQPSDGGEF 877
            A+        CE       V WYKDG E+  S +  + E+ G   RLV       D G +
Sbjct: 809  AVAGGPAQFECETSEAHVHVHWYKDGMELGHSGERFLQEDVGTRHRLVAATVTRQDEGTY 868

Query: 878  QCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLE---RVVLTCELCRPWAEVRWTKD 934
             C  G++   F + +++    +V+   ++    ++ E      L+CE+ +   EV W KD
Sbjct: 869  SCRVGEDSVDFRLRVSEPK--VVFAKEQLARRKLQAEAGASATLSCEVAQAQTEVTWYKD 926

Query: 935  GEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPR 994
            G+++  S  + ++     RRLV+      D+GEY CE   +  SF + V EP  ++++ +
Sbjct: 927  GKKLSSSSKVCMEATGCTRRLVVQQAGQADAGEYSCEAGGQRLSFHLDVKEP--KVVFAK 984

Query: 995  DEVTLIAVTLEC---VVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAA 1051
            D+V    V  E      L CE+++    V WYKDG ++  S  + +E  G R RLV+  A
Sbjct: 985  DQVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSSSLKVHVEAKGCRRRLVVQQA 1044

Query: 1052 QPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQ 1111
               D G++ C+A      F + +T P        +   ++   A     L CEVA A ++
Sbjct: 1045 GKTDAGDYSCEARGQRVSFRLHITEPKMMFAKEQSVHNEVQAEAGASAMLSCEVAQAQTE 1104

Query: 1112 VRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPV 1171
            V WYKDG ++ +S  + +  +G TR L LP A   DAGEY CE   + ++F++ + EP  
Sbjct: 1105 VTWYKDGKKLSSSSKVGMEVKGCTRRLVLPQAGKADAGEYSCEAGGQRVSFHLHITEPKG 1164

Query: 1172 QFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLC 1231
             F   ++  + +    G   +LSCE+++    V W  +G+ +     + +  +G  R L 
Sbjct: 1165 VFAKEQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWYKDGKKLSSSSKVRMEVKGCTRRLV 1224

Query: 1232 IQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVV 1291
            +Q  G A AG Y+C++    G   +SF + + EP       +     VR+  G    L  
Sbjct: 1225 VQQVGKADAGEYSCEA----GGQRVSFQLHITEPKAVFAKEQLVHNEVRTEAGASATLSC 1280

Query: 1292 HLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFL 1351
             ++     V WYKDG++L+S  +V++E AG  + L VQ A   DAGEY C+A      F 
Sbjct: 1281 EVAQAQTEVTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQAGQADAGEYTCEAGGQRLSFH 1340

Query: 1352 VSVEEPLLVKLVSELT--PLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQ 1409
            + V EP  V    +L    +    G  AT  CEV+    +VTW ++G  ++   +V M  
Sbjct: 1341 LDVSEPKAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQTEVTWYKDGKKLSSSSKVRMEA 1400

Query: 1410 NGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRL---QDVRAEEGQDV 1466
             G +R L ++     D G  +  AG    S  L V E +++F +     ++V+A+ G   
Sbjct: 1401 VGCTRRLVVQQACQADTGEYSCEAGGQRLSFSLDVAEPKVVFAKEQPVHREVQAQAGAST 1460

Query: 1467 CLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH 1526
             L  E  +  A   V W + G+ L   S++ M   G   RL +     A  G Y CE+  
Sbjct: 1461 TLSCEVAQ--AQTEVMWYKDGKKLSFSSKVRMEAVGCTRRLVVQQAGQAVAGEYSCEAGS 1518

Query: 1527 DRTLARLSV-RPRQL--RVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGP 1583
             R    L V  P+ +  +      +V    G SAT   E++Q      W + G +L    
Sbjct: 1519 QRLSFHLHVAEPKAVFAKEQPASREVQAEAGTSATLSCEVAQAQTEVTWYKDGKKLSSSS 1578

Query: 1584 KCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVR---GPHDLEV 1640
            K  + + G   RLV+   G AD+G  S  A   R +  L V E  V   +      +++ 
Sbjct: 1579 KVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQRLSFHLHVAEPKVVFAKEQPAHREVQA 1638

Query: 1641 TEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC 1700
              G +AT  CE++QA  +VTW KDG  L+ S ++R++A+G  R L +++ G +DAG YSC
Sbjct: 1639 EAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRVEAVGCTRRLVVQQAGQADAGEYSC 1698

Query: 1701 AVGTARAGPVRLTVRERTVAVLS---ELRSVSAREGDGATFECTVSEVE-TTGRWELGGR 1756
              G  R    RL V E    +         +  +E +      T++     T  W   G 
Sbjct: 1699 EAGGQRLS-FRLHVAELEPQISERPCRREPLVVKEHEDIILTATLATPSAATVTWLKDGV 1757

Query: 1757 PLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCR--HP 1814
             +R   R     +G  H L +   +  D+     + G       ++VE +  + CR   P
Sbjct: 1758 EIRRSKRHETASQGDTHTLTVHGAQVLDSAIYSCRVGAEGQDFPVQVEEVAAKFCRLLEP 1817

Query: 1815 PREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPED 1874
               +   +G    L   +S +   V W     +L  G +++M + GP  SL +  +R ED
Sbjct: 1818 VCGE---LGGTVTLACELSPACAEVVWRCGNTQLRVGKRFQMVAEGPVRSLTVLGLRAED 1874

Query: 1875 QGTYCCQAGQDSTHTRLLV 1893
             G Y C++  D T  +L V
Sbjct: 1875 AGEYVCESRDDHTSAQLTV 1893



 Score =  621 bits (1602), Expect = e-177
 Identities = 473/1604 (29%), Positives = 723/1604 (45%), Gaps = 80/1604 (4%)

Query: 330  SAVQLHVKE-PRLRFTRP----LQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCR 384
            S++++ V+  P L   +P     ++V  R H  A L  ++ +      W ++ + L P  
Sbjct: 691  SSIRMEVRAAPGLTANKPPAAAAREVLARLHEEAQLLAELSDQAAAVTWLKDGRTLSPGP 750

Query: 385  KYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRK------L 438
            KYE       R L++  +  DD G+Y C  RG  R    ++V+G  L R   K      +
Sbjct: 751  KYEVQASAGRRVLLVRDVARDDAGLYECVSRGG-RIAYQLSVQG--LARFLHKDMAGSCV 807

Query: 439  DVLEGENAVLLVETLEAGVEGRWSRDGEEL----PVICQSSSGHMHALVLPGVTREDAGE 494
            D + G  A    ET EA V   W +DG EL        Q   G  H LV   VTR+D G 
Sbjct: 808  DAVAGGPAQFECETSEAHVHVHWYKDGMELGHSGERFLQEDVGTRHRLVAATVTRQDEGT 867

Query: 495  VTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHK------NTVLLTWKPPEPAPETP 548
             +  +G       LRV     S P      E     K       +  L+ +  +   E  
Sbjct: 868  YSCRVGEDSVDFRLRV-----SEPKVVFAKEQLARRKLQAEAGASATLSCEVAQAQTEVT 922

Query: 549  FIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHG 608
            +    ++    S+  ++     +   V+  G      G+Y    C   G   S H+    
Sbjct: 923  WYKDGKKLSSSSKVCMEATGCTRRLVVQQAGQA--DAGEYS---CEAGGQRLSFHLDVKE 977

Query: 609  SAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGA 667
                V  A+      +VQ   G  A  S +++    +  W+ +G++L S+          
Sbjct: 978  PK--VVFAKDQVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSSS---------- 1025

Query: 668  LRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESPVHILSPQD-RV 724
            L+  +E KG + RL++      D+G    +SC   G + S  L I E  +     Q    
Sbjct: 1026 LKVHVEAKGCRRRLVVQQAGKTDAG---DYSCEARGQRVSFRLHITEPKMMFAKEQSVHN 1082

Query: 725  SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
             +        +L+CE+++     TWYKDG+K+  S  + +++ G   RL+LP+A   D+G
Sbjct: 1083 EVQAEAGASAMLSCEVAQAQTEVTWYKDGKKLSSSSKVGMEVKGCTRRLVLPQAGKADAG 1142

Query: 785  EFECRTEGVSAFFGVTVQDPP-VHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKD 843
            E+ C   G    F + + +P  V   +   H  V A      ML+CEV +    V WYKD
Sbjct: 1143 EYSCEAGGQRVSFHLHITEPKGVFAKEQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWYKD 1202

Query: 844  GQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPS 903
            G+++  S  V +E +G  RRLV+     +D GE+ C AG +   F + IT+  +  V+  
Sbjct: 1203 GKKLSSSSKVRMEVKGCTRRLVVQQVGKADAGEYSCEAGGQRVSFQLHITEPKA--VFAK 1260

Query: 904  GKVYVAAVRLER---VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV 960
             ++    VR E      L+CE+ +   EV W KDG+++  S  + ++    +R+LV+   
Sbjct: 1261 EQLVHNEVRTEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQA 1320

Query: 961  QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLEC---VVLMCELSRED 1017
               D+GEY CE   +  SF + V+EP  + ++ ++++    V  E      L CE+++  
Sbjct: 1321 GQADAGEYTCEAGGQRLSFHLDVSEP--KAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQ 1378

Query: 1018 APVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAP 1077
              V WYKDG ++  S  + +E  G   RLV+  A   D GE+ C+AG     F++ V  P
Sbjct: 1379 TEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQQACQADTGEYSCEAGGQRLSFSLDVAEP 1438

Query: 1078 PERIV--HPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPT 1135
                    P  R +    GA     L CEVA A ++V WYKDG ++  S  +++ A G T
Sbjct: 1439 KVVFAKEQPVHREVQAQAGAS--TTLSCEVAQAQTEVMWYKDGKKLSFSSKVRMEAVGCT 1496

Query: 1136 RTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSC 1195
            R L +  A    AGEY CE   + ++F++ +AEP   F   +     +    G    LSC
Sbjct: 1497 RRLVVQQAGQAVAGEYSCEAGSQRLSFHLHVAEPKAVFAKEQPASREVQAEAGTSATLSC 1556

Query: 1196 ELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPS 1255
            E+++A   V W  +G+ +     + + A G  R L +Q AG A AG Y+C++G       
Sbjct: 1557 EVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQ----R 1612

Query: 1256 LSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRV 1315
            LSF + VAEP V     + A   V++  G    L   ++     V WYKDG++L+S  +V
Sbjct: 1613 LSFHLHVAEPKVVFAKEQPAHREVQAEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKV 1672

Query: 1316 QLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEE--PLLVKLVSELTPLTVHE 1373
            ++E  G  + L VQ A   DAGEY C+A      F + V E  P + +      PL V E
Sbjct: 1673 RVEAVGCTRRLVVQQAGQADAGEYSCEAGGQRLSFRLHVAELEPQISERPCRREPLVVKE 1732

Query: 1374 GDDATFRCEVSPPDA-DVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR 1432
             +D      ++ P A  VTWL++G  +    + E A  G +  LT+ G Q+ D+   + R
Sbjct: 1733 HEDIILTATLATPSAATVTWLKDGVEIRRSKRHETASQGDTHTLTVHGAQVLDSAIYSCR 1792

Query: 1433 AGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPH 1492
             G+      + V E    F R L+ V  E G  V L  E     A   V W  G   L  
Sbjct: 1793 VGAEGQDFPVQVEEVAAKFCRLLEPVCGELGGTVTLACELSP--ACAEVVWRCGNTQLRV 1850

Query: 1493 DSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVR-PRQLRVLRPLEDVTI 1551
              R  M  +G +  L + G+   D G Y CES  D T A+L+V  PR ++ +  L  V  
Sbjct: 1851 GKRFQMVAEGPVRSLTVLGLRAEDAGEYVCESRDDHTSAQLTVSVPRVVKFMSGLSTVVA 1910

Query: 1552 SEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSF 1611
             EGG ATFQ  +S   V   W R G  L P  K  I   G  H L ++ L L D+G ++ 
Sbjct: 1911 EEGGEATFQCVVSPSDVAVVWFRDGALLQPSEKFAISQSGASHSLTISDLVLEDAGQITV 1970

Query: 1612 TADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPS 1671
             A+    +A L VRE PV   +      V E  + T E EL++   ++ W ++  AL P 
Sbjct: 1971 EAEGASSSAALRVREAPVLFKKKLEPQTVEERSSVTLEVELTRPWPELRWTRNATALAPG 2030

Query: 1672 PRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAR 1731
              + + A G R  L L   G +D G + C     +    +LTV  R V ++  L++V AR
Sbjct: 2031 KNVEIHAEGARHRLVLHNVGFADRGFFGCETPDDKT-QAKLTVEMRQVRLVRGLQAVEAR 2089

Query: 1732 EGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQ 1791
            E   AT E  +S  +  G W   G   + G    +   G  H L LS LR ED+G + F+
Sbjct: 2090 EQGTATMEVQLSHADVDGSWTRDGLRFQQGPTCHLAVRGPMHTLTLSGLRPEDSGLMVFK 2149

Query: 1792 AGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPG 1851
            A    + A L V  LP+   R P ++       +  LE  +SR    V WL++G EL  G
Sbjct: 2150 AEGVHTSARLVVTELPVSFSR-PLQDVVTTEKEKVTLECELSRPNVDVRWLKDGVELRAG 2208

Query: 1852 DKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEG 1895
                + + G   SL I+     DQG Y C A    +   + V+G
Sbjct: 2209 KTMAIAAQGACRSLTIYRCEFADQGVYVCDAHDAQSSASVKVQG 2252



 Score =  605 bits (1561), Expect = e-172
 Identities = 483/1704 (28%), Positives = 765/1704 (44%), Gaps = 121/1704 (7%)

Query: 260  GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
            G  A+F C    +    + W+ +G  L     R +  D      L       +D G Y C
Sbjct: 812  GGPAQFECET-SEAHVHVHWYKDGMELGHSGERFLQEDVGTRHRLVAATVTRQDEGTYSC 870

Query: 320  AARNSAGQTLSAVQLHVKEPRLRFTRPL---QDVEGREHGIAVLECKVPNSRIPTAWFRE 376
                  G+     +L V EP++ F +     + ++      A L C+V  ++    W+++
Sbjct: 871  RV----GEDSVDFRLRVSEPKVVFAKEQLARRKLQAEAGASATLSCEVAQAQTEVTWYKD 926

Query: 377  DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPIL----- 431
             ++L    K      G  RRL++ +    D G Y CE  G+ R   ++ VK P +     
Sbjct: 927  GKKLSSSSKVCMEATGCTRRLVVQQAGQADAGEYSCEAGGQ-RLSFHLDVKEPKVVFAKD 985

Query: 432  KRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SSSGHMHALVLPGVT 488
            +    ++    G +A L  E  +A  E  W +DG++L    +    + G    LV+    
Sbjct: 986  QVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSSSLKVHVEAKGCRRRLVVQQAG 1045

Query: 489  REDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETP 548
            + DAG+ +      R +  L +         P ++    +   N V    +    A  + 
Sbjct: 1046 KTDAGDYSCEARGQRVSFRLHIT-------EPKMMFAKEQSVHNEVQA--EAGASAMLSC 1096

Query: 549  FIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDC----VPSEG--DYRFRICTVSGHGRSP 602
             + + + +    +D  +  S  K G +EV G      +P  G  D     C   G   S 
Sbjct: 1097 EVAQAQTEVTWYKDGKKLSSSSKVG-MEVKGCTRRLVLPQAGKADAGEYSCEAGGQRVSF 1155

Query: 603  HVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEG 661
            H+  H +      A+  +   +VQ   G  A+ S +++    + TW+ +G++L S+    
Sbjct: 1156 HL--HITEPKGVFAKEQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWYKDGKKLSSSS--- 1210

Query: 662  QVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESPVHILS 719
                   + R+E KG   RL++  V   D+G    +SC   G + S  L I E P  + +
Sbjct: 1211 -------KVRMEVKGCTRRLVVQQVGKADAGE---YSCEAGGQRVSFQLHITE-PKAVFA 1259

Query: 720  PQDRVSLTFTTSE--RVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPE 777
             +  V     T       L+CE+++     TWYKDG+K+  S  + ++  G   +L++ +
Sbjct: 1260 KEQLVHNEVRTEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQ 1319

Query: 778  AKVQDSGEFECRTEGVSAFFGVTVQDPP-VHIVDPREHVFVHAITSECVMLACEVDREDA 836
            A   D+GE+ C   G    F + V +P  V   +   H  V A       L+CEV +   
Sbjct: 1320 AGQADAGEYTCEAGGQRLSFHLDVSEPKAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQT 1379

Query: 837  PVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVS 896
             V WYKDG+++  S  V +E  G  RRLV+     +D GE+ C AG +   F++ + +  
Sbjct: 1380 EVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQQACQADTGEYSCEAGGQRLSFSLDVAEPK 1439

Query: 897  SWIVYPSGKVYVAAVRLER---VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVR 953
              +V+   +     V+ +      L+CE+ +   EV W KDG+++  S  + ++     R
Sbjct: 1440 --VVFAKEQPVHREVQAQAGASTTLSCEVAQAQTEVMWYKDGKKLSFSSKVRMEAVGCTR 1497

Query: 954  RLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLEC---VVLM 1010
            RLV+       +GEY CE   +  SF + V EP  + ++ +++     V  E      L 
Sbjct: 1498 RLVVQQAGQAVAGEYSCEAGSQRLSFHLHVAEP--KAVFAKEQPASREVQAEAGTSATLS 1555

Query: 1011 CELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFF 1070
            CE+++    V WYKDG ++  S  + +E  G   RLV+  A   D GE+ C AGD    F
Sbjct: 1556 CEVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQRLSF 1615

Query: 1071 TVTVTAPPERIV--HPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQ 1128
             + V  P        PA R +    GA     L CEVA A ++V WYKDG ++ +S  ++
Sbjct: 1616 HLHVAEPKVVFAKEQPAHREVQAEAGASAT--LSCEVAQAQTEVTWYKDGKKLSSSSKVR 1673

Query: 1129 LGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPG 1188
            + A G TR L +  A   DAGEY CE   + ++F + +AE   Q         PL V   
Sbjct: 1674 VEAVGCTRRLVVQQAGQADAGEYSCEAGGQRLSFRLHVAELEPQISERPCRREPLVVKEH 1733

Query: 1189 EPVVLSCELSR-AGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQS 1247
            E ++L+  L+  + A V W  +G  ++  +  E  ++G    L +  A    + +Y+C+ 
Sbjct: 1734 EDIILTATLATPSAATVTWLKDGVEIRRSKRHETASQGDTHTLTVHGAQVLDSAIYSCRV 1793

Query: 1248 GAAPGAPSLSFTVQVAEPPV---RVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYK 1304
            GA        F VQV E      R++ P   +       GG + L   LS     V W  
Sbjct: 1794 GAE----GQDFPVQVEEVAAKFCRLLEPVCGEL------GGTVTLACELSPACAEVVWRC 1843

Query: 1305 DGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVS 1364
               +L    R Q+   G  + L V G R+ DAGEY+C++  D     ++V  P +VK +S
Sbjct: 1844 GNTQLRVGKRFQMVAEGPVRSLTVLGLRAEDAGEYVCESRDDHTSAQLTVSVPRVVKFMS 1903

Query: 1365 ELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLG 1424
             L+ +   EG +ATF+C VSP D  V W R+GA++ P  +  ++Q+G+S  LT+    L 
Sbjct: 1904 GLSTVVAEEGGEATFQCVVSPSDVAVVWFRDGALLQPSEKFAISQSGASHSLTISDLVLE 1963

Query: 1425 DAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWV 1484
            DAG +T+ A   ++SA L VRE  +LF ++L+    EE   V LEVE  R      +RW 
Sbjct: 1964 DAGQITVEAEGASSSAALRVREAPVLFKKKLEPQTVEERSSVTLEVELTRPWPE--LRWT 2021

Query: 1485 RGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLR 1544
            R    L     + +  +G  HRL +H V  AD+G +GCE+  D+T A+L+V  RQ+R++R
Sbjct: 2022 RNATALAPGKNVEIHAEGARHRLVLHNVGFADRGFFGCETPDDKTQAKLTVEMRQVRLVR 2081

Query: 1545 PLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLA 1604
             L+ V   E G+AT +++LS   V G W R G++   GP CH+   G  H L L+GL   
Sbjct: 2082 GLQAVEAREQGTATMEVQLSHADVDGSWTRDGLRFQQGPTCHLAVRGPMHTLTLSGLRPE 2141

Query: 1605 DSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKD 1664
            DSG + F A+ +  +ARL+V E+PV+  R   D+  TE +  T ECELS+   DV W KD
Sbjct: 2142 DSGLMVFKAEGVHTSARLVVTELPVSFSRPLQDVVTTEKEKVTLECELSRPNVDVRWLKD 2201

Query: 1665 GNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTAR------------------ 1706
            G  L     + + A G  R L + RC  +D G Y C    A+                  
Sbjct: 2202 GVELRAGKTMAIAAQGACRSLTIYRCEFADQGVYVCDAHDAQSSASVKVQGRTYTLIYRR 2261

Query: 1707 -----AGPV-----------RLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGR 1750
                 AG +           +L V+E  V ++  LR   A E      EC VS      R
Sbjct: 2262 VLAEDAGEIQFVAENAESRAQLRVKELPVTLVRPLRDKIAMEKHRGVLECQVSRASAQVR 2321

Query: 1751 WELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQM 1810
            W  G + L+PG +  +  +G    L++S++ AED       AG  ++ A   VE   + +
Sbjct: 2322 WFKGSQELQPGPKYELVSDGLYRKLIISDVHAEDEDTYTCDAGDVKTSAQFFVEEQSITI 2381

Query: 1811 CRHPPREKTVLVGRRAVLEVTVS-RSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHD 1869
             R   ++ TV+    A  E   S  S     WL     L  G    +   G  H L++  
Sbjct: 2382 VR-GLQDVTVMEPAPAWFECETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRR 2440

Query: 1870 VRPEDQGTYCCQAGQDSTHTRLLV 1893
                  G      G+  +  RL+V
Sbjct: 2441 TCSTMTGPVHFTVGKSRSSARLVV 2464



 Score =  499 bits (1284), Expect = e-140
 Identities = 511/1946 (26%), Positives = 789/1946 (40%), Gaps = 189/1946 (9%)

Query: 21   VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
            V+  +GA A L C V  +    V W K G++L++S ++     G    L+L  A   DAG
Sbjct: 1084 VQAEAGASAMLSCEV-AQAQTEVTWYKDGKKLSSSSKVGMEVKGCTRRLVLPQAGKADAG 1142

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL 140
             Y C A    G    +  + + EP     + Q     + +                    
Sbjct: 1143 EYSCEA----GGQRVSFHLHITEPKGVFAKEQSVHNEVQAEA------------------ 1180

Query: 141  RGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAAR 200
             G   +L+C     P+  + W KDG  L     SS   ++        G +  L +    
Sbjct: 1181 -GTTAMLSCEVAQ-PQTEVTWYKDGKKLSS---SSKVRMEV------KGCTRRLVVQQVG 1229

Query: 201  LPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEG 260
              D+G Y C A    G  +    L + +P              V    +          G
Sbjct: 1230 KADAGEYSCEA----GGQRVSFQLHITEPKA------------VFAKEQLVHNEVRTEAG 1273

Query: 261  KHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQA--KDRGLYV 318
              A   C V  + + E+ W+ +G+ L    +    R    G + +++  QA   D G Y 
Sbjct: 1274 ASATLSCEV-AQAQTEVTWYKDGKKLSSSSK---VRIEAAGCMRQLVVQQAGQADAGEYT 1329

Query: 319  CAARNSAGQTLSAVQLHVKEPRLRFTRPL---QDVEGREHGIAVLECKVPNSRIPTAWFR 375
            C A    GQ LS   L V EP+  F +     + V+     IA L C+V  ++    W++
Sbjct: 1330 CEA---GGQRLS-FHLDVSEPKAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQTEVTWYK 1385

Query: 376  EDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGP---ILK 432
            + ++L    K      G  RRL++ +    D G Y CE  G+ R   ++ V  P     K
Sbjct: 1386 DGKKLSSSSKVRMEAVGCTRRLVVQQACQADTGEYSCEAGGQ-RLSFSLDVAEPKVVFAK 1444

Query: 433  RLP--RKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHALVLPGV 487
              P  R++    G +  L  E  +A  E  W +DG++L     +   + G    LV+   
Sbjct: 1445 EQPVHREVQAQAGASTTLSCEVAQAQTEVMWYKDGKKLSFSSKVRMEAVGCTRRLVVQQA 1504

Query: 488  TREDAGEVTFSLGNSRTTTLLRV---KCV--KHSPPGPPILAEMFKGHKNTVLLTWKPPE 542
             +  AGE +   G+ R +  L V   K V  K  P    + AE       +  L+ +  +
Sbjct: 1505 GQAVAGEYSCEAGSQRLSFHLHVAEPKAVFAKEQPASREVQAEA----GTSATLSCEVAQ 1560

Query: 543  PAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSE-----GDYRFRICTVSG 597
               E  +    ++    S+  ++     +   V+  G     E     GD R        
Sbjct: 1561 AQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQRLSFHL--- 1617

Query: 598  HGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKS 656
            H   P VVF         A+      +VQ   G  A  S +++    + TW+ +G++L S
Sbjct: 1618 HVAEPKVVF---------AKEQPAHREVQAEAGASATLSCEVAQAQTEVTWYKDGKKLSS 1668

Query: 657  NEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESP 714
            +           + R+E  G   RL++      D+G    +SC   G + S  L + E  
Sbjct: 1669 SS----------KVRVEAVGCTRRLVVQQAGQADAGE---YSCEAGGQRLSFRLHVAELE 1715

Query: 715  VHILS-PQDRVSLTFTTSERVVLTCELSRVDFPA-TWYKDGQKVEESELLVVKMDGRKHR 772
              I   P  R  L     E ++LT  L+       TW KDG ++  S+       G  H 
Sbjct: 1716 PQISERPCRREPLVVKEHEDIILTATLATPSAATVTWLKDGVEIRRSKRHETASQGDTHT 1775

Query: 773  LILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSEC------VM 826
            L +  A+V DS  + CR        G   QD PV + +     F   +   C      V 
Sbjct: 1776 LTVHGAQVLDSAIYSCRV-------GAEGQDFPVQVEEVAAK-FCRLLEPVCGELGGTVT 1827

Query: 827  LACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECA 886
            LACE+    A V W     ++       +  EGP R L +   +  D GE+ C + D+  
Sbjct: 1828 LACELSPACAEVVWRCGNTQLRVGKRFQMVAEGPVRSLTVLGLRAEDAGEYVCESRDDHT 1887

Query: 887  YFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLL 946
               +T++ V   + + SG   V A         C +      V W +DG  +  S    +
Sbjct: 1888 SAQLTVS-VPRVVKFMSGLSTVVAEEGGEATFQCVVSPSDVAVVWFRDGALLQPSEKFAI 1946

Query: 947  QKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPV---RIIYPRDEVTLIAVT 1003
             +      L +  + LED+G+   E +  S+S  + V E PV   + + P+      +VT
Sbjct: 1947 SQSGASHSLTISDLVLEDAGQITVEAEGASSSAALRVREAPVLFKKKLEPQTVEERSSVT 2006

Query: 1004 LECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDA 1063
            LE      EL+R    +RW ++   +   + + +  +G R RLVL      D G F C+ 
Sbjct: 2007 LEV-----ELTRPWPELRWTRNATALAPGKNVEIHAEGARHRLVLHNVGFADRGFFGCET 2061

Query: 1064 GDDSAFFTVTVTAPPERIVHPAARSLD-LHFGAPGRVELRCEVAPAGSQVRWYKDGLEVE 1122
             DD     +TV     R+V    R L  +     G   +  +++ A     W +DGL  +
Sbjct: 2062 PDDKTQAKLTVEMRQVRLV----RGLQAVEAREQGTATMEVQLSHADVDGSWTRDGLRFQ 2117

Query: 1123 ASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSP 1182
                  L   GP  TLTL   +PED+G  V +      +  +++ E PV F         
Sbjct: 2118 QGPTCHLAVRGPMHTLTLSGLRPEDSGLMVFKAEGVHTSARLVVTELPVSF---SRPLQD 2174

Query: 1183 LCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGL 1242
            +     E V L CELSR    V W  +G  ++ G+ + + A+G  R L I     A  G+
Sbjct: 2175 VVTTEKEKVTLECELSRPNVDVRWLKDGVELRAGKTMAIAAQGACRSLTIYRCEFADQGV 2234

Query: 1243 YTC-----QSGAAPGAPSLSFTV----QVAEPP--VRVVAPEA---AQTRVRSTP----- 1283
            Y C     QS A+      ++T+     +AE    ++ VA  A   AQ RV+  P     
Sbjct: 2235 YVCDAHDAQSSASVKVQGRTYTLIYRRVLAEDAGEIQFVAENAESRAQLRVKELPVTLVR 2294

Query: 1284 -----------GGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGAR 1332
                        G LE  V  S     VRW+K  + L    + +L   G  + L +    
Sbjct: 2295 PLRDKIAMEKHRGVLECQV--SRASAQVRWFKGSQELQPGPKYELVSDGLYRKLIISDVH 2352

Query: 1333 SGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA-DVT 1391
            + D   Y CDA          VEE  +  +V  L  +TV E   A F CE S P      
Sbjct: 2353 AEDEDTYTCDAGDVKTSAQFFVEEQSIT-IVRGLQDVTVMEPAPAWFECETSIPSVRPPK 2411

Query: 1392 WLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLF 1451
            WL    V+  G  V + Q G+   L LR       G V    G + +SARL V +  ++ 
Sbjct: 2412 WLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTGPVHFTVGKSRSSARLVVSDIPVVL 2471

Query: 1452 LRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHG 1511
             R L+     E Q V L  +     A  AV+W +   PL    +  M+ +G +  L I  
Sbjct: 2472 TRPLEPKTGRELQSVVLSCDFRP--APKAVQWYKDDTPLSPSEKFKMSLEGQMAELRILR 2529

Query: 1512 VILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGE 1571
            ++ AD G Y C++    +   ++V  R++ V  PL+D   +E G A+F  ELS E    E
Sbjct: 2530 LMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQDAEATEEGWASFSCELSHEDEEVE 2589

Query: 1572 WARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTI 1631
            W+  G+ LY      I   G RH LVL  +  AD+G V  ++  +  +ARL VR  PV  
Sbjct: 2590 WSLNGMPLYNDSFHEISHKGRRHTLVLKSIQRADAGIVRASSLKVSTSARLEVRVKPVVF 2649

Query: 1632 VRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLR-LQALGTRRLLQLRRC 1690
            ++   DL   E  T   +CE+S   A V W KDG  L PS +   L   GTR L+ +   
Sbjct: 2650 LKALDDLSAEERGTLALQCEVSDPEAHVVWRKDGVQLGPSDKYDFLHTAGTRGLV-VHDV 2708

Query: 1691 GPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETT-- 1748
             P DAG Y+C VG+      R+ V +  V +   L+++   EG+  +FEC +S    +  
Sbjct: 2709 SPEDAGLYTCHVGSEET-RARVRVHDLHVGITKRLKTMEVLEGESCSFECVLSHESASDP 2767

Query: 1749 GRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPL 1808
              W +GG+ +   +R +  ++G+K+ILV+ E    DAGEV F      S A L V   P 
Sbjct: 2768 AMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSVRGLTSKASLIVRERPA 2827

Query: 1809 QMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIH 1868
             + + P  ++ V  G    L   +SR+G  V WL++   +    KY++   G    LVI 
Sbjct: 2828 AIIK-PLEDQWVAPGEDVELRCELSRAGTPVHWLKDRKAIRKSQKYDVVCEGTMAMLVIR 2886

Query: 1869 DVRPEDQGTYCCQAGQDSTHTRLLVE 1894
                +D G Y C+     +   L VE
Sbjct: 2887 GASLKDAGEYTCEVEASKSTASLHVE 2912



 Score =  497 bits (1280), Expect = e-140
 Identities = 512/1913 (26%), Positives = 781/1913 (40%), Gaps = 178/1913 (9%)

Query: 19   RPVRVVSGAEAELKCVVLG----EPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
            RP+   +G E  L+ VVL       P  V W K    L+ SE+     +G    L +   
Sbjct: 2473 RPLEPKTGRE--LQSVVLSCDFRPAPKAVQWYKDDTPLSPSEKFKMSLEGQMAELRILRL 2530

Query: 75   LPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGP 134
            +P DAGVY C+A    G A+++  VTV                       E   V +TGP
Sbjct: 2531 MPADAGVYRCQA----GSAHSSTEVTV-----------------------EAREVTVTGP 2563

Query: 135  RSQWVLRGAEVV------LTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP 188
                 L+ AE         +C      E  + W  +GM L    DS H     GR     
Sbjct: 2564 -----LQDAEATEEGWASFSCELSHEDEE-VEWSLNGMPLYN--DSFHEISHKGRRH--- 2612

Query: 189  GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
                 L + + +  D+G+     R +       A L+V   P              V  L
Sbjct: 2613 ----TLVLKSIQRADAGI----VRASSLKVSTSARLEVRVKP--------------VVFL 2650

Query: 249  KCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLP-DRRRLMYRDRDGGFVLKVL 307
            K          G  A  +C V   PE  + W  +G  L P D+   ++     G V+  +
Sbjct: 2651 KALDDLSAEERGTLA-LQCEV-SDPEAHVVWRKDGVQLGPSDKYDFLHTAGTRGLVVHDV 2708

Query: 308  YCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNS 367
                +D GLY C      G   +  ++ V +  +  T+ L+ +E  E      EC + + 
Sbjct: 2709 --SPEDAGLYTC----HVGSEETRARVRVHDLHVGITKRLKTMEVLEGESCSFECVLSHE 2762

Query: 368  RI--PTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVT 425
                P  W    + +    +++   +G    L++      D G  +  +RG     + + 
Sbjct: 2763 SASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSVRGLTSKASLIV 2822

Query: 426  VKGP--ILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRD------GEELPVICQSSSG 477
             + P  I+K L  +  V  GE+  L  E   AG    W +D       ++  V+C+   G
Sbjct: 2823 RERPAAIIKPLEDQW-VAPGEDVELRCELSRAGTPVHWLKDRKAIRKSQKYDVVCE---G 2878

Query: 478  HMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLT 537
             M  LV+ G + +DAGE T  +  S++T  L V+  + +      L  +    K T + T
Sbjct: 2879 TMAMLVIRGASLKDAGEYTCEVEASKSTASLHVE--EKANCFTEELTNLQVEEKGTAVFT 2936

Query: 538  WKPPEPAPETPFIYRL---------ERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDY 588
             K   PA    +   L         +  + G    +   ++EKA +     D   ++   
Sbjct: 2937 CKTEHPAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKADSDTYTCDIGQAQSRA 2996

Query: 589  RFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGT-- 646
            +  +      GR  H++                LEDV V +G  A F   +S        
Sbjct: 2997 QLLV-----QGRRVHII--------------EDLEDVDVQEGSSATFRCRISPANYEPVH 3037

Query: 647  WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSA 706
            WFL+   L +NE         L     Q G  H L L  +  +DSG +  F     + SA
Sbjct: 3038 WFLDKTPLHANE---------LNEIDAQPGGYHVLTLRQLALKDSGTIY-FEAGDQRASA 3087

Query: 707  ALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKM 766
            AL + E P   +  ++    T T  E + L CE S  D P  W KDG+ +  S    +  
Sbjct: 3088 ALRVTEKPS--VFSRELTDATITEGEDLTLVCETSTCDIPVCWTKDGKTLRGSARCQLSH 3145

Query: 767  DGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVM 826
            +G + +L++  A +QDSG ++C   G  +   V V   PV   +  + + V  +      
Sbjct: 3146 EGHRAQLLITGATLQDSGRYKCEAGGACSSSIVRVHARPVRFQEALKDLEV--LEGGAAT 3203

Query: 827  LACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECA 886
            L C +    APV+W      +   D   L  EG    LV+   +P D G + C  GD+  
Sbjct: 3204 LRCVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAMLELVVRNLRPQDSGRYSCSFGDQTT 3263

Query: 887  YFTVTITDVSSWIVYPSGKVY-VAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALL 945
              T+T+T + +  +   GK+    A       L CEL +  A V W K  E + +     
Sbjct: 3264 SATLTVTALPAQFI---GKLRNKEATEGATATLRCELSKA-APVEWRKGSETLRDGDRYC 3319

Query: 946  LQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYP-RDEVTLIAVTL 1004
            L+++  +  L +  + + D+ EY C   +E  S ++T+   P   I   R + ++   T 
Sbjct: 3320 LRQDGAMCELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFIGRLRHQESIEGAT- 3378

Query: 1005 ECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAG 1064
                L CELS+  APV W K    + + +   L +DG  C L +      D GE+ C  G
Sbjct: 3379 --ATLRCELSKA-APVEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSCVCG 3435

Query: 1065 DDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEAS 1124
            ++    T+TV A P +      R+ +   GA     L CE++   + V W K    +   
Sbjct: 3436 EERTSATLTVKALPAKFTE-GLRNEEAVEGATAM--LWCELSKV-APVEWRKGPENLRDG 3491

Query: 1125 DALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLC 1184
            D   L  EG    L +      DAGEY+C    E  +  + +   P +F+          
Sbjct: 3492 DRYILRQEGTRCELQICGLAMADAGEYLCVCGQERTSATLTIRALPARFIEDVKNQE--- 3548

Query: 1185 VAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYT 1244
               G   VL CEL+ A APV W      +++G+   L  +G +  L I+    A  G Y+
Sbjct: 3549 AREGATAVLQCELNSA-APVEWRKGSETLRDGDRYSLRQDGTKCELQIRGLAMADTGEYS 3607

Query: 1245 CQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYK 1304
            C  G    +  L+    V   P++            +T G    L   LS    PV W+K
Sbjct: 3608 CVCGQERTSAMLT----VRALPIKFTE---GLRNEEATEGATAVLRCELSKMA-PVEWWK 3659

Query: 1305 DGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVS 1364
              E L    R  L Q GAR  L+++G  + DAGEYLC   ++    +++V   +  K + 
Sbjct: 3660 GHETLRDGDRHSLRQDGARCELQIRGLVAEDAGEYLCMCGKERTSAMLTVRA-MPSKFIE 3718

Query: 1365 ELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLG 1424
             L      EGD AT  CE+S   A V W +    +  G +  + Q+GS   L +RG  + 
Sbjct: 3719 GLRNEEATEGDTATLWCELSKA-APVEWRKGHETLRDGDRHSLRQDGSRCELQIRGLAVV 3777

Query: 1425 DAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWV 1484
            DAG  +   G   TSA L VR     F+  +++  A EG    L+ E  +   A  V W 
Sbjct: 3778 DAGEYSCVCGQERTSATLTVRALPARFIEDVKNQEAREGATAVLQCELSK---AAPVEWR 3834

Query: 1485 RGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLR 1544
            +G + L    R S+ QDG    L IHG+ +AD G Y C    +RT A L+VR  Q     
Sbjct: 3835 KGSETLRGGDRYSLRQDGTRCELQIHGLSVADTGEYSCVCGQERTSATLTVRAPQPVFRE 3894

Query: 1545 PLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLA 1604
            PL+ +   EG +AT Q ELS+   T  W++GG+QL    +      G    LVL  L   
Sbjct: 3895 PLQSLQAEEGSTATLQCELSEPTATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQRE 3954

Query: 1605 DSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKD 1664
            D+G  + T  S   +A L V   PV  +R     EV EG TA   CELS+A A V W K 
Sbjct: 3955 DTGEYTCTCGSQATSATLTVTAAPVRFLRELQHQEVDEGGTAHLCCELSRAGASVEWRKG 4014

Query: 1665 GNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSE 1724
               L P  + ++   G    L +R     DAG Y+C  G  ++    L+VR       + 
Sbjct: 4015 SLQLFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCDTGHTQS-MASLSVRVPRPKFKTR 4073

Query: 1725 LRSVSAREGDGATFECTVSEVETTG--RWELGGRPLRPGARVRIRQEGKKHILVLSELRA 1782
            L+S+    GD A   C +S+ E+    +W   G  L  G +  +R +G    L++ +L A
Sbjct: 4074 LQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEA 4133

Query: 1783 EDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGG-HVCW 1841
            +D GE     G  ++ A L V    + + R    +  V           VSR+G   V W
Sbjct: 4134 KDTGEYACVTGGQKTAASLRVTEPEVTIVRGLV-DAEVTADEDVEFSCEVSRAGATGVQW 4192

Query: 1842 LREGAELCPGDKYEMR-SHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLV 1893
              +G  L   +  E+    G  H+L +  V PED GT     G  ++  +L V
Sbjct: 4193 CLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTV 4245



 Score =  450 bits (1158), Expect = e-126
 Identities = 501/1891 (26%), Positives = 762/1891 (40%), Gaps = 174/1891 (9%)

Query: 39   PPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC---RARNAAGEAYA 95
            P   V W KG  +L AS +     +G    L ++A    D+  Y C   +A++ A     
Sbjct: 2942 PAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKADSDTYTCDIGQAQSRAQLLVQ 3001

Query: 96   AAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLP 155
               V ++E      +L+  +                       V  G+     CR     
Sbjct: 3002 GRRVHIIE------DLEDVD-----------------------VQEGSSATFRCRISPAN 3032

Query: 156  EPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAH 215
               ++W  D   L         A +    +  PG    L +    L DSG     A    
Sbjct: 3033 YEPVHWFLDKTPLH--------ANELNEIDAQPGGYHVLTLRQLALKDSGTIYFEA---- 3080

Query: 216  GHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEP 275
            G  +A A L+V + P     +  +A                + EG+     C       P
Sbjct: 3081 GDQRASAALRVTEKPSVFSRELTDAT---------------ITEGEDLTLVCETSTCDIP 3125

Query: 276  EIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLH 335
             + W  +G+ L    R  +  +     +L +     +D G Y C A  +   ++  V++H
Sbjct: 3126 -VCWTKDGKTLRGSARCQLSHEGHRAQLL-ITGATLQDSGRYKCEAGGACSSSI--VRVH 3181

Query: 336  VKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVR 395
             +   +RF   L+D+E  E G A L C + +   P  W   +  L P  KY   +EG + 
Sbjct: 3182 ARP--VRFQEALKDLEVLEGGAATLRCVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAML 3239

Query: 396  RLIIHRLKADDDGIYLCEMRGRVRTVANVTV---KGPILKRLPRKLDVLEGENAVLLVET 452
             L++  L+  D G Y C   G   T A +TV       + +L R  +  EG  A L  E 
Sbjct: 3240 ELVVRNLRPQDSGRYSCSF-GDQTTSATLTVTALPAQFIGKL-RNKEATEGATATLRCEL 3297

Query: 453  LEAG-VEGRWS----RDGEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTL 507
             +A  VE R      RDG+     C    G M  L + G+   DA E +   G  RT+  
Sbjct: 3298 SKAAPVEWRKGSETLRDGDR---YCLRQDGAMCELQIRGLAMVDAAEYSCVCGEERTSAS 3354

Query: 508  LRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCF 567
            L ++ +     G     E  +G   T+       E +   P  +R  R+ +   D     
Sbjct: 3355 LTIRPMPAHFIGRLRHQESIEGATATLRC-----ELSKAAPVEWRKGRESLRDGD---RH 3406

Query: 568  SIEKAGAV---EVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLED 624
            S+ + GAV   ++ G  V   G+Y      V G  R+   +   +   +P A+   GL +
Sbjct: 3407 SLRQDGAVCELQICGLAVADAGEY----SCVCGEERTSATL---TVKALP-AKFTEGLRN 3458

Query: 625  VQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILH 684
             +  +G  A+   +LS +    W    E L+  +          RY + Q+G +  L + 
Sbjct: 3459 EEAVEGATAMLWCELSKVAPVEWRKGPENLRDGD----------RYILRQEGTRCELQIC 3508

Query: 685  AVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD 744
             +   D+G  +   C   + SA LTI+  P   +  +D  +         VL CEL+   
Sbjct: 3509 GLAMADAGEYL-CVCGQERTSATLTIRALPARFI--EDVKNQEAREGATAVLQCELNSA- 3564

Query: 745  FPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDP 804
             P  W K  + + + +   ++ DG K  L +    + D+GE+ C          +TV+  
Sbjct: 3565 APVEWRKGSETLRDGDRYSLRQDGTKCELQIRGLAMADTGEYSCVCGQERTSAMLTVRAL 3624

Query: 805  PVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRL 864
            P+   +   +    A      +L CE+ +  APV W+K  + + + D   L  +G    L
Sbjct: 3625 PIKFTEGLRN--EEATEGATAVLRCELSKM-APVEWWKGHETLRDGDRHSLRQDGARCEL 3681

Query: 865  VLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCR 924
             +      D GE+ C+ G E     +T+  + S  +   G     A   +   L CEL +
Sbjct: 3682 QIRGLVAEDAGEYLCMCGKERTSAMLTVRAMPSKFI--EGLRNEEATEGDTATLWCELSK 3739

Query: 925  PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVT 984
              A V W K  E + +     L+++ +   L +  + + D+GEY C    E  S T+TV 
Sbjct: 3740 A-APVEWRKGHETLRDGDRHSLRQDGSRCELQIRGLAVVDAGEYSCVCGQERTSATLTVR 3798

Query: 985  EPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRC 1044
              P R I   D     A      VL CELS+  APV W K    +   +   L +DG RC
Sbjct: 3799 ALPARFI--EDVKNQEAREGATAVLQCELSKA-APVEWRKGSETLRGGDRYSLRQDGTRC 3855

Query: 1045 RLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCE 1104
             L +      D GE+ C  G +    T+TV A P+ +     +SL    G+     L+CE
Sbjct: 3856 ELQIHGLSVADTGEYSCVCGQERTSATLTVRA-PQPVFREPLQSLQAEEGS--TATLQCE 3912

Query: 1105 VAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNV 1164
            ++   + V W K GL+++A+   +   +G T  L L   Q ED GEY C    +A +  +
Sbjct: 3913 LSEPTATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQREDTGEYTCTCGSQATSATL 3972

Query: 1165 ILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAE 1224
             +   PV+FL          V  G    L CELSRAGA V W      +      ++  +
Sbjct: 3973 TVTAAPVRFLRELQHQE---VDEGGTAHLCCELSRAGASVEWRKGSLQLFPCAKYQMVQD 4029

Query: 1225 GPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRS--- 1281
            G    L ++      AG YTC +G      SLS         VRV  P+  +TR++S   
Sbjct: 4030 GAAAELLVRGVEQEDAGDYTCDTGHTQSMASLS---------VRVPRPK-FKTRLQSLEQ 4079

Query: 1282 TPGGDLELVVHLSG--PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEY 1339
              G    L   LS    G  V+W K+G  L +  + ++   GA + L +    + D GEY
Sbjct: 4080 ETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEAKDTGEY 4139

Query: 1340 LCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA-DVTWLRNGAV 1398
             C          + V EP  V +V  L    V   +D  F CEVS   A  V W   G  
Sbjct: 4140 ACVTGGQKTAASLRVTEP-EVTIVRGLVDAEVTADEDVEFSCEVSRAGATGVQWCLQGLP 4198

Query: 1399 VTPGPQVEMA-QNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQD 1457
            +      E+A ++G    L L+G    DAGTV+   G+ A+SA+L VR  E+  L  LQD
Sbjct: 4199 LQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTVRAPEVTILEPLQD 4258

Query: 1458 VRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSM-AQDGHIHRLFIHGVILAD 1516
            V+  EGQD   +    R     A RW  GG PL  +    +  + G +H L +H V L D
Sbjct: 4259 VQLSEGQDASFQCRLSRASGQEA-RWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLED 4317

Query: 1517 QGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGE-WARG 1575
             GT         + A+L V  +   V+R LE+V   EGG A F+ +LSQ  V    W   
Sbjct: 4318 AGTVSFHVGTCSSEAQLKVTAKN-TVVRGLENVEALEGGEALFECQLSQPEVAAHTWLLD 4376

Query: 1576 GVQLYPGPKCHI--HSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVR 1633
               ++      +    +G RH L+L  L   DS  V+F A  +  +A L VR   + I+ 
Sbjct: 4377 DEPVHTSENAEVVFFENGLRHLLLLKNLRPQDSCRVTFLAGDMVTSAFLTVRGWRLEILE 4436

Query: 1634 GPHDLEVTEGDTATFECELSQA--LADVTWEKDGNALTPSPR-LRLQALGTRRLLQLRRC 1690
               +  V  G  A F C LS+A  + + +W  +G A+ P      + A G+   L LR  
Sbjct: 4437 PLKNAAVRAGAQACFTCTLSEAVPVGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSA 4496

Query: 1691 GPSDAG--TYSC--AVGTARAGPVRL---------TVRERTVAVLSELRSVSAREGDGAT 1737
             P  AG  T++C  AV +AR   + L           R      LS    +S   G    
Sbjct: 4497 QPHHAGEVTFACRDAVASARLTVLGLPDPPEDAEVVARSSHTVTLSWAAPMSDGGGGLCG 4556

Query: 1738 FECTVSEVETTGRWELGGRPLRPGARVRI--RQEGKKHILVLSELRAEDAGEVRFQAGPA 1795
            +   V E   TG+W L    L PG    +     G+ +   ++ +    AGE        
Sbjct: 4557 YRVEVKE-GATGQWRL-CHELVPGPECVVDGLAPGETYRFRVAAVGPVGAGE---PVHLP 4611

Query: 1796 QSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYE 1855
            Q++ L E    P+      P  + V  G    LE+ V    G V W +    + PG ++E
Sbjct: 4612 QTVRLAE-PPKPVPPQPSAPESRQVAAGEDVSLELEVVAEAGEVIWHKGMERIQPGGRFE 4670

Query: 1856 MRSHGPTHSLVIHDVRPEDQGTYCCQAGQDS 1886
            + S G    LVI     EDQG Y C   Q S
Sbjct: 4671 VVSQGRQQMLVIKGFTAEDQGEYHCGLAQGS 4701



 Score =  427 bits (1098), Expect = e-119
 Identities = 442/1765 (25%), Positives = 696/1765 (39%), Gaps = 127/1765 (7%)

Query: 155  PEPTLYWEKDGMAL--DEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHAR 212
            PE  + W KDG+ L   + +D  H A   G           L +      D+G+Y CH  
Sbjct: 2673 PEAHVVWRKDGVQLGPSDKYDFLHTAGTRG-----------LVVHDVSPEDAGLYTCHV- 2720

Query: 213  NAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGK 272
               G  +  A ++VH           +    + + LK    T  V EG+   F C +  +
Sbjct: 2721 ---GSEETRARVRVH-----------DLHVGITKRLK----TMEVLEGESCSFECVLSHE 2762

Query: 273  PEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAV 332
               +      G   +    R     +   ++L V      D G  V + R       S  
Sbjct: 2763 SASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSVRGLT----SKA 2818

Query: 333  QLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEG 392
             L V+E      +PL+D          L C++  +  P  W ++ + +   +KY+ + EG
Sbjct: 2819 SLIVRERPAAIIKPLEDQWVAPGEDVELRCELSRAGTPVHWLKDRKAIRKSQKYDVVCEG 2878

Query: 393  TVRRLIIHRLKADDDGIYLCEMRGRVRTVA-NVTVKGPILKRLPRKLDVLEGENAVLLVE 451
            T+  L+I      D G Y CE+     T + +V  K          L V E   AV   +
Sbjct: 2879 TMAMLVIRGASLKDAGEYTCEVEASKSTASLHVEEKANCFTEELTNLQVEEKGTAVFTCK 2938

Query: 452  TLEAGVEGRWSRDGEELPVICQ---SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLL 508
            T        W +   EL    +   S  G    L +  + + D+   T  +G +++   L
Sbjct: 2939 TEHPAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKADSDTYTCDIGQAQSRAQL 2998

Query: 509  RVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAP------ETPFIYRLERQEVGSED 562
             V+  +          ++ +G   T      P    P      +TP ++  E  E+ ++ 
Sbjct: 2999 LVQGRRVHIIEDLEDVDVQEGSSATFRCRISPANYEPVHWFLDKTP-LHANELNEIDAQP 3057

Query: 563  WIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTAR---LV 619
                    +  A++  G      GD R                   SA L  T +     
Sbjct: 3058 GGYHVLTLRQLALKDSGTIYFEAGDQR------------------ASAALRVTEKPSVFS 3099

Query: 620  AGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQ 678
              L D  + +GED     + ST  I   W  +G+ L+          G+ R ++  +G +
Sbjct: 3100 RELTDATITEGEDLTLVCETSTCDIPVCWTKDGKTLR----------GSARCQLSHEGHR 3149

Query: 679  HRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVL 736
             +L++     QDSG    + C   G   S+ + +   PV     +    L         L
Sbjct: 3150 AQLLITGATLQDSGR---YKCEAGGACSSSIVRVHARPVRF--QEALKDLEVLEGGAATL 3204

Query: 737  TCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF 796
             C LS V  P  W      +   +   ++ +G    L++   + QDSG + C     +  
Sbjct: 3205 RCVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAMLELVVRNLRPQDSGRYSCSFGDQTTS 3264

Query: 797  FGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLE 856
              +TV   P   +    +    A       L CE+ +  APV W K  + + + D   L 
Sbjct: 3265 ATLTVTALPAQFIGKLRNK--EATEGATATLRCELSKA-APVEWRKGSETLRDGDRYCLR 3321

Query: 857  NEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKV-YVAAVRLER 915
             +G    L +      D  E+ CV G+E    ++TI  + +  +   G++ +  ++    
Sbjct: 3322 QDGAMCELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFI---GRLRHQESIEGAT 3378

Query: 916  VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE 975
              L CEL +  A V W K  E + +     L+++  V  L +  + + D+GEY C   +E
Sbjct: 3379 ATLRCELSKA-APVEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSCVCGEE 3437

Query: 976  SASFTVTVTEPPVRIIYP-RDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEA 1034
              S T+TV   P +     R+E  +   T    +L CELS+  APV W K    + + + 
Sbjct: 3438 RTSATLTVKALPAKFTEGLRNEEAVEGAT---AMLWCELSKV-APVEWRKGPENLRDGDR 3493

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFG 1094
             +L ++G RC L +      D GE++C  G +    T+T+ A P R +    ++ +   G
Sbjct: 3494 YILRQEGTRCELQICGLAMADAGEYLCVCGQERTSATLTIRALPARFIEDV-KNQEAREG 3552

Query: 1095 APGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCE 1154
            A     L+CE+  A + V W K    +   D   L  +G    L +      D GEY C 
Sbjct: 3553 ATA--VLQCELNSA-APVEWRKGSETLRDGDRYSLRQDGTKCELQIRGLAMADTGEYSCV 3609

Query: 1155 TRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQ 1214
               E  +  + +   P++F              G   VL CELS+  APV W      ++
Sbjct: 3610 CGQERTSAMLTVRALPIKFTEGLRNEE---ATEGATAVLRCELSKM-APVEWWKGHETLR 3665

Query: 1215 EGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEA 1274
            +G+   L  +G R  L I+      AG Y C  G    +  L+    V   P + +    
Sbjct: 3666 DGDRHSLRQDGARCELQIRGLVAEDAGEYLCMCGKERTSAMLT----VRAMPSKFIE--- 3718

Query: 1275 AQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSG 1334
                  +T G    L   LS    PV W K  E L    R  L Q G+R  L+++G    
Sbjct: 3719 GLRNEEATEGDTATLWCELS-KAAPVEWRKGHETLRDGDRHSLRQDGSRCELQIRGLAVV 3777

Query: 1335 DAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLR 1394
            DAGEY C   Q+     ++V   L  + + ++      EG  A  +CE+S   A V W +
Sbjct: 3778 DAGEYSCVCGQERTSATLTVRA-LPARFIEDVKNQEAREGATAVLQCELSKA-APVEWRK 3835

Query: 1395 NGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRR 1454
                +  G +  + Q+G+   L + G  + D G  +   G   TSA L VR  + +F   
Sbjct: 3836 GSETLRGGDRYSLRQDGTRCELQIHGLSVADTGEYSCVCGQERTSATLTVRAPQPVFREP 3895

Query: 1455 LQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVIL 1514
            LQ ++AEEG    L+ E     A   V W +GG  L  + R      G    L +  +  
Sbjct: 3896 LQSLQAEEGSTATLQCELSEPTAT--VVWSKGGLQLQANGRREPRLQGCTAELVLQDLQR 3953

Query: 1515 ADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWAR 1574
             D G Y C      T A L+V    +R LR L+   + EGG+A    ELS+ G + EW +
Sbjct: 3954 EDTGEYTCTCGSQATSATLTVTAAPVRFLRELQHQEVDEGGTAHLCCELSRAGASVEWRK 4013

Query: 1575 GGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRG 1634
            G +QL+P  K  +  DG    L++ G+   D+G  +      +  A L VR         
Sbjct: 4014 GSLQLFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCDTGHTQSMASLSVRVPRPKFKTR 4073

Query: 1635 PHDLEVTEGDTATFECELSQAL--ADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGP 1692
               LE   GD A   C+LS A   A V W K+G  L   P+  +++ G  R L + +   
Sbjct: 4074 LQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEA 4133

Query: 1693 SDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RW 1751
             D G Y+C  G  +     L V E  V ++  L        +   F C VS    TG +W
Sbjct: 4134 KDTGEYACVTGGQKTA-ASLRVTEPEVTIVRGLVDAEVTADEDVEFSCEVSRAGATGVQW 4192

Query: 1752 ELGGRPLRPGARVRIR-QEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQM 1810
             L G PL+      +  ++G+ H L L  +  EDAG V F  G   S A L V A P   
Sbjct: 4193 CLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTVRA-PEVT 4251

Query: 1811 CRHPPREKTVLVGRRAVLEVTVSRSGGHVC-WLREGAELCPGDKYEMR-SHGPTHSLVIH 1868
               P ++  +  G+ A  +  +SR+ G    W   G  L   +  ++    G  H L +H
Sbjct: 4252 ILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLH 4311

Query: 1869 DVRPEDQGTYCCQAGQDSTHTRLLV 1893
             V  ED GT     G  S+  +L V
Sbjct: 4312 KVTLEDAGTVSFHVGTCSSEAQLKV 4336



 Score =  404 bits (1039), Expect = e-112
 Identities = 472/1941 (24%), Positives = 733/1941 (37%), Gaps = 180/1941 (9%)

Query: 21   VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
            V+  +G  A L C V  +P   V W K G++L++S ++     G    L++      DAG
Sbjct: 1176 VQAEAGTTAMLSCEV-AQPQTEVTWYKDGKKLSSSSKVRMEVKGCTRRLVVQQVGKADAG 1234

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL 140
             Y C A    G    +  + + EP A   + Q     + +                    
Sbjct: 1235 EYSCEA----GGQRVSFQLHITEPKAVFAKEQLVHNEVRTEA------------------ 1272

Query: 141  RGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAAR 200
             GA   L+C      +  + W KDG  L     SS   ++        G    L +  A 
Sbjct: 1273 -GASATLSCEVAQA-QTEVTWYKDGKKLSS---SSKVRIEAA------GCMRQLVVQQAG 1321

Query: 201  LPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEG 260
              D+G Y C A         G  L  H     P A        V    + A +      G
Sbjct: 1322 QADAGEYTCEA--------GGQRLSFHLDVSEPKA--------VFAKEQLAHRKVQAEAG 1365

Query: 261  KHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCA 320
              A   C V  + + E+ W+ +G+ L    +  M        ++    CQA D G Y C 
Sbjct: 1366 AIATLSCEV-AQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQQACQA-DTGEYSCE 1423

Query: 321  ARNSAGQTLSAVQLHVKEPRLRFTRPL---QDVEGREHGIAVLECKVPNSRIPTAWFRED 377
            A    GQ LS   L V EP++ F +     ++V+ +      L C+V  ++    W+++ 
Sbjct: 1424 A---GGQRLS-FSLDVAEPKVVFAKEQPVHREVQAQAGASTTLSCEVAQAQTEVMWYKDG 1479

Query: 378  QRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGP---ILKRL 434
            ++L    K      G  RRL++ +      G Y CE  G  R   ++ V  P     K  
Sbjct: 1480 KKLSFSSKVRMEAVGCTRRLVVQQAGQAVAGEYSCEA-GSQRLSFHLHVAEPKAVFAKEQ 1538

Query: 435  P--RKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHALVLPGVTR 489
            P  R++    G +A L  E  +A  E  W +DG++L     +   + G    LV+    +
Sbjct: 1539 PASREVQAEAGTSATLSCEVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQ 1598

Query: 490  EDAGEVTFSLGNSRTTTLL-----RVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPA 544
             DAGE +   G+ R +  L     +V   K  P    + AE       +  L+ +  +  
Sbjct: 1599 ADAGEYSCKAGDQRLSFHLHVAEPKVVFAKEQPAHREVQAEAGA----SATLSCEVAQAQ 1654

Query: 545  PETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRS--P 602
             E  +    ++    S+  ++     +   V+  G      G+Y    C   G   S   
Sbjct: 1655 TEVTWYKDGKKLSSSSKVRVEAVGCTRRLVVQQAGQA--DAGEYS---CEAGGQRLSFRL 1709

Query: 603  HVVFHGSAHLVPT-ARLVAGLEDVQVYDGEDAVFSLDLSTIIQGT--WFLNGEELKSNEP 659
            HV     A L P  +      E + V + ED + +  L+T    T  W  +G E++ ++ 
Sbjct: 1710 HV-----AELEPQISERPCRREPLVVKEHEDIILTATLATPSAATVTWLKDGVEIRRSK- 1763

Query: 660  EGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILS 719
                     R+    +G  H L +H  +  DS     +SC    +     +Q   V    
Sbjct: 1764 ---------RHETASQGDTHTLTVHGAQVLDSAI---YSCRVGAEGQDFPVQVEEVAAKF 1811

Query: 720  PQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAK 779
             +    +       V L CELS       W     ++   +   +  +G    L +   +
Sbjct: 1812 CRLLEPVCGELGGTVTLACELSPACAEVVWRCGNTQLRVGKRFQMVAEGPVRSLTVLGLR 1871

Query: 780  VQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVR 839
             +D+GE+ C +        +TV  P V          V     E     C V   D  V 
Sbjct: 1872 AEDAGEYVCESRDDHTSAQLTVSVPRVVKFMSGLSTVVAEEGGEATF-QCVVSPSDVAVV 1930

Query: 840  WYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWI 899
            W++DG  ++ S+   +   G    L +      D G+    A    +   + + +    +
Sbjct: 1931 WFRDGALLQPSEKFAISQSGASHSLTISDLVLEDAGQITVEAEGASSSAALRVREAP--V 1988

Query: 900  VYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPA 959
            ++              V L  EL RPW E+RWT++   +     + +  E    RLVL  
Sbjct: 1989 LFKKKLEPQTVEERSSVTLEVELTRPWPELRWTRNATALAPGKNVEIHAEGARHRLVLHN 2048

Query: 960  VQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP 1019
            V   D G + CE  D+     +TV    VR++  R    + A       +  +LS  D  
Sbjct: 2049 VGFADRGFFGCETPDDKTQAKLTVEMRQVRLV--RGLQAVEAREQGTATMEVQLSHADVD 2106

Query: 1020 VRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPE 1079
              W +DGL  ++     L   GP   L L   +PED G  V  A        + VT  P 
Sbjct: 2107 GSWTRDGLRFQQGPTCHLAVRGPMHTLTLSGLRPEDSGLMVFKAEGVHTSARLVVTELPV 2166

Query: 1080 RIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLT 1139
                P     D+      +V L CE++     VRW KDG+E+ A   + + A+G  R+LT
Sbjct: 2167 SFSRPLQ---DVVTTEKEKVTLECELSRPNVDVRWLKDGVELRAGKTMAIAAQGACRSLT 2223

Query: 1140 LPHAQPEDAGEYVCETRHEA--------------ITFNVILAEPP--VQFLALETTPSPL 1183
            +   +  D G YVC+  H+A              + +  +LAE    +QF+A        
Sbjct: 2224 IYRCEFADQGVYVCDA-HDAQSSASVKVQGRTYTLIYRRVLAEDAGEIQFVAENAESRAQ 2282

Query: 1184 CVAPGEPV-----------------VLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGP 1226
                  PV                 VL C++SRA A V W    + +Q G   EL ++G 
Sbjct: 2283 LRVKELPVTLVRPLRDKIAMEKHRGVLECQVSRASAQVRWFKGSQELQPGPKYELVSDGL 2342

Query: 1227 RRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGD 1286
             R L I          YTC +G      S  F V+  E  + +V      T +   P   
Sbjct: 2343 YRKLIISDVHAEDEDTYTCDAGDVK--TSAQFFVE--EQSITIVRGLQDVTVMEPAPAW- 2397

Query: 1287 LELVVHLSGPG-GPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAG--EYLCDA 1343
                   S P   P +W      L + G V LEQ G    L ++   S   G   +    
Sbjct: 2398 --FECETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTGPVHFTVGK 2455

Query: 1344 PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGP 1403
             + S   +VS    + V L   L P T  E       C+  P    V W ++   ++P  
Sbjct: 2456 SRSSARLVVS---DIPVVLTRPLEPKTGRELQSVVLSCDFRPAPKAVQWYKDDTPLSPSE 2512

Query: 1404 QVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEG 1463
            + +M+  G    L +      DAG    +AGS  +S  + V   E+     LQD  A E 
Sbjct: 2513 KFKMSLEGQMAELRILRLMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQDAEATEE 2572

Query: 1464 QDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCE 1523
                   E         V W   G PL +DS   ++  G  H L +  +  AD G     
Sbjct: 2573 GWASFSCELSHEDEE--VEWSLNGMPLYNDSFHEISHKGRRHTLVLKSIQRADAGIVRAS 2630

Query: 1524 SHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGP 1583
            S    T ARL VR + +  L+ L+D++  E G+   Q E+S       W + GVQL P  
Sbjct: 2631 SLKVSTSARLEVRVKPVVFLKALDDLSAEERGTLALQCEVSDPEAHVVWRKDGVQLGPSD 2690

Query: 1584 KCH-IHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTE 1642
            K   +H+ G R  LV++ +   D+G  +    S    AR+ V ++ V I +    +EV E
Sbjct: 2691 KYDFLHTAGTRG-LVVHDVSPEDAGLYTCHVGSEETRARVRVHDLHVGITKRLKTMEVLE 2749

Query: 1643 GDTATFECELSQALAD--VTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAG--TY 1698
            G++ +FEC LS   A     W   G  +  S R +    G + +L +R   PSDAG   +
Sbjct: 2750 GESCSFECVLSHESASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVF 2809

Query: 1699 SCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPL 1758
            S    T++A    L VRER  A++  L       G+     C +S   T   W    + +
Sbjct: 2810 SVRGLTSKAS---LIVRERPAAIIKPLEDQWVAPGEDVELRCELSRAGTPVHWLKDRKAI 2866

Query: 1759 RPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVE----ALPLQMCRHP 1814
            R   +  +  EG   +LV+     +DAGE   +   ++S A L VE        ++    
Sbjct: 2867 RKSQKYDVVCEGTMAMLVIRGASLKDAGEYTCEVEASKSTASLHVEEKANCFTEELTNLQ 2926

Query: 1815 PREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPED 1874
              EK       AV           V W +   EL    K++    G T  L I  +   D
Sbjct: 2927 VEEKGT-----AVFTCKTEHPAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKAD 2981

Query: 1875 QGTYCCQAGQDSTHTRLLVEG 1895
              TY C  GQ  +  +LLV+G
Sbjct: 2982 SDTYTCDIGQAQSRAQLLVQG 3002



 Score =  387 bits (993), Expect = e-107
 Identities = 356/1325 (26%), Positives = 530/1325 (40%), Gaps = 69/1325 (5%)

Query: 607  HGSAHLVPTARLVA---GLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQ 662
            H SA LV T   V+    L+DV   + E      +LS   +   W  +G EL++ +    
Sbjct: 2154 HTSARLVVTELPVSFSRPLQDVVTTEKEKVTLECELSRPNVDVRWLKDGVELRAGKTMAI 2213

Query: 663  VEPGALR----YRIE---------------------QKGLQHRLILHAVKHQDSGALVGF 697
               GA R    YR E                      +G  + LI   V  +D+G  + F
Sbjct: 2214 AAQGACRSLTIYRCEFADQGVYVCDAHDAQSSASVKVQGRTYTLIYRRVLAEDAGE-IQF 2272

Query: 698  SCPGVQDSAALTIQESPVHILSP-QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKV 756
                 +  A L ++E PV ++ P +D++++      R VL C++SR      W+K  Q++
Sbjct: 2273 VAENAESRAQLRVKELPVTLVRPLRDKIAME---KHRGVLECQVSRASAQVRWFKGSQEL 2329

Query: 757  EESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVF 816
            +      +  DG   +LI+ +   +D   + C    V       V++  + IV   + V 
Sbjct: 2330 QPGPKYELVSDGLYRKLIISDVHAEDEDTYTCDAGDVKTSAQFFVEEQSITIVRGLQDVT 2389

Query: 817  VHAITSECVMLACEVDREDA-PVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGG 875
            V  +        CE       P +W      ++    V LE EG   RL+L  T  +  G
Sbjct: 2390 V--MEPAPAWFECETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTG 2447

Query: 876  EFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDG 935
                  G   +   + ++D+   +  P          L+ VVL+C+       V+W KD 
Sbjct: 2448 PVHFTVGKSRSSARLVVSDIPVVLTRPLEPK--TGRELQSVVLSCDFRPAPKAVQWYKDD 2505

Query: 936  EEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRD 995
              +  S    +  E  +  L +  +   D+G Y C+     +S  VTV    V +  P  
Sbjct: 2506 TPLSPSEKFKMSLEGQMAELRILRLMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQ 2565

Query: 996  EVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPED 1055
            +    A         CELS ED  V W  +G+ +       +   G R  LVL + Q  D
Sbjct: 2566 DAE--ATEEGWASFSCELSHEDEEVEWSLNGMPLYNDSFHEISHKGRRHTLVLKSIQRAD 2623

Query: 1056 GGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWY 1115
             G     +   S    + V   P  +V   A   DL     G + L+CEV+   + V W 
Sbjct: 2624 AGIVRASSLKVSTSARLEVRVKP--VVFLKALD-DLSAEERGTLALQCEVSDPEAHVVWR 2680

Query: 1116 KDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLA 1175
            KDG+++  SD         TR L +    PEDAG Y C    E     V + +  V    
Sbjct: 2681 KDGVQLGPSDKYDFLHTAGTRGLVVHDVSPEDAGLYTCHVGSEETRARVRVHDLHVGITK 2740

Query: 1176 LETTPSPLCVAPGEPVVLSCELSRAGA--PVVWSHNGRPVQEGEGLELHAEGPRRVLCIQ 1233
               T     V  GE     C LS   A  P +W+  G+ V      +   +G + +L ++
Sbjct: 2741 RLKTME---VLEGESCSFECVLSHESASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVR 2797

Query: 1234 AAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHL 1293
             A P+ AG             SL     V E P  ++ P   Q      PG D+EL   L
Sbjct: 2798 EAAPSDAGEVVFSVRGLTSKASLI----VRERPAAIIKPLEDQW---VAPGEDVELRCEL 2850

Query: 1294 SGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVS 1353
            S  G PV W KD + +    +  +   G   +L ++GA   DAGEY C+         + 
Sbjct: 2851 SRAGTPVHWLKDRKAIRKSQKYDVVCEGTMAMLVIRGASLKDAGEYTCEVEASKSTASLH 2910

Query: 1354 VEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSS 1413
            VEE        ELT L V E   A F C+   P A VTW +    +    + + +Q G +
Sbjct: 2911 VEEKANC-FTEELTNLQVEEKGTAVFTCKTEHPAATVTWRKGLLELRASGKHQPSQEGLT 2969

Query: 1414 RILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETG 1473
              LT+   +  D+ T T   G   + A+L V+   +  +  L+DV  +EG          
Sbjct: 2970 LRLTISALEKADSDTYTCDIGQAQSRAQLLVQGRRVHIIEDLEDVDVQEGSSATFRC--- 3026

Query: 1474 RVGAAG--AVRWVRGGQPLPHDSRLSM--AQDGHIHRLFIHGVILADQGTYGCESHHDRT 1529
            R+  A    V W     PL H + L+   AQ G  H L +  + L D GT   E+   R 
Sbjct: 3027 RISPANYEPVHWFLDKTPL-HANELNEIDAQPGGYHVLTLRQLALKDSGTIYFEAGDQRA 3085

Query: 1530 LARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHS 1589
             A L V  +     R L D TI+EG   T   E S   +   W + G  L    +C +  
Sbjct: 3086 SAALRVTEKPSVFSRELTDATITEGEDLTLVCETSTCDIPVCWTKDGKTLRGSARCQLSH 3145

Query: 1590 DGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFE 1649
            +GHR +L++ G  L DSG     A     ++ + V   PV       DLEV EG  AT  
Sbjct: 3146 EGHRAQLLITGATLQDSGRYKCEAGGACSSSIVRVHARPVRFQEALKDLEVLEGGAATLR 3205

Query: 1650 CELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGP 1709
            C LS   A V W    N L P  +  L+  G    L +R   P D+G YSC+ G      
Sbjct: 3206 CVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAMLELVVRNLRPQDSGRYSCSFGDQTTSA 3265

Query: 1710 VRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQE 1769
              LTV       + +LR+  A EG  AT  C +S+      W  G   LR G R  +RQ+
Sbjct: 3266 T-LTVTALPAQFIGKLRNKEATEGATATLRCELSKAAPV-EWRKGSETLRDGDRYCLRQD 3323

Query: 1770 GKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLE 1829
            G    L +  L   DA E     G  ++ A L +  +P         ++++  G  A L 
Sbjct: 3324 GAMCELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFIGRLRHQESI-EGATATLR 3382

Query: 1830 VTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHT 1889
              +S++   V W +    L  GD++ +R  G    L I  +   D G Y C  G++ T  
Sbjct: 3383 CELSKAAP-VEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSCVCGEERTSA 3441

Query: 1890 RLLVE 1894
             L V+
Sbjct: 3442 TLTVK 3446



 Score =  359 bits (922), Expect = 1e-98
 Identities = 442/1753 (25%), Positives = 688/1753 (39%), Gaps = 189/1753 (10%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            P  F R      +  G +  L C       PV  W K G+ L  S R     +G    LL
Sbjct: 3095 PSVFSRELTDATITEGEDLTLVCETSTCDIPVC-WTKDGKTLRGSARCQLSHEGHRAQLL 3153

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            +T A   D+G Y C       EA  A + +++   A     Q A + L            
Sbjct: 3154 ITGATLQDSGRYKC-------EAGGACSSSIVRVHARPVRFQEALKDLE----------- 3195

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED--GP 188
                    VL G    L C    +  P              W   +  L+PG        
Sbjct: 3196 --------VLEGGAATLRCVLSSVAAPVK------------WCYGNNVLRPGDKYSLRQE 3235

Query: 189  GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
            GA L L +   R  DSG Y C    + G     A L V              PA  +  L
Sbjct: 3236 GAMLELVVRNLRPQDSGRYSC----SFGDQTTSATLTV-----------TALPAQFIGKL 3280

Query: 249  KCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLY 308
            +    T    EG  A  RC  + K  P +EW  +G   L D  R   R +DG        
Sbjct: 3281 RNKEAT----EGATATLRCE-LSKAAP-VEWR-KGSETLRDGDRYCLR-QDGAM------ 3326

Query: 309  CQAKDRGL-YVCAARNSA--GQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVP 365
            C+ + RGL  V AA  S   G+  ++  L ++     F   L+  E  E   A L C++ 
Sbjct: 3327 CELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFIGRLRHQESIEGATATLRCELS 3386

Query: 366  NSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVT 425
             +  P  W +  + L    ++   ++G V  L I  L   D G Y C + G  RT A +T
Sbjct: 3387 KAA-PVEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSC-VCGEERTSATLT 3444

Query: 426  VKGPILKRLP--RKLDVLEGENAVLLVETLE-AGVEGRWS----RDGEELPVICQSSSGH 478
            VK    K     R  + +EG  A+L  E  + A VE R      RDG+   +      G 
Sbjct: 3445 VKALPAKFTEGLRNEEAVEGATAMLWCELSKVAPVEWRKGPENLRDGDRYIL---RQEGT 3501

Query: 479  MHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKN----TV 534
               L + G+   DAGE     G  RT+  L ++ +      P    E  K  +     T 
Sbjct: 3502 RCELQICGLAMADAGEYLCVCGQERTSATLTIRAL------PARFIEDVKNQEAREGATA 3555

Query: 535  LLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGA---VEVPGDCVPSEGDYRFR 591
            +L  +    AP     +R   + +   D    +S+ + G    +++ G  +   G+Y   
Sbjct: 3556 VLQCELNSAAPVE---WRKGSETLRDGDR---YSLRQDGTKCELQIRGLAMADTGEYS-- 3607

Query: 592  ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
               V G  R+  ++   +   +P  +   GL + +  +G  AV   +LS +    W+   
Sbjct: 3608 --CVCGQERTSAML---TVRALPI-KFTEGLRNEEATEGATAVLRCELSKMAPVEWWKGH 3661

Query: 652  EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQ 711
            E L+  +          R+ + Q G +  L +  +  +D+G  +   C   + SA LT++
Sbjct: 3662 ETLRDGD----------RHSLRQDGARCELQIRGLVAEDAGEYLCM-CGKERTSAMLTVR 3710

Query: 712  ESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKH 771
              P   +        T    +   L CELS+   P  W K  + + + +   ++ DG + 
Sbjct: 3711 AMPSKFIEGLRNEEAT--EGDTATLWCELSKAA-PVEWRKGHETLRDGDRHSLRQDGSRC 3767

Query: 772  RLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEV 831
             L +    V D+GE+ C          +TV+  P   ++  ++    A      +L CE+
Sbjct: 3768 ELQIRGLAVVDAGEYSCVCGQERTSATLTVRALPARFIEDVKNQ--EAREGATAVLQCEL 3825

Query: 832  DREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVT 891
             +  APV W K  + +   D   L  +G    L +     +D GE+ CV G E    T+T
Sbjct: 3826 SKA-APVEWRKGSETLRGGDRYSLRQDGTRCELQIHGLSVADTGEYSCVCGQERTSATLT 3884

Query: 892  ITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDT 951
            +       V+      + A       L CEL  P A V W+K G ++  +     + +  
Sbjct: 3885 VRAPQP--VFREPLQSLQAEEGSTATLQCELSEPTATVVWSKGGLQLQANGRREPRLQGC 3942

Query: 952  VRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRII--YPRDEVTLIAVTLECVVL 1009
               LVL  +Q ED+GEY C    ++ S T+TVT  PVR +      EV        C   
Sbjct: 3943 TAELVLQDLQREDTGEYTCTCGSQATSATLTVTAAPVRFLRELQHQEVDEGGTAHLC--- 3999

Query: 1010 MCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAF 1069
             CELSR  A V W K  L++       + +DG    L++   + ED G++ CD G   + 
Sbjct: 4000 -CELSRAGASVEWRKGSLQLFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCDTGHTQSM 4058

Query: 1070 FTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQL 1129
             +++V  P  +      +SL+   G   R+  +   A +G+ V+W K+G+E+ A    ++
Sbjct: 4059 ASLSVRVPRPKF-KTRLQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEM 4117

Query: 1130 GAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGE 1189
             ++G TR L +   + +D GEY C T  +    ++ + EP V  +          V   E
Sbjct: 4118 RSQGATRELLIHQLEAKDTGEYACVTGGQKTAASLRVTEPEVTIVRGLVDAE---VTADE 4174

Query: 1190 PVVLSCELSRAGAP-VVWSHNGRPVQEGEGLELHA-EGPRRVLCIQAAGPAHAGLYTCQS 1247
             V  SCE+SRAGA  V W   G P+Q  E  E+   +G    L ++   P  AG  +   
Sbjct: 4175 DVEFSCEVSRAGATGVQWCLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHL 4234

Query: 1248 GAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGP-VRWYKDG 1306
            G    +  L+    V  P V ++ P      V+ + G D      LS   G   RW   G
Sbjct: 4235 GNHASSAQLT----VRAPEVTILEP---LQDVQLSEGQDASFQCRLSRASGQEARWALGG 4287

Query: 1307 ERLASQ--GRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVK--- 1361
              L +     + +EQ G   +L +      DAG           +   S E  L V    
Sbjct: 4288 VPLQANEMNDITVEQ-GTLHLLTLHKVTLEDAGTV------SFHVGTCSSEAQLKVTAKN 4340

Query: 1362 -LVSELTPLTVHEGDDATFRCEVSPPD-ADVTWLRNGAVVTPGPQVEMA--QNGSSRILT 1417
             +V  L  +   EG +A F C++S P+ A  TWL +   V      E+   +NG   +L 
Sbjct: 4341 TVVRGLENVEALEGGEALFECQLSQPEVAAHTWLLDDEPVHTSENAEVVFFENGLRHLLL 4400

Query: 1418 LRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGA 1477
            L+  +  D+  VT  AG   TSA L VR   L  L  L++     G   C          
Sbjct: 4401 LKNLRPQDSCRVTFLAGDMVTSAFLTVRGWRLEILEPLKNAAVRAGAQACFTCTLSEAVP 4460

Query: 1478 AGAVRW-VRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQG--TYGCE---SHHDRTLA 1531
             G   W + G    P DS  ++  DG  H L +        G  T+ C    +    T+ 
Sbjct: 4461 VGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVASARLTVL 4520

Query: 1532 RLSVRPRQLRVL-RPLEDVTIS--------EGGSATFQLELSQEGVTGEWARGGVQLYPG 1582
             L   P    V+ R    VT+S         GG   +++E+ +EG TG+W R   +L PG
Sbjct: 4521 GLPDPPEDAEVVARSSHTVTLSWAAPMSDGGGGLCGYRVEV-KEGATGQW-RLCHELVPG 4578

Query: 1583 PKCHIH--SDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEV 1640
            P+C +   + G  +R  +  +G   +G       ++R A     + VP      P   +V
Sbjct: 4579 PECVVDGLAPGETYRFRVAAVGPVGAGEPVHLPQTVRLAEP--PKPVPPQ-PSAPESRQV 4635

Query: 1641 TEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC 1700
              G+  + E E+     +V W K    + P  R  + + G +++L ++     D G Y C
Sbjct: 4636 AAGEDVSLELEVVAEAGEVIWHKGMERIQPGGRFEVVSQGRQQMLVIKGFTAEDQGEYHC 4695

Query: 1701 AVGTARAGPVRLT 1713
             +      P   T
Sbjct: 4696 GLAQGSICPAAAT 4708



 Score =  288 bits (737), Expect = 3e-77
 Identities = 467/1975 (23%), Positives = 741/1975 (37%), Gaps = 263/1975 (13%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            P  F    + + V+ G  A L+CV+     PV  W  G   L   ++ S   +GA   L+
Sbjct: 3184 PVRFQEALKDLEVLEGGAATLRCVLSSVAAPVK-WCYGNNVLRPGDKYSLRQEGAMLELV 3242

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            +    P D+G Y C    + G+   +A +TV   PA                       F
Sbjct: 3243 VRNLRPQDSGRYSC----SFGDQTTSATLTVTALPAQ----------------------F 3276

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGA 190
            +   R++    GA   L C         + W K    L    D   + L+    +DG   
Sbjct: 3277 IGKLRNKEATEGATATLRCELS--KAAPVEWRKGSETLR---DGDRYCLR----QDGAMC 3327

Query: 191  SLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKC 250
             L +R LA  + D+  Y C      G  +  A L +              PA  +  L+ 
Sbjct: 3328 ELQIRGLA--MVDAAEYSCVC----GEERTSASLTIRP-----------MPAHFIGRLRH 3370

Query: 251  APKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQ 310
                    EG  A  RC  + K  P +EW  +GR  L D  R   R       L++    
Sbjct: 3371 QESI----EGATATLRCE-LSKAAP-VEWR-KGRESLRDGDRHSLRQDGAVCELQICGLA 3423

Query: 311  AKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP 370
              D G Y C      G+  ++  L VK    +FT  L++ E  E   A+L C++ +   P
Sbjct: 3424 VADAGEYSCVC----GEERTSATLTVKALPAKFTEGLRNEEAVEGATAMLWCEL-SKVAP 3478

Query: 371  TAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPI 430
              W +  + L    +Y   +EGT   L I  L   D G YLC + G+ RT A +T++   
Sbjct: 3479 VEWRKGPENLRDGDRYILRQEGTRCELQICGLAMADAGEYLC-VCGQERTSATLTIRALP 3537

Query: 431  LKRLP--RKLDVLEGENAVLLVETLEAG-VEGRWS----RDGEELPVICQSSSGHMHALV 483
             + +   +  +  EG  AVL  E   A  VE R      RDG+   +      G    L 
Sbjct: 3538 ARFIEDVKNQEAREGATAVLQCELNSAAPVEWRKGSETLRDGDRYSL---RQDGTKCELQ 3594

Query: 484  LPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEP 543
            + G+   D GE +   G  RT+ +L V+ +       PI  +  +G +N         E 
Sbjct: 3595 IRGLAMADTGEYSCVCGQERTSAMLTVRAL-------PI--KFTEGLRNE--------EA 3637

Query: 544  APETPFIYRLERQEVGSEDWIQCF---------SIEKAGA---VEVPGDCVPSEGDYRFR 591
                  + R E  ++   +W +           S+ + GA   +++ G      G+Y   
Sbjct: 3638 TEGATAVLRCELSKMAPVEWWKGHETLRDGDRHSLRQDGARCELQIRGLVAEDAGEY--- 3694

Query: 592  ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
            +C + G  R+  ++   +   +P+ + + GL + +  +G+ A    +LS      W    
Sbjct: 3695 LC-MCGKERTSAML---TVRAMPS-KFIEGLRNEEATEGDTATLWCELSKAAPVEWRKGH 3749

Query: 652  EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD--SAALT 709
            E L+  +          R+ + Q G +  L +  +   D+G    +SC   Q+  SA LT
Sbjct: 3750 ETLRDGD----------RHSLRQDGSRCELQIRGLAVVDAGE---YSCVCGQERTSATLT 3796

Query: 710  IQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGR 769
            ++  P   +  +D  +         VL CELS+   P  W K  + +   +   ++ DG 
Sbjct: 3797 VRALPARFI--EDVKNQEAREGATAVLQCELSKAA-PVEWRKGSETLRGGDRYSLRQDGT 3853

Query: 770  KHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLAC 829
            +  L +    V D+GE+ C          +TV+ P     +P + +   A       L C
Sbjct: 3854 RCELQIHGLSVADTGEYSCVCGQERTSATLTVRAPQPVFREPLQSL--QAEEGSTATLQC 3911

Query: 830  EVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFT 889
            E+    A V W K G +++ +       +G    LVL   Q  D GE+ C  G +    T
Sbjct: 3912 ELSEPTATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQREDTGEYTCTCGSQATSAT 3971

Query: 890  VTITDVSSWIVYPSGKVYVAAVRLERVV------------LTCELCRPWAEVRWTKDGEE 937
            +T+T               A VR  R +            L CEL R  A V W K   +
Sbjct: 3972 LTVT--------------AAPVRFLRELQHQEVDEGGTAHLCCELSRAGASVEWRKGSLQ 4017

Query: 938  VVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEV 997
            +       + ++     L++  V+ ED+G+Y C+        T ++    VR+  P+ + 
Sbjct: 4018 LFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCD-----TGHTQSMASLSVRVPRPKFKT 4072

Query: 998  TLIAV---TLECVVLMCELSRED--APVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQ 1052
             L ++   T +   L C+LS  +  A V+W K+G+E+       +   G    L++   +
Sbjct: 4073 RLQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLE 4132

Query: 1053 PEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQ- 1111
             +D GE+ C  G      ++ VT P   IV      +D    A   VE  CEV+ AG+  
Sbjct: 4133 AKDTGEYACVTGGQKTAASLRVTEPEVTIVRGL---VDAEVTADEDVEFSCEVSRAGATG 4189

Query: 1112 VRWYKDGLEVEASDALQLGA-EGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPP 1170
            V+W   GL +++++  ++   +G   TL L    PEDAG       + A +  + +  P 
Sbjct: 4190 VQWCLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTVRAPE 4249

Query: 1171 VQFLALETTPSPLCVAPGEPVVLSCELSRA-GAPVVWSHNGRPVQEGEGLELHAE-GPRR 1228
            V  L        + ++ G+     C LSRA G    W+  G P+Q  E  ++  E G   
Sbjct: 4250 VTILE---PLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLH 4306

Query: 1229 VLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLE 1288
            +L +       AG  +   G       L  T +     VR +        V +  GG+  
Sbjct: 4307 LLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAK--NTVVRGLE------NVEALEGGEAL 4358

Query: 1289 LVVHLSGPGGPVR-WYKDGERL--ASQGRVQLEQAGARQVLRVQGARSGD-------AGE 1338
                LS P      W  D E +  +    V   + G R +L ++  R  D       AG+
Sbjct: 4359 FECQLSQPEVAAHTWLLDDEPVHTSENAEVVFFENGLRHLLLLKNLRPQDSCRVTFLAGD 4418

Query: 1339 YLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSP--PDADVTWLRNG 1396
             +  A    R + + + EPL            V  G  A F C +S   P  + +W  NG
Sbjct: 4419 MVTSAFLTVRGWRLEILEPL--------KNAAVRAGAQACFTCTLSEAVPVGEASWYING 4470

Query: 1397 AVVTPGPQV-EMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVR------ETEL 1449
            A V P      +  +GS   L LR  Q   AG VT        SARL V       E   
Sbjct: 4471 AAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVASARLTVLGLPDPPEDAE 4530

Query: 1450 LFLRRLQDVR-------AEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDG 1502
            +  R    V        ++ G  +C      + GA G  R      P P      +A  G
Sbjct: 4531 VVARSSHTVTLSWAAPMSDGGGGLCGYRVEVKEGATGQWRLCHELVPGPECVVDGLAP-G 4589

Query: 1503 HIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPL-EDVTISEGGSATFQL 1561
              +R  +  V     G    E  H     RL+  P+ +       E   ++ G   + +L
Sbjct: 4590 ETYRFRVAAVGPVGAG----EPVHLPQTVRLAEPPKPVPPQPSAPESRQVAAGEDVSLEL 4645

Query: 1562 ELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSG---CVSFTADSLRC 1618
            E+  E     W +G  ++ PG +  + S G +  LV+ G    D G   C          
Sbjct: 4646 EVVAEAGEVIWHKGMERIQPGGRFEVVSQGRQQMLVIKGFTAEDQGEYHCGLAQGSICPA 4705

Query: 1619 AARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQA 1678
            AA   V   P ++   P      E         L +ALA          L     L  + 
Sbjct: 4706 AATFQVALSPASVDEAPQPSLPPEAAQEGDLHLLWEALARKRRMSREPTLDSISELPEED 4765

Query: 1679 LGTRRLLQ-LRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGAT 1737
              ++RL Q      P  +  YS A   AR G              ++L   S+ +   A 
Sbjct: 4766 GRSQRLPQEAEEVAPDLSEGYSTADELARTGD-------------ADLSHTSSDDESRAG 4812

Query: 1738 FECTVSEVETTGRWELG------GRPLRPGARVRIRQEGKKHILV-LSELRAEDAGE--- 1787
                V+ ++  GR          G P  P  + + +QE    +   L +L  +D G+   
Sbjct: 4813 TPSLVTYLKKAGRPGTSPLASKVGAPAAPSVKPQQQQEPLAAVRPPLGDLSTKDLGDPSM 4872

Query: 1788 ----VRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLE-VTVSRSGGHVCWL 1842
                V+ QA         E++     M  H   +    VG    LE V  S++     WL
Sbjct: 4873 DKAAVKIQAAFKGYKVRKEMKQQEGPMFSHTFGDTEAQVGDALRLECVVASKADVRARWL 4932

Query: 1843 REGAELCPGDKYEMRSHGP-THSLVIHDVRPEDQGTYCCQAGQ---DSTHTRLLV 1893
            ++G EL  G  + +   G  T SL+I  +   D G Y CQ        TH+  +V
Sbjct: 4933 KDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCYTCQVSNKFGQVTHSACVV 4987



 Score =  178 bits (452), Expect = 4e-44
 Identities = 204/796 (25%), Positives = 316/796 (39%), Gaps = 94/796 (11%)

Query: 1178 TTPSPLCVAPGEPVVLSCELSRAGAPVV-WSHNGRPVQEGEGLELHAEGPRRVLCIQAAG 1236
            T P    V+ G+   LSC++     P V W  + +PV  G    L  +G    L I    
Sbjct: 14   TRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQDGDLYRLTILDLA 73

Query: 1237 PAHAGLYTCQSGAAPGAPSLSFTVQV-AEPPVRVVAPE--AAQTRVRSTPGGDLELVVHL 1293
               +G Y C++  A G    +  +QV AE      AP      T +R   G +      +
Sbjct: 74   LGDSGQYVCRARNAIGEAFAAVGLQVDAEAACAEQAPHFLLRPTSIRVREGSEATFRCRV 133

Query: 1294 SGPGGP-VRWYKDGERLASQG--RVQLEQAGARQVLRVQGARSGDAGEYLCDA------- 1343
             G   P V W KDG RL      RV++E+ G    LR++ AR  D G Y   A       
Sbjct: 134  GGSPRPAVSWSKDGRRLGEPDGPRVRVEELGEASALRIRAARPRDGGTYEVRAENPLGAA 193

Query: 1344 ------------------PQDSRIFLVSVEEPLLVKLVSELTPL----------TVHEGD 1375
                              P  S   L++  +     + +E  P           TV EG 
Sbjct: 194  SAAAALVVDSDAADTASRPGTSTAALLAHLQRRREAMRAEGAPASPPSTGTRTCTVTEGK 253

Query: 1376 DATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSR-ILTLRGCQLGDAGTVTLRA 1433
             A   C V+  P  +  W ++G +VT G +  + ++     +L +  C+  D G  T  A
Sbjct: 254  HARLSCYVTGEPKPETVWKKDGQLVTEGRRHVVYEDAQENFVLKILFCKQSDRGLYTCTA 313

Query: 1434 ----GSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQP 1489
                G T +S  + VRE  + F +RLQD+   E +      E  +     A  W +    
Sbjct: 314  SNLVGQTYSSVLVVVREPAVPFKKRLQDLEVREKESATFLCEVPQPSTEAA--WFKEETR 371

Query: 1490 LPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH-DRTLARLSVRPRQLRVLRPLED 1548
            L   ++  + ++G   RL +  V   D   Y CE+    RT+A L+V+   LR L     
Sbjct: 372  LWASAKYGIEEEGTERRLTVRNVSADDDAVYICETPEGSRTVAELAVQGNLLRKLPRKTA 431

Query: 1549 VTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGC 1608
            V +  G +A F +EL+       W R   ++  G +  I ++G RH L ++   L D G 
Sbjct: 432  VRV--GDTAMFCVELAVPVGPVHWLRNQEEVVAGGRVAISAEGTRHTLTISQCCLEDVGQ 489

Query: 1609 VSFTADSLRCAARLIV---REVPVT-----IVRG-------------PHDLEVTEGDTAT 1647
            V+F A   + + +  V   R+ P+      +V+              PH       D   
Sbjct: 490  VAFMAGDCQTSTQFCVSAPRKPPLQPPVDPVVKARMESSVILSWSPPPHGERPVTIDGYL 549

Query: 1648 FECELSQALADVTWEKDGNA-LTPSPRLRLQALGTRRLLQLRRCGPSDAGT--YSCAVGT 1704
             E    + L   TW +   A    +P L +  +      Q R    +  G   Y    GT
Sbjct: 550  VE---KKKLGTYTWIRCHEAEWVATPELTVADVAEEGNFQFRVSALNSFGQSPYLEFPGT 606

Query: 1705 ARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARV 1764
                P         +AV + L++V A EG   TF   ++ V + G W L G+ L+  +  
Sbjct: 607  VHLAP--------KLAVRTPLKAVQAVEGGEVTFSVDLT-VASAGEWFLDGQALKASSVY 657

Query: 1765 RIRQEGKKHILVLSELRAEDAG-EVRFQAGPAQSLALLEVEALPLQMCRHPP----REKT 1819
             I  +  +H L + E+ A   G +++F A   +S   +EV A P      PP    RE  
Sbjct: 658  EIHCDRTRHTLTIREVPASLHGAQLKFVANGIESSIRMEVRAAPGLTANKPPAAAAREVL 717

Query: 1820 VLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYC 1879
              +   A L   +S     V WL++G  L PG KYE+++      L++ DV  +D G Y 
Sbjct: 718  ARLHEEAQLLAELSDQAAAVTWLKDGRTLSPGPKYEVQASAGRRVLLVRDVARDDAGLYE 777

Query: 1880 CQAGQDSTHTRLLVEG 1895
            C +       +L V+G
Sbjct: 778  CVSRGGRIAYQLSVQG 793



 Score =  115 bits (287), Expect = 5e-25
 Identities = 114/388 (29%), Positives = 155/388 (39%), Gaps = 68/388 (17%)

Query: 126 GAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAE 185
           GAP FLT P++  V  G +  L+C+  G P P + WEKD      V   + F L    A+
Sbjct: 8   GAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKD---QQPVAAGARFRL----AQ 60

Query: 186 DGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVV 245
           DG      L IL   L DSG YVC ARNA G A A   LQV         D + A A   
Sbjct: 61  DGD--LYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLQV---------DAEAACAEQA 109

Query: 246 EPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVL 304
                 P +  V EG  A FRC V G P P + W  +GR L  PD  R+   +      L
Sbjct: 110 PHFLLRPTSIRVREGSEATFRCRVGGSPRPAVSWSKDGRRLGEPDGPRVRVEELGEASAL 169

Query: 305 KVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV---------------------------- 336
           ++   + +D G Y   A N  G   +A  L V                            
Sbjct: 170 RIRAARPRDGGTYEVRAENPLGAASAAAALVVDSDAADTASRPGTSTAALLAHLQRRREA 229

Query: 337 -------KEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFREDQRLLPCRK--- 385
                    P    TR     EG+    A L C V     P T W ++ Q +   R+   
Sbjct: 230 MRAEGAPASPPSTGTRTCTVTEGKH---ARLSCYVTGEPKPETVWKKDGQLVTEGRRHVV 286

Query: 386 YEQIEEGTVRRLIIHRLKADDDGIYLC---EMRGRVRTVANVTVKGPIL--KRLPRKLDV 440
           YE  +E  V +++    K  D G+Y C    + G+  +   V V+ P +  K+  + L+V
Sbjct: 287 YEDAQENFVLKILF--CKQSDRGLYTCTASNLVGQTYSSVLVVVREPAVPFKKRLQDLEV 344

Query: 441 LEGENAVLLVETLEAGVEGRWSRDGEEL 468
            E E+A  L E  +   E  W ++   L
Sbjct: 345 REKESATFLCEVPQPSTEAAWFKEETRL 372



 Score =  101 bits (252), Expect = 6e-21
 Identities = 102/352 (28%), Positives = 137/352 (38%), Gaps = 38/352 (10%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG-AEHGLL 70
            P FL   +   V  G      CVV G+P P V W K G+ L   +      D    H L+
Sbjct: 5126 PVFLTELQNQEVQDGYPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLI 5185

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTV------LEPPASDPE----------LQPA 114
            +TA +P D GVY C A N+ G +   A + V       +  A   E          L   
Sbjct: 5186 ITAVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSR 5245

Query: 115  ERPLPSPGSGEGA-PVFLTGPRSQWVLRGAEVV-LTCRAGGLPEPTLYWEKDGMALDEVW 172
            E+      + EG  P  +   R   V  G  +     +  G P P LYW KDG  L    
Sbjct: 5246 EQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTA-- 5303

Query: 173  DSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVH---QP 229
             S+H  +   +          L I++    DSG Y  +  NA G A + A L V    +P
Sbjct: 5304 -SAHIRMTDKKILH------TLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEP 5356

Query: 230  PESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEG--RPLL 287
             E P +D  E   P     +  PK   V +G    F   V G+P P + W  E   R +L
Sbjct: 5357 EEKPASDVHEQLVPPRMLERFTPKK--VKKGSSITFSVKVEGRPVPTVHWLREEAERGVL 5414

Query: 288  ---PDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
               PD              L +L    + +G Y C A N+AGQ L +  LHV
Sbjct: 5415 WIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHV 5466



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 64/230 (27%), Positives = 101/230 (43%), Gaps = 29/230 (12%)

Query: 142  GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
            G  V L CR  G P+P + W KDG A+    D  H  ++       P  S AL + +   
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQV--DPHHILIED------PDGSCALILDSLTG 6079

Query: 202  PDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGK 261
             DSG Y+C A +A G+      + V  PP              V  ++ +P      EG+
Sbjct: 6080 VDSGQYMCFAASAAGNCSTLGKILVQVPPR------------FVNKVRASPFV----EGE 6123

Query: 262  HAKFRCYVMGKPEPEIEWHWEGRPLLPDRR-RLMYRDRDGGFVLKVLYCQAKDRGLYVCA 320
             A+F C + G P P+I W+ +G  L    + + +   R G  VL +     +D GLY C 
Sbjct: 6124 DAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECE 6183

Query: 321  ARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP 370
              N  G   ++ +L ++ P L+     Q+   RE  +A +E     +++P
Sbjct: 6184 LVNRLGSARASAELRIQSPMLQ----AQEQCHREQLVAAVEVTEQETKVP 6229



 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 83/279 (29%), Positives = 115/279 (41%), Gaps = 50/279 (17%)

Query: 103  EPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWE 162
            E PA  P + P   PLPS  + + APVFLT  ++Q V  G  V   C   G P P++ W 
Sbjct: 5105 ETPA--PVVPP--EPLPSLLTSDAAPVFLTELQNQEVQDGYPVSFDCVVTGQPMPSVRWF 5160

Query: 163  KDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGA 222
            KDG  L+E     H+ +     ED  G    L I A    D GVY C A N+ G +   A
Sbjct: 5161 KDGKLLEE---DDHYMIN----EDQQGGH-QLIITAVVPADMGVYRCLAENSMGVSSTKA 5212

Query: 223  LLQVH---------------------------QPPESPPADPDEAPAP-VVEPLK---CA 251
             L+V                            +  E   +  DE   P VVE L+    A
Sbjct: 5213 ELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQVVEELRDLQVA 5272

Query: 252  PKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQA 311
            P T      + AKF+  V G P P + W  +G+PL      +   D+     L+++    
Sbjct: 5273 PGT------RLAKFQLKVKGYPAPRLYWFKDGQPLTAS-AHIRMTDKKILHTLEIISVTR 5325

Query: 312  KDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDV 350
            +D G Y     N+ G   S+ +L V+ P     +P  DV
Sbjct: 5326 EDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDV 5364



 Score = 75.9 bits (185), Expect = 4e-13
 Identities = 61/229 (26%), Positives = 92/229 (40%), Gaps = 10/229 (4%)

Query: 4    SSGDQGSPPCFLRFPRPVRVVSGAE-AELKCVVLGEPPPVVVWEKGGQQLAASERLSFPA 62
            S+ D+G  P  +   R ++V  G   A+ +  V G P P + W K GQ L AS  +    
Sbjct: 5252 STTDEGQLPQVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTD 5311

Query: 63   DGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
                H L + +    D+G Y     NA G AY++A + V  P       +P E+P     
Sbjct: 5312 KKILHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPD------EPEEKPASDVH 5365

Query: 123  SGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPG 182
                 P  L     + V +G+ +  + +  G P PT++W ++      +W        PG
Sbjct: 5366 EQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPD---TPG 5422

Query: 183  RAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPE 231
                      +L +L       G Y C A NA G A   A L V   P+
Sbjct: 5423 YTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSGLPK 5471



 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 48/181 (26%), Positives = 82/181 (45%), Gaps = 11/181 (6%)

Query: 260  GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
            G+  K  C V G P+P I W+ +G+ +  D   ++  D DG   L +      D G Y+C
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMC 6087

Query: 320  AARNSAG--QTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFRE 376
             A ++AG   TL  + + V    +   R    VEG +   A   C +  +  P   W+++
Sbjct: 6088 FAASAAGNCSTLGKILVQVPPRFVNKVRASPFVEGED---AQFTCTIEGAPYPQIRWYKD 6144

Query: 377  DQRLLPCRKYEQIEE--GTVRRLIIHRLKADDDGIYLCEM---RGRVRTVANVTVKGPIL 431
               L    K++ + E    +  L+I     +D G+Y CE+    G  R  A + ++ P+L
Sbjct: 6145 GALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECELVNRLGSARASAELRIQSPML 6204

Query: 432  K 432
            +
Sbjct: 6205 Q 6205



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 59/206 (28%), Positives = 81/206 (39%), Gaps = 33/206 (16%)

Query: 26   GAEAELKCVVLGEPPPVVVWEKGGQ--QLAASERLSFPADGAEHGLLLTAALPTDAGVYV 83
            G   +L C V G P PV+ W K G+  Q+     L    DG+   L+L +    D+G Y+
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGS-CALILDSLTGVDSGQYM 6086

Query: 84   CRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGA 143
            C A +AAG       + V  PP                        F+   R+   + G 
Sbjct: 6087 CFAASAAGNCSTLGKILVQVPPR-----------------------FVNKVRASPFVEGE 6123

Query: 144  EVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPD 203
            +   TC   G P P + W KDG  L     +    L   R+       L L I AA   D
Sbjct: 6124 DAQFTCTIEGAPYPQIRWYKDGALL--TTGNKFQTLSEPRS-----GLLVLVIRAASKED 6176

Query: 204  SGVYVCHARNAHGHAQAGALLQVHQP 229
             G+Y C   N  G A+A A L++  P
Sbjct: 6177 LGLYECELVNRLGSARASAELRIQSP 6202



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 64/217 (29%), Positives = 96/217 (44%), Gaps = 16/217 (7%)

Query: 947  QKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLEC 1006
            ++ED+VR+ +L A        ++ EI        + V  PP    +  +     A   E 
Sbjct: 5974 EREDSVRKYLLQARTAIIKSSWVKEICGIQQRLALPVWRPPD---FEEELADCTAELGET 6030

Query: 1007 VVLMCELSREDAPV-RWYKDG--LEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC-- 1061
            V L C ++    PV  WYKDG  ++V+    L+ + DG  C L+L +    D G+++C  
Sbjct: 6031 VKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGS-CALILDSLTGVDSGQYMCFA 6089

Query: 1062 --DAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGL 1119
               AG+ S    + V  PP R V+    S  +  G   +     E AP   Q+RWYKDG 
Sbjct: 6090 ASAAGNCSTLGKILVQVPP-RFVNKVRASPFVE-GEDAQFTCTIEGAPY-PQIRWYKDGA 6146

Query: 1120 EVEASDALQLGAEGPTRTLTL--PHAQPEDAGEYVCE 1154
             +   +  Q  +E  +  L L    A  ED G Y CE
Sbjct: 6147 LLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECE 6183



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 126/569 (22%), Positives = 182/569 (31%), Gaps = 118/569 (20%)

Query: 26   GAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG-AEHGLLLTAALPTDAGVYVC 84
            G    L+CVV  +      W K G +L           G     LL+T     DAG Y C
Sbjct: 4912 GDALRLECVVASKADVRARWLKDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCYTC 4971

Query: 85   RARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF---------LTGPR 135
            +  N  G+   +A V V            +E    S   GE    F         L   +
Sbjct: 4972 QVSNKFGQVTHSACVVV----------SGSESEAESSSGGELDDAFRRAARRLHRLFRTK 5021

Query: 136  SQWVLRGAEVVLTCRAG-GLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLAL 194
            S   +   E+ L+   G   PE    W+          +  HF     R E    A  A+
Sbjct: 5022 SPAEVSDEELFLSADEGPAEPEEPADWQ-------TYREDEHFICI--RFEALTEARQAV 5072

Query: 195  RILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADP-------DEAPAPVVEP 247
                      G+ V       G  +    +    P    P +P       D AP  + E 
Sbjct: 5073 TRFQEMFATLGIGVEIKLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSDAAPVFLTE- 5131

Query: 248  LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVL 307
                 +   V +G    F C V G+P P + W  +G+ L  D   ++  D+ GG  L + 
Sbjct: 5132 ----LQNQEVQDGYPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLIIT 5187

Query: 308  YCQAKDRGLYVCAARNSAGQTLSAVQLHV-------------KEPRLRFT---------- 344
                 D G+Y C A NS G + +  +L V              E    F+          
Sbjct: 5188 AVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQ 5247

Query: 345  -------------------RPLQDVEGREHGIAVLECKVPNSRIPTA-WFREDQRLLPCR 384
                               R LQ   G    +A  + KV     P   WF++ Q L    
Sbjct: 5248 EGTESTTDEGQLPQVVEELRDLQVAPGTR--LAKFQLKVKGYPAPRLYWFKDGQPLTASA 5305

Query: 385  KYEQIEEGTVRRLIIHRLKADDDG---IYLCEMRGRVRTVANVTVKGPILKRLPRKLDVL 441
                 ++  +  L I  +  +D G    Y+    G   + A + V+GP         DV 
Sbjct: 5306 HIRMTDKKILHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDVH 5365

Query: 442  EGENAVLLVE-------------TLEAGVEGR------WSRD---------GEELPVICQ 473
            E      ++E             T    VEGR      W R+         G + P    
Sbjct: 5366 EQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPDTPGYTV 5425

Query: 474  SSSGHMHALVLPGVTREDAGEVTFSLGNS 502
            +SS   H+LVL  V R+  G  T    N+
Sbjct: 5426 ASSAQQHSLVLLDVGRQHQGTYTCIASNA 5454



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 46/179 (25%), Positives = 78/179 (43%), Gaps = 15/179 (8%)

Query: 1284 GGDLELVVHLSGPGGPV-RWYKDGERL-ASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
            G  ++L   ++G   PV  WYKDG+ +      + +E       L +      D+G+Y+C
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMC 6087

Query: 1342 DAPQD----SRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVS-PPDADVTWLRNG 1396
             A       S +  + V+ P   + V+++      EG+DA F C +   P   + W ++G
Sbjct: 6088 FAASAAGNCSTLGKILVQVP--PRFVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKDG 6145

Query: 1397 AVVTPGPQVEMAQNGSSRILTL--RGCQLGDAG----TVTLRAGSTATSARLHVRETEL 1449
            A++T G + +      S +L L  R     D G     +  R GS   SA L ++   L
Sbjct: 6146 ALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECELVNRLGSARASAELRIQSPML 6204



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 65/244 (26%), Positives = 98/244 (40%), Gaps = 20/244 (8%)

Query: 648  FLNGEELKSNEPEGQVEPGALRYRI--EQKGLQHRLILHAVKHQDSGALVGFSCPGVQDS 705
            F N  +L S +   QVE     + +  E++    + +L A       + V   C G+Q  
Sbjct: 5947 FRNMMKLSSIDLNDQVEGDDRAFEVWQEREDSVRKYLLQARTAIIKSSWVKEIC-GIQQR 6005

Query: 706  AALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPA-TWYKDGQ--KVEESELL 762
             AL +   P      ++    T    E V L C ++    P  +WYKDG+  +V+   +L
Sbjct: 6006 LALPVWRPPDF---EEELADCTAELGETVKLACRVTGTPKPVISWYKDGKAVQVDPHHIL 6062

Query: 763  VVKMDGRKHRLILPEAKVQDSGEFEC----RTEGVSAFFGVTVQDPPVHIVDPREHVFVH 818
            +   DG    LIL      DSG++ C         S    + VQ PP  +   R   FV 
Sbjct: 6063 IEDPDG-SCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNKVRASPFVE 6121

Query: 819  AITSECVMLACEVDREDAP-VRWYKDGQEVEESD-FVVL-ENEGPHRRLVLPATQPSDGG 875
                E     C ++    P +RWYKDG  +   + F  L E       LV+ A    D G
Sbjct: 6122 ---GEDAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLG 6178

Query: 876  EFQC 879
             ++C
Sbjct: 6179 LYEC 6182



 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 46/159 (28%), Positives = 69/159 (43%), Gaps = 12/159 (7%)

Query: 823  ECVMLACEVDREDAPV-RWYKDGQEVE-ESDFVVLENEGPHRRLVLPATQPSDGGEFQCV 880
            E V LAC V     PV  WYKDG+ V+ +   +++E+      L+L +    D G++ C 
Sbjct: 6029 ETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCF 6088

Query: 881  AGD---ECAYFTVTITDVSSWIVYPSGKVYVAA-VRLERVVLTCEL-CRPWAEVRWTKDG 935
            A      C+     +  V    V    KV  +  V  E    TC +   P+ ++RW KDG
Sbjct: 6089 AASAAGNCSTLGKILVQVPPRFV---NKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKDG 6145

Query: 936  EEVVESPAL--LLQKEDTVRRLVLPAVQLEDSGEYLCEI 972
              +        L +    +  LV+ A   ED G Y CE+
Sbjct: 6146 ALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECEL 6184



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 45/163 (27%), Positives = 71/163 (43%), Gaps = 15/163 (9%)

Query: 1188 GEPVVLSCELSRAGAPVV-WSHNGRPVQ-EGEGLELHAEGPRRVLCIQAAGPAHAGLYTC 1245
            GE V L+C ++    PV+ W  +G+ VQ +   + +        L + +     +G Y C
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMC 6087

Query: 1246 QSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTP---GGDLELVVHLSGPGGP-VR 1301
             + +A G  S    + V  PP  V        +VR++P   G D +    + G   P +R
Sbjct: 6088 FAASAAGNCSTLGKILVQVPPRFV-------NKVRASPFVEGEDAQFTCTIEGAPYPQIR 6140

Query: 1302 WYKDGERLASQGRVQL--EQAGARQVLRVQGARSGDAGEYLCD 1342
            WYKDG  L +  + Q   E      VL ++ A   D G Y C+
Sbjct: 6141 WYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECE 6183



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 87/336 (25%), Positives = 116/336 (34%), Gaps = 82/336 (24%)

Query: 1639 EVTEGDTATFECELS-QALADVTWEKDGNALTPSPRLRLQA--LGTRRLLQLRRCGPSDA 1695
            EV +G   +F+C ++ Q +  V W KDG  L       +     G  +L+ +    P+D 
Sbjct: 5136 EVQDGYPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLI-ITAVVPADM 5194

Query: 1696 GTYSC------AVGTARA------------------------------------GPVRLT 1713
            G Y C       V + +A                                    G    T
Sbjct: 5195 GVYRCLAENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTT 5254

Query: 1714 VRERTVAVLSELRSVSAREGDG-ATFECTVSEVETTGR-WELGGRPLRPGARVRIRQEGK 1771
               +   V+ ELR +    G   A F+  V         W   G+PL   A +R+  +  
Sbjct: 5255 DEGQLPQVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKI 5314

Query: 1772 KHILVLSELRAEDAGE----VRFQAGPAQSLALL------EVEALPLQMCRH---PPR-- 1816
             H L +  +  ED+G+    +    G A S A L      E E  P         PPR  
Sbjct: 5315 LHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDVHEQLVPPRML 5374

Query: 1817 ----EKTVLVGRRAVLEVTVS-RSGGHVCWLREGAEL--------CPGDKYEMRSHGPTH 1863
                 K V  G      V V  R    V WLRE AE          PG  Y + S    H
Sbjct: 5375 ERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPDTPG--YTVASSAQQH 5432

Query: 1864 SLVIHDVRPEDQGTYCC----QAGQDSTHTRLLVEG 1895
            SLV+ DV  + QGTY C     AGQ      L V G
Sbjct: 5433 SLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSG 5468



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 32/97 (32%), Positives = 44/97 (45%), Gaps = 4/97 (4%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASER---LSFPADGAEH 67
            PP F+   R    V G +A+  C + G P P + W K G  L    +   LS P  G   
Sbjct: 6107 PPRFVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGL-L 6165

Query: 68   GLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEP 104
             L++ AA   D G+Y C   N  G A A+A + +  P
Sbjct: 6166 VLVIRAASKEDLGLYECELVNRLGSARASAELRIQSP 6202



 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 122/566 (21%), Positives = 184/566 (32%), Gaps = 135/566 (23%)

Query: 1001 AVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGP-RCRLVLPAAQPEDGGEF 1059
            A+ LECVV     S+ D   RW KDG+E+ +     +++ G   C L++      D G +
Sbjct: 4914 ALRLECVVA----SKADVRARWLKDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCY 4969

Query: 1060 VCDAGDDSAFFT----VTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWY 1115
             C   +     T    V V+         +   LD  F    R   R             
Sbjct: 4970 TCQVSNKFGQVTHSACVVVSGSESEAESSSGGELDDAFRRAARRLHRLFRT--------- 5020

Query: 1116 KDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAIT--------FNVILA 1167
            K   EV   +      EGP         Q     E+    R EA+T        F  + A
Sbjct: 5021 KSPAEVSDEELFLSADEGPAEPEEPADWQTYREDEHFICIRFEALTEARQAVTRFQEMFA 5080

Query: 1168 ------------------------EPPVQFLALETTPSPLC---------------VAPG 1188
                                    E P   +  E  PS L                V  G
Sbjct: 5081 TLGIGVEIKLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSDAAPVFLTELQNQEVQDG 5140

Query: 1189 EPVVLSCELSRAGAPVV-WSHNGRPVQEGEGLELHAEGPR-RVLCIQAAGPAHAGLYTCQ 1246
             PV   C ++    P V W  +G+ ++E +   ++ +      L I A  PA  G+Y C 
Sbjct: 5141 YPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCL 5200

Query: 1247 SGAAPGAPSLSFTVQV---------AEPPVRVVAPEAAQTRVRS---------TPGGDLE 1288
            +  + G  S    ++V         A       +  +AQ  + S         T  G L 
Sbjct: 5201 AENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLP 5260

Query: 1289 LVVH-------------------LSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRV 1328
             VV                    + G P   + W+KDG+ L +   +++        L +
Sbjct: 5261 QVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKILHTLEI 5320

Query: 1329 QGARSGDAGEY-------LCDAPQDSRIFLVSVEEP------------LLVKLVSELTPL 1369
                  D+G+Y       +  A   +R+ +   +EP            +  +++   TP 
Sbjct: 5321 ISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDVHEQLVPPRMLERFTPK 5380

Query: 1370 TVHEGDDATFRCEV-SPPDADVTWLRNGA---VVTPGPQV---EMAQNGSSRILTLRGCQ 1422
             V +G   TF  +V   P   V WLR  A   V+  GP      +A +     L L    
Sbjct: 5381 KVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPDTPGYTVASSAQQHSLVLLDVG 5440

Query: 1423 LGDAGTVTL----RAGSTATSARLHV 1444
                GT T      AG    SA LHV
Sbjct: 5441 RQHQGTYTCIASNAAGQALCSASLHV 5466



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 42/195 (21%), Positives = 78/195 (40%), Gaps = 45/195 (23%)

Query: 825  VMLACEVDREDAP-VRWYKDGQEVEESD-FVVLENEGPHRRLVLPATQPSDGGEFQCVAG 882
            V   C V  +  P VRW+KDG+ +EE D +++ E++    +L++ A  P+D G ++C+A 
Sbjct: 5143 VSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCLAE 5202

Query: 883  DECAYFTV--------------TITDVSSWIVYPSGKVYVAAVRLERVVLTCELCR---- 924
            +     +               T  D +    Y S + Y+++   E    T +  +    
Sbjct: 5203 NSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQV 5262

Query: 925  -------------------------PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPA 959
                                     P   + W KDG+ +  S  + +  +  +  L + +
Sbjct: 5263 VEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKILHTLEIIS 5322

Query: 960  VQLEDSGEYLCEIDD 974
            V  EDSG+Y   I +
Sbjct: 5323 VTREDSGQYAAYISN 5337



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 127/609 (20%), Positives = 209/609 (34%), Gaps = 144/609 (23%)

Query: 741  SRVDFPATWYKDGQKVEESELLVVKMDGRKHR----------LILPEAKVQDSGEFECRT 790
            S+ D  A W KDG ++          DGR H           L++      D+G + C+ 
Sbjct: 4923 SKADVRARWLKDGVELT---------DGRHHHIDQLGDGTCSLLITGLDRADAGCYTCQ- 4972

Query: 791  EGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEES 850
              VS  FG       V +V   E     +   E         R    +   K   EV + 
Sbjct: 4973 --VSNKFGQVTHSACV-VVSGSESEAESSSGGELDDAFRRAARRLHRLFRTKSPAEVSDE 5029

Query: 851  DFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDE---CAYFTVTITDVSSWIVYPSGKVY 907
            +  +  +EGP         +P +  ++Q    DE   C  F   +T+             
Sbjct: 5030 ELFLSADEGP--------AEPEEPADWQTYREDEHFICIRFEA-LTEARQ---------- 5070

Query: 908  VAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGE 967
             A  R + +  T  +     E++  + G   VE   + + KE        P V  E    
Sbjct: 5071 -AVTRFQEMFATLGI---GVEIKLVEQGPRRVE---MCISKETPA-----PVVPPEPLPS 5118

Query: 968  YLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGL 1027
             L    D +  F   +    V+  YP        V+ +CVV      +    VRW+KDG 
Sbjct: 5119 LLTS--DAAPVFLTELQNQEVQDGYP--------VSFDCVVT----GQPMPSVRWFKDGK 5164

Query: 1028 EVEESEALVLERDGP-RCRLVLPAAQPEDGGEFVC------------------------- 1061
             +EE +  ++  D     +L++ A  P D G + C                         
Sbjct: 5165 LLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDYD 5224

Query: 1062 ---DAGDDSAFFTV-----------TVTAPPERIVHPAARSLDLHFGAPG----RVELRC 1103
               DA + S++F+            T +   E  +      L     APG    + +L+ 
Sbjct: 5225 TAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLKV 5284

Query: 1104 EVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGE---YVCETRHEAI 1160
            +  PA  ++ W+KDG  + AS  +++  +    TL +     ED+G+   Y+      A 
Sbjct: 5285 KGYPA-PRLYWFKDGQPLTASAHIRMTDKKILHTLEIISVTREDSGQYAAYISNAMGAAY 5343

Query: 1161 TFNVILA-------EPPVQFLALETTP-------SPLCVAPGEPVVLSCELSRAGAPVVW 1206
            +   +L        E P   +  +  P       +P  V  G  +  S ++   G PV  
Sbjct: 5344 SSARLLVRGPDEPEEKPASDVHEQLVPPRMLERFTPKKVKKGSSITFSVKVE--GRPVPT 5401

Query: 1207 SHNGRPVQE---------GEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLS 1257
             H  R   E           G  + +   +  L +   G  H G YTC +  A G    S
Sbjct: 5402 VHWLREEAERGVLWIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCS 5461

Query: 1258 FTVQVAEPP 1266
             ++ V+  P
Sbjct: 5462 ASLHVSGLP 5470



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 44/158 (27%), Positives = 66/158 (41%), Gaps = 12/158 (7%)

Query: 914  ERVVLTCELC-RPWAEVRWTKDGEEVVESPA-LLLQKEDTVRRLVLPAVQLEDSGEYLCE 971
            E V L C +   P   + W KDG+ V   P  +L++  D    L+L ++   DSG+Y+C 
Sbjct: 6029 ETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCF 6088

Query: 972  IDDESASFT----VTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDG 1026
                + + +    + V  PP  +   R       V  E     C +     P +RWYKDG
Sbjct: 6089 AASAAGNCSTLGKILVQVPPRFVNKVRASP---FVEGEDAQFTCTIEGAPYPQIRWYKDG 6145

Query: 1027 --LEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCD 1062
              L        + E       LV+ AA  ED G + C+
Sbjct: 6146 ALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECE 6183



 Score = 39.7 bits (91), Expect = 0.028
 Identities = 64/274 (23%), Positives = 102/274 (37%), Gaps = 57/274 (20%)

Query: 1450 LFLRRLQDVRAEEGQDVCLE-VETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHI-HRL 1507
            +FL  LQ+   ++G  V  + V TG+     +VRW + G+ L  D    + +D    H+L
Sbjct: 5127 VFLTELQNQEVQDGYPVSFDCVVTGQ--PMPSVRWFKDGKLLEEDDHYMINEDQQGGHQL 5184

Query: 1508 FIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEG 1567
             I  V+ AD G Y C + +      +S    +LRV     D+T ++  +A    E S   
Sbjct: 5185 IITAVVPADMGVYRCLAENS---MGVSSTKAELRV-----DLTSTDYDTAADATESSS-- 5234

Query: 1568 VTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGL-GLADSGCVSFTADSLRCAARLIVRE 1626
                              +  + G+       G     D G +    + LR         
Sbjct: 5235 ------------------YFSAQGYLSSREQEGTESTTDEGQLPQVVEELR--------- 5267

Query: 1627 VPVTIVRGPHDLEVTEGD-TATFECELSQALAD-VTWEKDGNALTPSPRLRLQALGTRRL 1684
                      DL+V  G   A F+ ++    A  + W KDG  LT S  +R+        
Sbjct: 5268 ----------DLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKILHT 5317

Query: 1685 LQLRRCGPSDAGTYSCAVGTARA---GPVRLTVR 1715
            L++      D+G Y+  +  A        RL VR
Sbjct: 5318 LEIISVTREDSGQYAAYISNAMGAAYSSARLLVR 5351



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 47/177 (26%), Positives = 67/177 (37%), Gaps = 31/177 (17%)

Query: 1483 WVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDR----TLARLSVRPR 1538
            W + GQPL   + + M     +H L I  V   D G Y     +      + ARL VR  
Sbjct: 5294 WFKDGQPLTASAHIRMTDKKILHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGP 5353

Query: 1539 QLRVLRPLEDV----------------TISEGGSATFQLELSQEGV-TGEWARGGVQ--- 1578
                 +P  DV                 + +G S TF +++    V T  W R   +   
Sbjct: 5354 DEPEEKPASDVHEQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGV 5413

Query: 1579 LYPGPKC---HIHSDGHRHRLVLNGLGLADSG---CV-SFTADSLRCAARLIVREVP 1628
            L+ GP      + S   +H LVL  +G    G   C+ S  A    C+A L V  +P
Sbjct: 5414 LWIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSGLP 5470


>gi|148833506 obscurin, cytoskeletal calmodulin and titin-interacting
            RhoGEF isoform b [Homo sapiens]
          Length = 7968

 Score =  858 bits (2217), Expect = 0.0
 Identities = 585/1939 (30%), Positives = 896/1939 (46%), Gaps = 112/1939 (5%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLL 71
            P FL  P+   V  G +A L C ++G P P V WEK  Q +AA  R     DG  + L +
Sbjct: 10   PRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQDGDLYRLTI 69

Query: 72   TAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFL 131
                  D+G YVCRARNA GEA+AA  + V      D E   AE+          AP FL
Sbjct: 70   LDLALGDSGQYVCRARNAIGEAFAAVGLQV------DAEAACAEQ----------APHFL 113

Query: 132  TGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP--- 188
              P S  V  G+E    CR GG P P + W KDG  L E               DGP   
Sbjct: 114  LRPTSIRVREGSEATFRCRVGGSPRPAVSWSKDGRRLGE--------------PDGPRVR 159

Query: 189  ----GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPV 244
                G + ALRI AAR  D G Y   A N  G A A A L V        + P  + A +
Sbjct: 160  VEELGEASALRIRAARPRDGGTYEVRAENPLGAASAAAALVVDSDAADTASRPGTSTAAL 219

Query: 245  V-----------------EPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLL 287
            +                  P     +T  V EGKHA+  CYV G+P+PE  W  +G+ + 
Sbjct: 220  LAHLQRRREAMRAEGAPASPPSTGTRTCTVTEGKHARLSCYVTGEPKPETVWKKDGQLVT 279

Query: 288  PDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPL 347
              RR ++Y D    FVLK+L+C+  DRGLY C A N  GQT S+V + V+EP + F + L
Sbjct: 280  EGRRHVVYEDAQENFVLKILFCKQSDRGLYTCTASNLVGQTYSSVLVVVREPAVPFKKRL 339

Query: 348  QDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDD 407
            QD+E RE   A   C+VP      AWF+E+ RL    KY   EEGT RRL +  + ADDD
Sbjct: 340  QDLEVREKESATFLCEVPQPSTEAAWFKEETRLWASAKYGIEEEGTERRLTVRNVSADDD 399

Query: 408  GIYLCEMRGRVRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEE 467
             +Y+CE     RTVA + V+G +L++LPRK  V  G+ A+  VE         W R+ EE
Sbjct: 400  AVYICETPEGSRTVAELAVQGNLLRKLPRKTAVRVGDTAMFCVELAVPVGPVHWLRNQEE 459

Query: 468  LPV---ICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILA 524
            +     +  S+ G  H L +     ED G+V F  G+ +T+T   V   +  P  PP+  
Sbjct: 460  VVAGGRVAISAEGTRHTLTISQCCLEDVGQVAFMAGDCQTSTQFCVSAPRKPPLQPPVDP 519

Query: 525  EMFKGHKNTVLLTWKPPEPAPETPFI---YRLERQEVGSEDWIQCFSIEKAGAVEVPGDC 581
             +    +++V+L+W PP P  E P     Y +E++++G+  WI+C   E     E+    
Sbjct: 520  VVKARMESSVILSWSPP-PHGERPVTIDGYLVEKKKLGTYTWIRCHEAEWVATPELTVAD 578

Query: 582  VPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLST 641
            V  EG+++FR+  ++  G+SP++ F G+ HL P   +   L+ VQ  +G +  FS+DL+ 
Sbjct: 579  VAEEGNFQFRVSALNSFGQSPYLEFPGTVHLAPKLAVRTPLKAVQAVEGGEVTFSVDLTV 638

Query: 642  IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPG 701
               G WFL+G+ LK++            Y I     +H L +  V     GA + F   G
Sbjct: 639  ASAGEWFLDGQALKASSV----------YEIHCDRTRHTLTIREVPASLHGAQLKFVANG 688

Query: 702  VQDSAALTIQESPVHILSPQDRVS---LTFTTSERVVLTCELSRVDFPATWYKDGQKVEE 758
            ++ S  + ++ +P    +     +   +     E   L  ELS      TW KDG+ +  
Sbjct: 689  IESSIRMEVRAAPGLTANKPPAAAAREVLARLHEEAQLLAELSDQAAAVTWLKDGRTLSP 748

Query: 759  SELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVH 818
                 V+    +  L++ +    D+G +EC + G    + ++VQ     +        V 
Sbjct: 749  GPKYEVQASAGRRVLLVRDVARDDAGLYECVSRGGRIAYQLSVQGLARFLHKDMAGSCVD 808

Query: 819  AITSECVMLACEVDREDAPVRWYKDGQEVEES-DFVVLENEGPHRRLVLPATQPSDGGEF 877
            A+        CE       V WYKDG E+  S +  + E+ G   RLV       D G +
Sbjct: 809  AVAGGPAQFECETSEAHVHVHWYKDGMELGHSGERFLQEDVGTRHRLVAATVTRQDEGTY 868

Query: 878  QCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLE---RVVLTCELCRPWAEVRWTKD 934
             C  G++   F + +++    +V+   ++    ++ E      L+CE+ +   EV W KD
Sbjct: 869  SCRVGEDSVDFRLRVSEPK--VVFAKEQLARRKLQAEAGASATLSCEVAQAQTEVTWYKD 926

Query: 935  GEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPR 994
            G+++  S  + ++     RRLV+      D+GEY CE   +  SF + V EP  ++++ +
Sbjct: 927  GKKLSSSSKVCMEATGCTRRLVVQQAGQADAGEYSCEAGGQRLSFHLDVKEP--KVVFAK 984

Query: 995  DEVTLIAVTLEC---VVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAA 1051
            D+V    V  E      L CE+++    V WYKDG ++  S  + +E  G R RLV+  A
Sbjct: 985  DQVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSSSLKVHVEAKGCRRRLVVQQA 1044

Query: 1052 QPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQ 1111
               D G++ C+A      F + +T P        +   ++   A     L CEVA A ++
Sbjct: 1045 GKTDAGDYSCEARGQRVSFRLHITEPKMMFAKEQSVHNEVQAEAGASAMLSCEVAQAQTE 1104

Query: 1112 VRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPV 1171
            V WYKDG ++ +S  + +  +G TR L LP A   DAGEY CE   + ++F++ + EP  
Sbjct: 1105 VTWYKDGKKLSSSSKVGMEVKGCTRRLVLPQAGKADAGEYSCEAGGQRVSFHLHITEPKG 1164

Query: 1172 QFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLC 1231
             F   ++  + +    G   +LSCE+++    V W  +G+ +     + +  +G  R L 
Sbjct: 1165 VFAKEQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWYKDGKKLSSSSKVRMEVKGCTRRLV 1224

Query: 1232 IQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVV 1291
            +Q  G A AG Y+C++    G   +SF + + EP       +     VR+  G    L  
Sbjct: 1225 VQQVGKADAGEYSCEA----GGQRVSFQLHITEPKAVFAKEQLVHNEVRTEAGASATLSC 1280

Query: 1292 HLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFL 1351
             ++     V WYKDG++L+S  +V++E AG  + L VQ A   DAGEY C+A      F 
Sbjct: 1281 EVAQAQTEVTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQAGQADAGEYTCEAGGQRLSFH 1340

Query: 1352 VSVEEPLLVKLVSELT--PLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQ 1409
            + V EP  V    +L    +    G  AT  CEV+    +VTW ++G  ++   +V M  
Sbjct: 1341 LDVSEPKAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQTEVTWYKDGKKLSSSSKVRMEA 1400

Query: 1410 NGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRL---QDVRAEEGQDV 1466
             G +R L ++     D G  +  AG    S  L V E +++F +     ++V+A+ G   
Sbjct: 1401 VGCTRRLVVQQACQADTGEYSCEAGGQRLSFSLDVAEPKVVFAKEQPVHREVQAQAGAST 1460

Query: 1467 CLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH 1526
             L  E  +  A   V W + G+ L   S++ M   G   RL +     A  G Y CE+  
Sbjct: 1461 TLSCEVAQ--AQTEVMWYKDGKKLSFSSKVRMEAVGCTRRLVVQQAGQAVAGEYSCEAGS 1518

Query: 1527 DRTLARLSV-RPRQL--RVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGP 1583
             R    L V  P+ +  +      +V    G SAT   E++Q      W + G +L    
Sbjct: 1519 QRLSFHLHVAEPKAVFAKEQPASREVQAEAGTSATLSCEVAQAQTEVTWYKDGKKLSSSS 1578

Query: 1584 KCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVR---GPHDLEV 1640
            K  + + G   RLV+   G AD+G  S  A   R +  L V E  V   +      +++ 
Sbjct: 1579 KVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQRLSFHLHVAEPKVVFAKEQPAHREVQA 1638

Query: 1641 TEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC 1700
              G +AT  CE++QA  +VTW KDG  L+ S ++R++A+G  R L +++ G +DAG YSC
Sbjct: 1639 EAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRVEAVGCTRRLVVQQAGQADAGEYSC 1698

Query: 1701 AVGTARAGPVRLTVRERTVAVLS---ELRSVSAREGDGATFECTVSEVE-TTGRWELGGR 1756
              G  R    RL V E    +         +  +E +      T++     T  W   G 
Sbjct: 1699 EAGGQRLS-FRLHVAELEPQISERPCRREPLVVKEHEDIILTATLATPSAATVTWLKDGV 1757

Query: 1757 PLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCR--HP 1814
             +R   R     +G  H L +   +  D+     + G       ++VE +  + CR   P
Sbjct: 1758 EIRRSKRHETASQGDTHTLTVHGAQVLDSAIYSCRVGAEGQDFPVQVEEVAAKFCRLLEP 1817

Query: 1815 PREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPED 1874
               +   +G    L   +S +   V W     +L  G +++M + GP  SL +  +R ED
Sbjct: 1818 VCGE---LGGTVTLACELSPACAEVVWRCGNTQLRVGKRFQMVAEGPVRSLTVLGLRAED 1874

Query: 1875 QGTYCCQAGQDSTHTRLLV 1893
             G Y C++  D T  +L V
Sbjct: 1875 AGEYVCESRDDHTSAQLTV 1893



 Score =  621 bits (1602), Expect = e-177
 Identities = 473/1604 (29%), Positives = 723/1604 (45%), Gaps = 80/1604 (4%)

Query: 330  SAVQLHVKE-PRLRFTRP----LQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCR 384
            S++++ V+  P L   +P     ++V  R H  A L  ++ +      W ++ + L P  
Sbjct: 691  SSIRMEVRAAPGLTANKPPAAAAREVLARLHEEAQLLAELSDQAAAVTWLKDGRTLSPGP 750

Query: 385  KYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRK------L 438
            KYE       R L++  +  DD G+Y C  RG  R    ++V+G  L R   K      +
Sbjct: 751  KYEVQASAGRRVLLVRDVARDDAGLYECVSRGG-RIAYQLSVQG--LARFLHKDMAGSCV 807

Query: 439  DVLEGENAVLLVETLEAGVEGRWSRDGEEL----PVICQSSSGHMHALVLPGVTREDAGE 494
            D + G  A    ET EA V   W +DG EL        Q   G  H LV   VTR+D G 
Sbjct: 808  DAVAGGPAQFECETSEAHVHVHWYKDGMELGHSGERFLQEDVGTRHRLVAATVTRQDEGT 867

Query: 495  VTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHK------NTVLLTWKPPEPAPETP 548
             +  +G       LRV     S P      E     K       +  L+ +  +   E  
Sbjct: 868  YSCRVGEDSVDFRLRV-----SEPKVVFAKEQLARRKLQAEAGASATLSCEVAQAQTEVT 922

Query: 549  FIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHG 608
            +    ++    S+  ++     +   V+  G      G+Y    C   G   S H+    
Sbjct: 923  WYKDGKKLSSSSKVCMEATGCTRRLVVQQAGQA--DAGEYS---CEAGGQRLSFHLDVKE 977

Query: 609  SAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGA 667
                V  A+      +VQ   G  A  S +++    +  W+ +G++L S+          
Sbjct: 978  PK--VVFAKDQVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSSS---------- 1025

Query: 668  LRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESPVHILSPQD-RV 724
            L+  +E KG + RL++      D+G    +SC   G + S  L I E  +     Q    
Sbjct: 1026 LKVHVEAKGCRRRLVVQQAGKTDAG---DYSCEARGQRVSFRLHITEPKMMFAKEQSVHN 1082

Query: 725  SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
             +        +L+CE+++     TWYKDG+K+  S  + +++ G   RL+LP+A   D+G
Sbjct: 1083 EVQAEAGASAMLSCEVAQAQTEVTWYKDGKKLSSSSKVGMEVKGCTRRLVLPQAGKADAG 1142

Query: 785  EFECRTEGVSAFFGVTVQDPP-VHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKD 843
            E+ C   G    F + + +P  V   +   H  V A      ML+CEV +    V WYKD
Sbjct: 1143 EYSCEAGGQRVSFHLHITEPKGVFAKEQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWYKD 1202

Query: 844  GQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPS 903
            G+++  S  V +E +G  RRLV+     +D GE+ C AG +   F + IT+  +  V+  
Sbjct: 1203 GKKLSSSSKVRMEVKGCTRRLVVQQVGKADAGEYSCEAGGQRVSFQLHITEPKA--VFAK 1260

Query: 904  GKVYVAAVRLER---VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV 960
             ++    VR E      L+CE+ +   EV W KDG+++  S  + ++    +R+LV+   
Sbjct: 1261 EQLVHNEVRTEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQA 1320

Query: 961  QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLEC---VVLMCELSRED 1017
               D+GEY CE   +  SF + V+EP  + ++ ++++    V  E      L CE+++  
Sbjct: 1321 GQADAGEYTCEAGGQRLSFHLDVSEP--KAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQ 1378

Query: 1018 APVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAP 1077
              V WYKDG ++  S  + +E  G   RLV+  A   D GE+ C+AG     F++ V  P
Sbjct: 1379 TEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQQACQADTGEYSCEAGGQRLSFSLDVAEP 1438

Query: 1078 PERIV--HPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPT 1135
                    P  R +    GA     L CEVA A ++V WYKDG ++  S  +++ A G T
Sbjct: 1439 KVVFAKEQPVHREVQAQAGAS--TTLSCEVAQAQTEVMWYKDGKKLSFSSKVRMEAVGCT 1496

Query: 1136 RTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSC 1195
            R L +  A    AGEY CE   + ++F++ +AEP   F   +     +    G    LSC
Sbjct: 1497 RRLVVQQAGQAVAGEYSCEAGSQRLSFHLHVAEPKAVFAKEQPASREVQAEAGTSATLSC 1556

Query: 1196 ELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPS 1255
            E+++A   V W  +G+ +     + + A G  R L +Q AG A AG Y+C++G       
Sbjct: 1557 EVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQ----R 1612

Query: 1256 LSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRV 1315
            LSF + VAEP V     + A   V++  G    L   ++     V WYKDG++L+S  +V
Sbjct: 1613 LSFHLHVAEPKVVFAKEQPAHREVQAEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKV 1672

Query: 1316 QLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEE--PLLVKLVSELTPLTVHE 1373
            ++E  G  + L VQ A   DAGEY C+A      F + V E  P + +      PL V E
Sbjct: 1673 RVEAVGCTRRLVVQQAGQADAGEYSCEAGGQRLSFRLHVAELEPQISERPCRREPLVVKE 1732

Query: 1374 GDDATFRCEVSPPDA-DVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR 1432
             +D      ++ P A  VTWL++G  +    + E A  G +  LT+ G Q+ D+   + R
Sbjct: 1733 HEDIILTATLATPSAATVTWLKDGVEIRRSKRHETASQGDTHTLTVHGAQVLDSAIYSCR 1792

Query: 1433 AGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPH 1492
             G+      + V E    F R L+ V  E G  V L  E     A   V W  G   L  
Sbjct: 1793 VGAEGQDFPVQVEEVAAKFCRLLEPVCGELGGTVTLACELSP--ACAEVVWRCGNTQLRV 1850

Query: 1493 DSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVR-PRQLRVLRPLEDVTI 1551
              R  M  +G +  L + G+   D G Y CES  D T A+L+V  PR ++ +  L  V  
Sbjct: 1851 GKRFQMVAEGPVRSLTVLGLRAEDAGEYVCESRDDHTSAQLTVSVPRVVKFMSGLSTVVA 1910

Query: 1552 SEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSF 1611
             EGG ATFQ  +S   V   W R G  L P  K  I   G  H L ++ L L D+G ++ 
Sbjct: 1911 EEGGEATFQCVVSPSDVAVVWFRDGALLQPSEKFAISQSGASHSLTISDLVLEDAGQITV 1970

Query: 1612 TADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPS 1671
             A+    +A L VRE PV   +      V E  + T E EL++   ++ W ++  AL P 
Sbjct: 1971 EAEGASSSAALRVREAPVLFKKKLEPQTVEERSSVTLEVELTRPWPELRWTRNATALAPG 2030

Query: 1672 PRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAR 1731
              + + A G R  L L   G +D G + C     +    +LTV  R V ++  L++V AR
Sbjct: 2031 KNVEIHAEGARHRLVLHNVGFADRGFFGCETPDDKT-QAKLTVEMRQVRLVRGLQAVEAR 2089

Query: 1732 EGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQ 1791
            E   AT E  +S  +  G W   G   + G    +   G  H L LS LR ED+G + F+
Sbjct: 2090 EQGTATMEVQLSHADVDGSWTRDGLRFQQGPTCHLAVRGPMHTLTLSGLRPEDSGLMVFK 2149

Query: 1792 AGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPG 1851
            A    + A L V  LP+   R P ++       +  LE  +SR    V WL++G EL  G
Sbjct: 2150 AEGVHTSARLVVTELPVSFSR-PLQDVVTTEKEKVTLECELSRPNVDVRWLKDGVELRAG 2208

Query: 1852 DKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEG 1895
                + + G   SL I+     DQG Y C A    +   + V+G
Sbjct: 2209 KTMAIAAQGACRSLTIYRCEFADQGVYVCDAHDAQSSASVKVQG 2252



 Score =  605 bits (1561), Expect = e-172
 Identities = 483/1704 (28%), Positives = 765/1704 (44%), Gaps = 121/1704 (7%)

Query: 260  GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
            G  A+F C    +    + W+ +G  L     R +  D      L       +D G Y C
Sbjct: 812  GGPAQFECET-SEAHVHVHWYKDGMELGHSGERFLQEDVGTRHRLVAATVTRQDEGTYSC 870

Query: 320  AARNSAGQTLSAVQLHVKEPRLRFTRPL---QDVEGREHGIAVLECKVPNSRIPTAWFRE 376
                  G+     +L V EP++ F +     + ++      A L C+V  ++    W+++
Sbjct: 871  RV----GEDSVDFRLRVSEPKVVFAKEQLARRKLQAEAGASATLSCEVAQAQTEVTWYKD 926

Query: 377  DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPIL----- 431
             ++L    K      G  RRL++ +    D G Y CE  G+ R   ++ VK P +     
Sbjct: 927  GKKLSSSSKVCMEATGCTRRLVVQQAGQADAGEYSCEAGGQ-RLSFHLDVKEPKVVFAKD 985

Query: 432  KRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SSSGHMHALVLPGVT 488
            +    ++    G +A L  E  +A  E  W +DG++L    +    + G    LV+    
Sbjct: 986  QVAHSEVQAEAGASATLSCEVAQAQTEVMWYKDGKKLSSSLKVHVEAKGCRRRLVVQQAG 1045

Query: 489  REDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETP 548
            + DAG+ +      R +  L +         P ++    +   N V    +    A  + 
Sbjct: 1046 KTDAGDYSCEARGQRVSFRLHIT-------EPKMMFAKEQSVHNEVQA--EAGASAMLSC 1096

Query: 549  FIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDC----VPSEG--DYRFRICTVSGHGRSP 602
             + + + +    +D  +  S  K G +EV G      +P  G  D     C   G   S 
Sbjct: 1097 EVAQAQTEVTWYKDGKKLSSSSKVG-MEVKGCTRRLVLPQAGKADAGEYSCEAGGQRVSF 1155

Query: 603  HVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEG 661
            H+  H +      A+  +   +VQ   G  A+ S +++    + TW+ +G++L S+    
Sbjct: 1156 HL--HITEPKGVFAKEQSVHNEVQAEAGTTAMLSCEVAQPQTEVTWYKDGKKLSSSS--- 1210

Query: 662  QVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESPVHILS 719
                   + R+E KG   RL++  V   D+G    +SC   G + S  L I E P  + +
Sbjct: 1211 -------KVRMEVKGCTRRLVVQQVGKADAGE---YSCEAGGQRVSFQLHITE-PKAVFA 1259

Query: 720  PQDRVSLTFTTSE--RVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPE 777
             +  V     T       L+CE+++     TWYKDG+K+  S  + ++  G   +L++ +
Sbjct: 1260 KEQLVHNEVRTEAGASATLSCEVAQAQTEVTWYKDGKKLSSSSKVRIEAAGCMRQLVVQQ 1319

Query: 778  AKVQDSGEFECRTEGVSAFFGVTVQDPP-VHIVDPREHVFVHAITSECVMLACEVDREDA 836
            A   D+GE+ C   G    F + V +P  V   +   H  V A       L+CEV +   
Sbjct: 1320 AGQADAGEYTCEAGGQRLSFHLDVSEPKAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQT 1379

Query: 837  PVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVS 896
             V WYKDG+++  S  V +E  G  RRLV+     +D GE+ C AG +   F++ + +  
Sbjct: 1380 EVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQQACQADTGEYSCEAGGQRLSFSLDVAEPK 1439

Query: 897  SWIVYPSGKVYVAAVRLER---VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVR 953
              +V+   +     V+ +      L+CE+ +   EV W KDG+++  S  + ++     R
Sbjct: 1440 --VVFAKEQPVHREVQAQAGASTTLSCEVAQAQTEVMWYKDGKKLSFSSKVRMEAVGCTR 1497

Query: 954  RLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLEC---VVLM 1010
            RLV+       +GEY CE   +  SF + V EP  + ++ +++     V  E      L 
Sbjct: 1498 RLVVQQAGQAVAGEYSCEAGSQRLSFHLHVAEP--KAVFAKEQPASREVQAEAGTSATLS 1555

Query: 1011 CELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFF 1070
            CE+++    V WYKDG ++  S  + +E  G   RLV+  A   D GE+ C AGD    F
Sbjct: 1556 CEVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQRLSF 1615

Query: 1071 TVTVTAPPERIV--HPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQ 1128
             + V  P        PA R +    GA     L CEVA A ++V WYKDG ++ +S  ++
Sbjct: 1616 HLHVAEPKVVFAKEQPAHREVQAEAGASAT--LSCEVAQAQTEVTWYKDGKKLSSSSKVR 1673

Query: 1129 LGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPG 1188
            + A G TR L +  A   DAGEY CE   + ++F + +AE   Q         PL V   
Sbjct: 1674 VEAVGCTRRLVVQQAGQADAGEYSCEAGGQRLSFRLHVAELEPQISERPCRREPLVVKEH 1733

Query: 1189 EPVVLSCELSR-AGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQS 1247
            E ++L+  L+  + A V W  +G  ++  +  E  ++G    L +  A    + +Y+C+ 
Sbjct: 1734 EDIILTATLATPSAATVTWLKDGVEIRRSKRHETASQGDTHTLTVHGAQVLDSAIYSCRV 1793

Query: 1248 GAAPGAPSLSFTVQVAEPPV---RVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYK 1304
            GA        F VQV E      R++ P   +       GG + L   LS     V W  
Sbjct: 1794 GAE----GQDFPVQVEEVAAKFCRLLEPVCGEL------GGTVTLACELSPACAEVVWRC 1843

Query: 1305 DGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVS 1364
               +L    R Q+   G  + L V G R+ DAGEY+C++  D     ++V  P +VK +S
Sbjct: 1844 GNTQLRVGKRFQMVAEGPVRSLTVLGLRAEDAGEYVCESRDDHTSAQLTVSVPRVVKFMS 1903

Query: 1365 ELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLG 1424
             L+ +   EG +ATF+C VSP D  V W R+GA++ P  +  ++Q+G+S  LT+    L 
Sbjct: 1904 GLSTVVAEEGGEATFQCVVSPSDVAVVWFRDGALLQPSEKFAISQSGASHSLTISDLVLE 1963

Query: 1425 DAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWV 1484
            DAG +T+ A   ++SA L VRE  +LF ++L+    EE   V LEVE  R      +RW 
Sbjct: 1964 DAGQITVEAEGASSSAALRVREAPVLFKKKLEPQTVEERSSVTLEVELTRPWPE--LRWT 2021

Query: 1485 RGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLR 1544
            R    L     + +  +G  HRL +H V  AD+G +GCE+  D+T A+L+V  RQ+R++R
Sbjct: 2022 RNATALAPGKNVEIHAEGARHRLVLHNVGFADRGFFGCETPDDKTQAKLTVEMRQVRLVR 2081

Query: 1545 PLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLA 1604
             L+ V   E G+AT +++LS   V G W R G++   GP CH+   G  H L L+GL   
Sbjct: 2082 GLQAVEAREQGTATMEVQLSHADVDGSWTRDGLRFQQGPTCHLAVRGPMHTLTLSGLRPE 2141

Query: 1605 DSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKD 1664
            DSG + F A+ +  +ARL+V E+PV+  R   D+  TE +  T ECELS+   DV W KD
Sbjct: 2142 DSGLMVFKAEGVHTSARLVVTELPVSFSRPLQDVVTTEKEKVTLECELSRPNVDVRWLKD 2201

Query: 1665 GNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTAR------------------ 1706
            G  L     + + A G  R L + RC  +D G Y C    A+                  
Sbjct: 2202 GVELRAGKTMAIAAQGACRSLTIYRCEFADQGVYVCDAHDAQSSASVKVQGRTYTLIYRR 2261

Query: 1707 -----AGPV-----------RLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGR 1750
                 AG +           +L V+E  V ++  LR   A E      EC VS      R
Sbjct: 2262 VLAEDAGEIQFVAENAESRAQLRVKELPVTLVRPLRDKIAMEKHRGVLECQVSRASAQVR 2321

Query: 1751 WELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQM 1810
            W  G + L+PG +  +  +G    L++S++ AED       AG  ++ A   VE   + +
Sbjct: 2322 WFKGSQELQPGPKYELVSDGLYRKLIISDVHAEDEDTYTCDAGDVKTSAQFFVEEQSITI 2381

Query: 1811 CRHPPREKTVLVGRRAVLEVTVS-RSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHD 1869
             R   ++ TV+    A  E   S  S     WL     L  G    +   G  H L++  
Sbjct: 2382 VR-GLQDVTVMEPAPAWFECETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRR 2440

Query: 1870 VRPEDQGTYCCQAGQDSTHTRLLV 1893
                  G      G+  +  RL+V
Sbjct: 2441 TCSTMTGPVHFTVGKSRSSARLVV 2464



 Score =  499 bits (1284), Expect = e-140
 Identities = 511/1946 (26%), Positives = 789/1946 (40%), Gaps = 189/1946 (9%)

Query: 21   VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
            V+  +GA A L C V  +    V W K G++L++S ++     G    L+L  A   DAG
Sbjct: 1084 VQAEAGASAMLSCEV-AQAQTEVTWYKDGKKLSSSSKVGMEVKGCTRRLVLPQAGKADAG 1142

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL 140
             Y C A    G    +  + + EP     + Q     + +                    
Sbjct: 1143 EYSCEA----GGQRVSFHLHITEPKGVFAKEQSVHNEVQAEA------------------ 1180

Query: 141  RGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAAR 200
             G   +L+C     P+  + W KDG  L     SS   ++        G +  L +    
Sbjct: 1181 -GTTAMLSCEVAQ-PQTEVTWYKDGKKLSS---SSKVRMEV------KGCTRRLVVQQVG 1229

Query: 201  LPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEG 260
              D+G Y C A    G  +    L + +P              V    +          G
Sbjct: 1230 KADAGEYSCEA----GGQRVSFQLHITEPKA------------VFAKEQLVHNEVRTEAG 1273

Query: 261  KHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQA--KDRGLYV 318
              A   C V  + + E+ W+ +G+ L    +    R    G + +++  QA   D G Y 
Sbjct: 1274 ASATLSCEV-AQAQTEVTWYKDGKKLSSSSK---VRIEAAGCMRQLVVQQAGQADAGEYT 1329

Query: 319  CAARNSAGQTLSAVQLHVKEPRLRFTRPL---QDVEGREHGIAVLECKVPNSRIPTAWFR 375
            C A    GQ LS   L V EP+  F +     + V+     IA L C+V  ++    W++
Sbjct: 1330 CEA---GGQRLS-FHLDVSEPKAVFAKEQLAHRKVQAEAGAIATLSCEVAQAQTEVTWYK 1385

Query: 376  EDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGP---ILK 432
            + ++L    K      G  RRL++ +    D G Y CE  G+ R   ++ V  P     K
Sbjct: 1386 DGKKLSSSSKVRMEAVGCTRRLVVQQACQADTGEYSCEAGGQ-RLSFSLDVAEPKVVFAK 1444

Query: 433  RLP--RKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHALVLPGV 487
              P  R++    G +  L  E  +A  E  W +DG++L     +   + G    LV+   
Sbjct: 1445 EQPVHREVQAQAGASTTLSCEVAQAQTEVMWYKDGKKLSFSSKVRMEAVGCTRRLVVQQA 1504

Query: 488  TREDAGEVTFSLGNSRTTTLLRV---KCV--KHSPPGPPILAEMFKGHKNTVLLTWKPPE 542
             +  AGE +   G+ R +  L V   K V  K  P    + AE       +  L+ +  +
Sbjct: 1505 GQAVAGEYSCEAGSQRLSFHLHVAEPKAVFAKEQPASREVQAEA----GTSATLSCEVAQ 1560

Query: 543  PAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSE-----GDYRFRICTVSG 597
               E  +    ++    S+  ++     +   V+  G     E     GD R        
Sbjct: 1561 AQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQADAGEYSCKAGDQRLSFHL--- 1617

Query: 598  HGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKS 656
            H   P VVF         A+      +VQ   G  A  S +++    + TW+ +G++L S
Sbjct: 1618 HVAEPKVVF---------AKEQPAHREVQAEAGASATLSCEVAQAQTEVTWYKDGKKLSS 1668

Query: 657  NEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESP 714
            +           + R+E  G   RL++      D+G    +SC   G + S  L + E  
Sbjct: 1669 SS----------KVRVEAVGCTRRLVVQQAGQADAGE---YSCEAGGQRLSFRLHVAELE 1715

Query: 715  VHILS-PQDRVSLTFTTSERVVLTCELSRVDFPA-TWYKDGQKVEESELLVVKMDGRKHR 772
              I   P  R  L     E ++LT  L+       TW KDG ++  S+       G  H 
Sbjct: 1716 PQISERPCRREPLVVKEHEDIILTATLATPSAATVTWLKDGVEIRRSKRHETASQGDTHT 1775

Query: 773  LILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSEC------VM 826
            L +  A+V DS  + CR        G   QD PV + +     F   +   C      V 
Sbjct: 1776 LTVHGAQVLDSAIYSCRV-------GAEGQDFPVQVEEVAAK-FCRLLEPVCGELGGTVT 1827

Query: 827  LACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECA 886
            LACE+    A V W     ++       +  EGP R L +   +  D GE+ C + D+  
Sbjct: 1828 LACELSPACAEVVWRCGNTQLRVGKRFQMVAEGPVRSLTVLGLRAEDAGEYVCESRDDHT 1887

Query: 887  YFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLL 946
               +T++ V   + + SG   V A         C +      V W +DG  +  S    +
Sbjct: 1888 SAQLTVS-VPRVVKFMSGLSTVVAEEGGEATFQCVVSPSDVAVVWFRDGALLQPSEKFAI 1946

Query: 947  QKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPV---RIIYPRDEVTLIAVT 1003
             +      L +  + LED+G+   E +  S+S  + V E PV   + + P+      +VT
Sbjct: 1947 SQSGASHSLTISDLVLEDAGQITVEAEGASSSAALRVREAPVLFKKKLEPQTVEERSSVT 2006

Query: 1004 LECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDA 1063
            LE      EL+R    +RW ++   +   + + +  +G R RLVL      D G F C+ 
Sbjct: 2007 LEV-----ELTRPWPELRWTRNATALAPGKNVEIHAEGARHRLVLHNVGFADRGFFGCET 2061

Query: 1064 GDDSAFFTVTVTAPPERIVHPAARSLD-LHFGAPGRVELRCEVAPAGSQVRWYKDGLEVE 1122
             DD     +TV     R+V    R L  +     G   +  +++ A     W +DGL  +
Sbjct: 2062 PDDKTQAKLTVEMRQVRLV----RGLQAVEAREQGTATMEVQLSHADVDGSWTRDGLRFQ 2117

Query: 1123 ASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSP 1182
                  L   GP  TLTL   +PED+G  V +      +  +++ E PV F         
Sbjct: 2118 QGPTCHLAVRGPMHTLTLSGLRPEDSGLMVFKAEGVHTSARLVVTELPVSF---SRPLQD 2174

Query: 1183 LCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGL 1242
            +     E V L CELSR    V W  +G  ++ G+ + + A+G  R L I     A  G+
Sbjct: 2175 VVTTEKEKVTLECELSRPNVDVRWLKDGVELRAGKTMAIAAQGACRSLTIYRCEFADQGV 2234

Query: 1243 YTC-----QSGAAPGAPSLSFTV----QVAEPP--VRVVAPEA---AQTRVRSTP----- 1283
            Y C     QS A+      ++T+     +AE    ++ VA  A   AQ RV+  P     
Sbjct: 2235 YVCDAHDAQSSASVKVQGRTYTLIYRRVLAEDAGEIQFVAENAESRAQLRVKELPVTLVR 2294

Query: 1284 -----------GGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGAR 1332
                        G LE  V  S     VRW+K  + L    + +L   G  + L +    
Sbjct: 2295 PLRDKIAMEKHRGVLECQV--SRASAQVRWFKGSQELQPGPKYELVSDGLYRKLIISDVH 2352

Query: 1333 SGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA-DVT 1391
            + D   Y CDA          VEE  +  +V  L  +TV E   A F CE S P      
Sbjct: 2353 AEDEDTYTCDAGDVKTSAQFFVEEQSIT-IVRGLQDVTVMEPAPAWFECETSIPSVRPPK 2411

Query: 1392 WLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLF 1451
            WL    V+  G  V + Q G+   L LR       G V    G + +SARL V +  ++ 
Sbjct: 2412 WLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTGPVHFTVGKSRSSARLVVSDIPVVL 2471

Query: 1452 LRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHG 1511
             R L+     E Q V L  +     A  AV+W +   PL    +  M+ +G +  L I  
Sbjct: 2472 TRPLEPKTGRELQSVVLSCDFRP--APKAVQWYKDDTPLSPSEKFKMSLEGQMAELRILR 2529

Query: 1512 VILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGE 1571
            ++ AD G Y C++    +   ++V  R++ V  PL+D   +E G A+F  ELS E    E
Sbjct: 2530 LMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQDAEATEEGWASFSCELSHEDEEVE 2589

Query: 1572 WARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTI 1631
            W+  G+ LY      I   G RH LVL  +  AD+G V  ++  +  +ARL VR  PV  
Sbjct: 2590 WSLNGMPLYNDSFHEISHKGRRHTLVLKSIQRADAGIVRASSLKVSTSARLEVRVKPVVF 2649

Query: 1632 VRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLR-LQALGTRRLLQLRRC 1690
            ++   DL   E  T   +CE+S   A V W KDG  L PS +   L   GTR L+ +   
Sbjct: 2650 LKALDDLSAEERGTLALQCEVSDPEAHVVWRKDGVQLGPSDKYDFLHTAGTRGLV-VHDV 2708

Query: 1691 GPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETT-- 1748
             P DAG Y+C VG+      R+ V +  V +   L+++   EG+  +FEC +S    +  
Sbjct: 2709 SPEDAGLYTCHVGSEET-RARVRVHDLHVGITKRLKTMEVLEGESCSFECVLSHESASDP 2767

Query: 1749 GRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPL 1808
              W +GG+ +   +R +  ++G+K+ILV+ E    DAGEV F      S A L V   P 
Sbjct: 2768 AMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSVRGLTSKASLIVRERPA 2827

Query: 1809 QMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIH 1868
             + + P  ++ V  G    L   +SR+G  V WL++   +    KY++   G    LVI 
Sbjct: 2828 AIIK-PLEDQWVAPGEDVELRCELSRAGTPVHWLKDRKAIRKSQKYDVVCEGTMAMLVIR 2886

Query: 1869 DVRPEDQGTYCCQAGQDSTHTRLLVE 1894
                +D G Y C+     +   L VE
Sbjct: 2887 GASLKDAGEYTCEVEASKSTASLHVE 2912



 Score =  497 bits (1280), Expect = e-140
 Identities = 512/1913 (26%), Positives = 781/1913 (40%), Gaps = 178/1913 (9%)

Query: 19   RPVRVVSGAEAELKCVVLG----EPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
            RP+   +G E  L+ VVL       P  V W K    L+ SE+     +G    L +   
Sbjct: 2473 RPLEPKTGRE--LQSVVLSCDFRPAPKAVQWYKDDTPLSPSEKFKMSLEGQMAELRILRL 2530

Query: 75   LPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGP 134
            +P DAGVY C+A    G A+++  VTV                       E   V +TGP
Sbjct: 2531 MPADAGVYRCQA----GSAHSSTEVTV-----------------------EAREVTVTGP 2563

Query: 135  RSQWVLRGAEVV------LTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP 188
                 L+ AE         +C      E  + W  +GM L    DS H     GR     
Sbjct: 2564 -----LQDAEATEEGWASFSCELSHEDEE-VEWSLNGMPLYN--DSFHEISHKGRRH--- 2612

Query: 189  GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
                 L + + +  D+G+     R +       A L+V   P              V  L
Sbjct: 2613 ----TLVLKSIQRADAGI----VRASSLKVSTSARLEVRVKP--------------VVFL 2650

Query: 249  KCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLP-DRRRLMYRDRDGGFVLKVL 307
            K          G  A  +C V   PE  + W  +G  L P D+   ++     G V+  +
Sbjct: 2651 KALDDLSAEERGTLA-LQCEV-SDPEAHVVWRKDGVQLGPSDKYDFLHTAGTRGLVVHDV 2708

Query: 308  YCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNS 367
                +D GLY C      G   +  ++ V +  +  T+ L+ +E  E      EC + + 
Sbjct: 2709 --SPEDAGLYTC----HVGSEETRARVRVHDLHVGITKRLKTMEVLEGESCSFECVLSHE 2762

Query: 368  RI--PTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVT 425
                P  W    + +    +++   +G    L++      D G  +  +RG     + + 
Sbjct: 2763 SASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSVRGLTSKASLIV 2822

Query: 426  VKGP--ILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRD------GEELPVICQSSSG 477
             + P  I+K L  +  V  GE+  L  E   AG    W +D       ++  V+C+   G
Sbjct: 2823 RERPAAIIKPLEDQW-VAPGEDVELRCELSRAGTPVHWLKDRKAIRKSQKYDVVCE---G 2878

Query: 478  HMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLT 537
             M  LV+ G + +DAGE T  +  S++T  L V+  + +      L  +    K T + T
Sbjct: 2879 TMAMLVIRGASLKDAGEYTCEVEASKSTASLHVE--EKANCFTEELTNLQVEEKGTAVFT 2936

Query: 538  WKPPEPAPETPFIYRL---------ERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDY 588
             K   PA    +   L         +  + G    +   ++EKA +     D   ++   
Sbjct: 2937 CKTEHPAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKADSDTYTCDIGQAQSRA 2996

Query: 589  RFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGT-- 646
            +  +      GR  H++                LEDV V +G  A F   +S        
Sbjct: 2997 QLLV-----QGRRVHII--------------EDLEDVDVQEGSSATFRCRISPANYEPVH 3037

Query: 647  WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSA 706
            WFL+   L +NE         L     Q G  H L L  +  +DSG +  F     + SA
Sbjct: 3038 WFLDKTPLHANE---------LNEIDAQPGGYHVLTLRQLALKDSGTIY-FEAGDQRASA 3087

Query: 707  ALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKM 766
            AL + E P   +  ++    T T  E + L CE S  D P  W KDG+ +  S    +  
Sbjct: 3088 ALRVTEKPS--VFSRELTDATITEGEDLTLVCETSTCDIPVCWTKDGKTLRGSARCQLSH 3145

Query: 767  DGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVM 826
            +G + +L++  A +QDSG ++C   G  +   V V   PV   +  + + V  +      
Sbjct: 3146 EGHRAQLLITGATLQDSGRYKCEAGGACSSSIVRVHARPVRFQEALKDLEV--LEGGAAT 3203

Query: 827  LACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECA 886
            L C +    APV+W      +   D   L  EG    LV+   +P D G + C  GD+  
Sbjct: 3204 LRCVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAMLELVVRNLRPQDSGRYSCSFGDQTT 3263

Query: 887  YFTVTITDVSSWIVYPSGKVY-VAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALL 945
              T+T+T + +  +   GK+    A       L CEL +  A V W K  E + +     
Sbjct: 3264 SATLTVTALPAQFI---GKLRNKEATEGATATLRCELSKA-APVEWRKGSETLRDGDRYC 3319

Query: 946  LQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYP-RDEVTLIAVTL 1004
            L+++  +  L +  + + D+ EY C   +E  S ++T+   P   I   R + ++   T 
Sbjct: 3320 LRQDGAMCELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFIGRLRHQESIEGAT- 3378

Query: 1005 ECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAG 1064
                L CELS+  APV W K    + + +   L +DG  C L +      D GE+ C  G
Sbjct: 3379 --ATLRCELSKA-APVEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSCVCG 3435

Query: 1065 DDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEAS 1124
            ++    T+TV A P +      R+ +   GA     L CE++   + V W K    +   
Sbjct: 3436 EERTSATLTVKALPAKFTE-GLRNEEAVEGATAM--LWCELSKV-APVEWRKGPENLRDG 3491

Query: 1125 DALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLC 1184
            D   L  EG    L +      DAGEY+C    E  +  + +   P +F+          
Sbjct: 3492 DRYILRQEGTRCELQICGLAMADAGEYLCVCGQERTSATLTIRALPARFIEDVKNQE--- 3548

Query: 1185 VAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYT 1244
               G   VL CEL+ A APV W      +++G+   L  +G +  L I+    A  G Y+
Sbjct: 3549 AREGATAVLQCELNSA-APVEWRKGSETLRDGDRYSLRQDGTKCELQIRGLAMADTGEYS 3607

Query: 1245 CQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYK 1304
            C  G    +  L+    V   P++            +T G    L   LS    PV W+K
Sbjct: 3608 CVCGQERTSAMLT----VRALPIKFTE---GLRNEEATEGATAVLRCELSKMA-PVEWWK 3659

Query: 1305 DGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVS 1364
              E L    R  L Q GAR  L+++G  + DAGEYLC   ++    +++V   +  K + 
Sbjct: 3660 GHETLRDGDRHSLRQDGARCELQIRGLVAEDAGEYLCMCGKERTSAMLTVRA-MPSKFIE 3718

Query: 1365 ELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLG 1424
             L      EGD AT  CE+S   A V W +    +  G +  + Q+GS   L +RG  + 
Sbjct: 3719 GLRNEEATEGDTATLWCELSKA-APVEWRKGHETLRDGDRHSLRQDGSRCELQIRGLAVV 3777

Query: 1425 DAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWV 1484
            DAG  +   G   TSA L VR     F+  +++  A EG    L+ E  +   A  V W 
Sbjct: 3778 DAGEYSCVCGQERTSATLTVRALPARFIEDVKNQEAREGATAVLQCELSK---AAPVEWR 3834

Query: 1485 RGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLR 1544
            +G + L    R S+ QDG    L IHG+ +AD G Y C    +RT A L+VR  Q     
Sbjct: 3835 KGSETLRGGDRYSLRQDGTRCELQIHGLSVADTGEYSCVCGQERTSATLTVRAPQPVFRE 3894

Query: 1545 PLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLA 1604
            PL+ +   EG +AT Q ELS+   T  W++GG+QL    +      G    LVL  L   
Sbjct: 3895 PLQSLQAEEGSTATLQCELSEPTATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQRE 3954

Query: 1605 DSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKD 1664
            D+G  + T  S   +A L V   PV  +R     EV EG TA   CELS+A A V W K 
Sbjct: 3955 DTGEYTCTCGSQATSATLTVTAAPVRFLRELQHQEVDEGGTAHLCCELSRAGASVEWRKG 4014

Query: 1665 GNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSE 1724
               L P  + ++   G    L +R     DAG Y+C  G  ++    L+VR       + 
Sbjct: 4015 SLQLFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCDTGHTQS-MASLSVRVPRPKFKTR 4073

Query: 1725 LRSVSAREGDGATFECTVSEVETTG--RWELGGRPLRPGARVRIRQEGKKHILVLSELRA 1782
            L+S+    GD A   C +S+ E+    +W   G  L  G +  +R +G    L++ +L A
Sbjct: 4074 LQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEA 4133

Query: 1783 EDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGG-HVCW 1841
            +D GE     G  ++ A L V    + + R    +  V           VSR+G   V W
Sbjct: 4134 KDTGEYACVTGGQKTAASLRVTEPEVTIVRGLV-DAEVTADEDVEFSCEVSRAGATGVQW 4192

Query: 1842 LREGAELCPGDKYEMR-SHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLV 1893
              +G  L   +  E+    G  H+L +  V PED GT     G  ++  +L V
Sbjct: 4193 CLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTV 4245



 Score =  450 bits (1158), Expect = e-126
 Identities = 501/1891 (26%), Positives = 762/1891 (40%), Gaps = 174/1891 (9%)

Query: 39   PPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC---RARNAAGEAYA 95
            P   V W KG  +L AS +     +G    L ++A    D+  Y C   +A++ A     
Sbjct: 2942 PAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKADSDTYTCDIGQAQSRAQLLVQ 3001

Query: 96   AAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLP 155
               V ++E      +L+  +                       V  G+     CR     
Sbjct: 3002 GRRVHIIE------DLEDVD-----------------------VQEGSSATFRCRISPAN 3032

Query: 156  EPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAH 215
               ++W  D   L         A +    +  PG    L +    L DSG     A    
Sbjct: 3033 YEPVHWFLDKTPLH--------ANELNEIDAQPGGYHVLTLRQLALKDSGTIYFEA---- 3080

Query: 216  GHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEP 275
            G  +A A L+V + P     +  +A                + EG+     C       P
Sbjct: 3081 GDQRASAALRVTEKPSVFSRELTDAT---------------ITEGEDLTLVCETSTCDIP 3125

Query: 276  EIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLH 335
             + W  +G+ L    R  +  +     +L +     +D G Y C A  +   ++  V++H
Sbjct: 3126 -VCWTKDGKTLRGSARCQLSHEGHRAQLL-ITGATLQDSGRYKCEAGGACSSSI--VRVH 3181

Query: 336  VKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVR 395
             +   +RF   L+D+E  E G A L C + +   P  W   +  L P  KY   +EG + 
Sbjct: 3182 ARP--VRFQEALKDLEVLEGGAATLRCVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAML 3239

Query: 396  RLIIHRLKADDDGIYLCEMRGRVRTVANVTV---KGPILKRLPRKLDVLEGENAVLLVET 452
             L++  L+  D G Y C   G   T A +TV       + +L R  +  EG  A L  E 
Sbjct: 3240 ELVVRNLRPQDSGRYSCSF-GDQTTSATLTVTALPAQFIGKL-RNKEATEGATATLRCEL 3297

Query: 453  LEAG-VEGRWS----RDGEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTL 507
             +A  VE R      RDG+     C    G M  L + G+   DA E +   G  RT+  
Sbjct: 3298 SKAAPVEWRKGSETLRDGDR---YCLRQDGAMCELQIRGLAMVDAAEYSCVCGEERTSAS 3354

Query: 508  LRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCF 567
            L ++ +     G     E  +G   T+       E +   P  +R  R+ +   D     
Sbjct: 3355 LTIRPMPAHFIGRLRHQESIEGATATLRC-----ELSKAAPVEWRKGRESLRDGD---RH 3406

Query: 568  SIEKAGAV---EVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLED 624
            S+ + GAV   ++ G  V   G+Y      V G  R+   +   +   +P A+   GL +
Sbjct: 3407 SLRQDGAVCELQICGLAVADAGEY----SCVCGEERTSATL---TVKALP-AKFTEGLRN 3458

Query: 625  VQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILH 684
             +  +G  A+   +LS +    W    E L+  +          RY + Q+G +  L + 
Sbjct: 3459 EEAVEGATAMLWCELSKVAPVEWRKGPENLRDGD----------RYILRQEGTRCELQIC 3508

Query: 685  AVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD 744
             +   D+G  +   C   + SA LTI+  P   +  +D  +         VL CEL+   
Sbjct: 3509 GLAMADAGEYL-CVCGQERTSATLTIRALPARFI--EDVKNQEAREGATAVLQCELNSA- 3564

Query: 745  FPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDP 804
             P  W K  + + + +   ++ DG K  L +    + D+GE+ C          +TV+  
Sbjct: 3565 APVEWRKGSETLRDGDRYSLRQDGTKCELQIRGLAMADTGEYSCVCGQERTSAMLTVRAL 3624

Query: 805  PVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRL 864
            P+   +   +    A      +L CE+ +  APV W+K  + + + D   L  +G    L
Sbjct: 3625 PIKFTEGLRN--EEATEGATAVLRCELSKM-APVEWWKGHETLRDGDRHSLRQDGARCEL 3681

Query: 865  VLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCR 924
             +      D GE+ C+ G E     +T+  + S  +   G     A   +   L CEL +
Sbjct: 3682 QIRGLVAEDAGEYLCMCGKERTSAMLTVRAMPSKFI--EGLRNEEATEGDTATLWCELSK 3739

Query: 925  PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVT 984
              A V W K  E + +     L+++ +   L +  + + D+GEY C    E  S T+TV 
Sbjct: 3740 A-APVEWRKGHETLRDGDRHSLRQDGSRCELQIRGLAVVDAGEYSCVCGQERTSATLTVR 3798

Query: 985  EPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRC 1044
              P R I   D     A      VL CELS+  APV W K    +   +   L +DG RC
Sbjct: 3799 ALPARFI--EDVKNQEAREGATAVLQCELSKA-APVEWRKGSETLRGGDRYSLRQDGTRC 3855

Query: 1045 RLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCE 1104
             L +      D GE+ C  G +    T+TV A P+ +     +SL    G+     L+CE
Sbjct: 3856 ELQIHGLSVADTGEYSCVCGQERTSATLTVRA-PQPVFREPLQSLQAEEGS--TATLQCE 3912

Query: 1105 VAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNV 1164
            ++   + V W K GL+++A+   +   +G T  L L   Q ED GEY C    +A +  +
Sbjct: 3913 LSEPTATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQREDTGEYTCTCGSQATSATL 3972

Query: 1165 ILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAE 1224
             +   PV+FL          V  G    L CELSRAGA V W      +      ++  +
Sbjct: 3973 TVTAAPVRFLRELQHQE---VDEGGTAHLCCELSRAGASVEWRKGSLQLFPCAKYQMVQD 4029

Query: 1225 GPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRS--- 1281
            G    L ++      AG YTC +G      SLS         VRV  P+  +TR++S   
Sbjct: 4030 GAAAELLVRGVEQEDAGDYTCDTGHTQSMASLS---------VRVPRPK-FKTRLQSLEQ 4079

Query: 1282 TPGGDLELVVHLSG--PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEY 1339
              G    L   LS    G  V+W K+G  L +  + ++   GA + L +    + D GEY
Sbjct: 4080 ETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEAKDTGEY 4139

Query: 1340 LCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA-DVTWLRNGAV 1398
             C          + V EP  V +V  L    V   +D  F CEVS   A  V W   G  
Sbjct: 4140 ACVTGGQKTAASLRVTEP-EVTIVRGLVDAEVTADEDVEFSCEVSRAGATGVQWCLQGLP 4198

Query: 1399 VTPGPQVEMA-QNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQD 1457
            +      E+A ++G    L L+G    DAGTV+   G+ A+SA+L VR  E+  L  LQD
Sbjct: 4199 LQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTVRAPEVTILEPLQD 4258

Query: 1458 VRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSM-AQDGHIHRLFIHGVILAD 1516
            V+  EGQD   +    R     A RW  GG PL  +    +  + G +H L +H V L D
Sbjct: 4259 VQLSEGQDASFQCRLSRASGQEA-RWALGGVPLQANEMNDITVEQGTLHLLTLHKVTLED 4317

Query: 1517 QGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGE-WARG 1575
             GT         + A+L V  +   V+R LE+V   EGG A F+ +LSQ  V    W   
Sbjct: 4318 AGTVSFHVGTCSSEAQLKVTAKN-TVVRGLENVEALEGGEALFECQLSQPEVAAHTWLLD 4376

Query: 1576 GVQLYPGPKCHI--HSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVR 1633
               ++      +    +G RH L+L  L   DS  V+F A  +  +A L VR   + I+ 
Sbjct: 4377 DEPVHTSENAEVVFFENGLRHLLLLKNLRPQDSCRVTFLAGDMVTSAFLTVRGWRLEILE 4436

Query: 1634 GPHDLEVTEGDTATFECELSQA--LADVTWEKDGNALTPSPR-LRLQALGTRRLLQLRRC 1690
               +  V  G  A F C LS+A  + + +W  +G A+ P      + A G+   L LR  
Sbjct: 4437 PLKNAAVRAGAQACFTCTLSEAVPVGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSA 4496

Query: 1691 GPSDAG--TYSC--AVGTARAGPVRL---------TVRERTVAVLSELRSVSAREGDGAT 1737
             P  AG  T++C  AV +AR   + L           R      LS    +S   G    
Sbjct: 4497 QPHHAGEVTFACRDAVASARLTVLGLPDPPEDAEVVARSSHTVTLSWAAPMSDGGGGLCG 4556

Query: 1738 FECTVSEVETTGRWELGGRPLRPGARVRI--RQEGKKHILVLSELRAEDAGEVRFQAGPA 1795
            +   V E   TG+W L    L PG    +     G+ +   ++ +    AGE        
Sbjct: 4557 YRVEVKE-GATGQWRL-CHELVPGPECVVDGLAPGETYRFRVAAVGPVGAGE---PVHLP 4611

Query: 1796 QSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYE 1855
            Q++ L E    P+      P  + V  G    LE+ V    G V W +    + PG ++E
Sbjct: 4612 QTVRLAE-PPKPVPPQPSAPESRQVAAGEDVSLELEVVAEAGEVIWHKGMERIQPGGRFE 4670

Query: 1856 MRSHGPTHSLVIHDVRPEDQGTYCCQAGQDS 1886
            + S G    LVI     EDQG Y C   Q S
Sbjct: 4671 VVSQGRQQMLVIKGFTAEDQGEYHCGLAQGS 4701



 Score =  427 bits (1098), Expect = e-119
 Identities = 442/1765 (25%), Positives = 696/1765 (39%), Gaps = 127/1765 (7%)

Query: 155  PEPTLYWEKDGMAL--DEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHAR 212
            PE  + W KDG+ L   + +D  H A   G           L +      D+G+Y CH  
Sbjct: 2673 PEAHVVWRKDGVQLGPSDKYDFLHTAGTRG-----------LVVHDVSPEDAGLYTCHV- 2720

Query: 213  NAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGK 272
               G  +  A ++VH           +    + + LK    T  V EG+   F C +  +
Sbjct: 2721 ---GSEETRARVRVH-----------DLHVGITKRLK----TMEVLEGESCSFECVLSHE 2762

Query: 273  PEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAV 332
               +      G   +    R     +   ++L V      D G  V + R       S  
Sbjct: 2763 SASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVFSVRGLT----SKA 2818

Query: 333  QLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEG 392
             L V+E      +PL+D          L C++  +  P  W ++ + +   +KY+ + EG
Sbjct: 2819 SLIVRERPAAIIKPLEDQWVAPGEDVELRCELSRAGTPVHWLKDRKAIRKSQKYDVVCEG 2878

Query: 393  TVRRLIIHRLKADDDGIYLCEMRGRVRTVA-NVTVKGPILKRLPRKLDVLEGENAVLLVE 451
            T+  L+I      D G Y CE+     T + +V  K          L V E   AV   +
Sbjct: 2879 TMAMLVIRGASLKDAGEYTCEVEASKSTASLHVEEKANCFTEELTNLQVEEKGTAVFTCK 2938

Query: 452  TLEAGVEGRWSRDGEELPVICQ---SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLL 508
            T        W +   EL    +   S  G    L +  + + D+   T  +G +++   L
Sbjct: 2939 TEHPAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKADSDTYTCDIGQAQSRAQL 2998

Query: 509  RVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAP------ETPFIYRLERQEVGSED 562
             V+  +          ++ +G   T      P    P      +TP ++  E  E+ ++ 
Sbjct: 2999 LVQGRRVHIIEDLEDVDVQEGSSATFRCRISPANYEPVHWFLDKTP-LHANELNEIDAQP 3057

Query: 563  WIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTAR---LV 619
                    +  A++  G      GD R                   SA L  T +     
Sbjct: 3058 GGYHVLTLRQLALKDSGTIYFEAGDQR------------------ASAALRVTEKPSVFS 3099

Query: 620  AGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQ 678
              L D  + +GED     + ST  I   W  +G+ L+          G+ R ++  +G +
Sbjct: 3100 RELTDATITEGEDLTLVCETSTCDIPVCWTKDGKTLR----------GSARCQLSHEGHR 3149

Query: 679  HRLILHAVKHQDSGALVGFSCP--GVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVL 736
             +L++     QDSG    + C   G   S+ + +   PV     +    L         L
Sbjct: 3150 AQLLITGATLQDSGR---YKCEAGGACSSSIVRVHARPVRF--QEALKDLEVLEGGAATL 3204

Query: 737  TCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF 796
             C LS V  P  W      +   +   ++ +G    L++   + QDSG + C     +  
Sbjct: 3205 RCVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAMLELVVRNLRPQDSGRYSCSFGDQTTS 3264

Query: 797  FGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLE 856
              +TV   P   +    +    A       L CE+ +  APV W K  + + + D   L 
Sbjct: 3265 ATLTVTALPAQFIGKLRNK--EATEGATATLRCELSKA-APVEWRKGSETLRDGDRYCLR 3321

Query: 857  NEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKV-YVAAVRLER 915
             +G    L +      D  E+ CV G+E    ++TI  + +  +   G++ +  ++    
Sbjct: 3322 QDGAMCELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFI---GRLRHQESIEGAT 3378

Query: 916  VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE 975
              L CEL +  A V W K  E + +     L+++  V  L +  + + D+GEY C   +E
Sbjct: 3379 ATLRCELSKA-APVEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSCVCGEE 3437

Query: 976  SASFTVTVTEPPVRIIYP-RDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEA 1034
              S T+TV   P +     R+E  +   T    +L CELS+  APV W K    + + + 
Sbjct: 3438 RTSATLTVKALPAKFTEGLRNEEAVEGAT---AMLWCELSKV-APVEWRKGPENLRDGDR 3493

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFG 1094
             +L ++G RC L +      D GE++C  G +    T+T+ A P R +    ++ +   G
Sbjct: 3494 YILRQEGTRCELQICGLAMADAGEYLCVCGQERTSATLTIRALPARFIEDV-KNQEAREG 3552

Query: 1095 APGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCE 1154
            A     L+CE+  A + V W K    +   D   L  +G    L +      D GEY C 
Sbjct: 3553 ATA--VLQCELNSA-APVEWRKGSETLRDGDRYSLRQDGTKCELQIRGLAMADTGEYSCV 3609

Query: 1155 TRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQ 1214
               E  +  + +   P++F              G   VL CELS+  APV W      ++
Sbjct: 3610 CGQERTSAMLTVRALPIKFTEGLRNEE---ATEGATAVLRCELSKM-APVEWWKGHETLR 3665

Query: 1215 EGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEA 1274
            +G+   L  +G R  L I+      AG Y C  G    +  L+    V   P + +    
Sbjct: 3666 DGDRHSLRQDGARCELQIRGLVAEDAGEYLCMCGKERTSAMLT----VRAMPSKFIE--- 3718

Query: 1275 AQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSG 1334
                  +T G    L   LS    PV W K  E L    R  L Q G+R  L+++G    
Sbjct: 3719 GLRNEEATEGDTATLWCELS-KAAPVEWRKGHETLRDGDRHSLRQDGSRCELQIRGLAVV 3777

Query: 1335 DAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLR 1394
            DAGEY C   Q+     ++V   L  + + ++      EG  A  +CE+S   A V W +
Sbjct: 3778 DAGEYSCVCGQERTSATLTVRA-LPARFIEDVKNQEAREGATAVLQCELSKA-APVEWRK 3835

Query: 1395 NGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRR 1454
                +  G +  + Q+G+   L + G  + D G  +   G   TSA L VR  + +F   
Sbjct: 3836 GSETLRGGDRYSLRQDGTRCELQIHGLSVADTGEYSCVCGQERTSATLTVRAPQPVFREP 3895

Query: 1455 LQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVIL 1514
            LQ ++AEEG    L+ E     A   V W +GG  L  + R      G    L +  +  
Sbjct: 3896 LQSLQAEEGSTATLQCELSEPTAT--VVWSKGGLQLQANGRREPRLQGCTAELVLQDLQR 3953

Query: 1515 ADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWAR 1574
             D G Y C      T A L+V    +R LR L+   + EGG+A    ELS+ G + EW +
Sbjct: 3954 EDTGEYTCTCGSQATSATLTVTAAPVRFLRELQHQEVDEGGTAHLCCELSRAGASVEWRK 4013

Query: 1575 GGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRG 1634
            G +QL+P  K  +  DG    L++ G+   D+G  +      +  A L VR         
Sbjct: 4014 GSLQLFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCDTGHTQSMASLSVRVPRPKFKTR 4073

Query: 1635 PHDLEVTEGDTATFECELSQAL--ADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGP 1692
               LE   GD A   C+LS A   A V W K+G  L   P+  +++ G  R L + +   
Sbjct: 4074 LQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLEA 4133

Query: 1693 SDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RW 1751
             D G Y+C  G  +     L V E  V ++  L        +   F C VS    TG +W
Sbjct: 4134 KDTGEYACVTGGQKTA-ASLRVTEPEVTIVRGLVDAEVTADEDVEFSCEVSRAGATGVQW 4192

Query: 1752 ELGGRPLRPGARVRIR-QEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQM 1810
             L G PL+      +  ++G+ H L L  +  EDAG V F  G   S A L V A P   
Sbjct: 4193 CLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTVRA-PEVT 4251

Query: 1811 CRHPPREKTVLVGRRAVLEVTVSRSGGHVC-WLREGAELCPGDKYEMR-SHGPTHSLVIH 1868
               P ++  +  G+ A  +  +SR+ G    W   G  L   +  ++    G  H L +H
Sbjct: 4252 ILEPLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLHLLTLH 4311

Query: 1869 DVRPEDQGTYCCQAGQDSTHTRLLV 1893
             V  ED GT     G  S+  +L V
Sbjct: 4312 KVTLEDAGTVSFHVGTCSSEAQLKV 4336



 Score =  404 bits (1039), Expect = e-112
 Identities = 472/1941 (24%), Positives = 733/1941 (37%), Gaps = 180/1941 (9%)

Query: 21   VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
            V+  +G  A L C V  +P   V W K G++L++S ++     G    L++      DAG
Sbjct: 1176 VQAEAGTTAMLSCEV-AQPQTEVTWYKDGKKLSSSSKVRMEVKGCTRRLVVQQVGKADAG 1234

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL 140
             Y C A    G    +  + + EP A   + Q     + +                    
Sbjct: 1235 EYSCEA----GGQRVSFQLHITEPKAVFAKEQLVHNEVRTEA------------------ 1272

Query: 141  RGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAAR 200
             GA   L+C      +  + W KDG  L     SS   ++        G    L +  A 
Sbjct: 1273 -GASATLSCEVAQA-QTEVTWYKDGKKLSS---SSKVRIEAA------GCMRQLVVQQAG 1321

Query: 201  LPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEG 260
              D+G Y C A         G  L  H     P A        V    + A +      G
Sbjct: 1322 QADAGEYTCEA--------GGQRLSFHLDVSEPKA--------VFAKEQLAHRKVQAEAG 1365

Query: 261  KHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCA 320
              A   C V  + + E+ W+ +G+ L    +  M        ++    CQA D G Y C 
Sbjct: 1366 AIATLSCEV-AQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQQACQA-DTGEYSCE 1423

Query: 321  ARNSAGQTLSAVQLHVKEPRLRFTRPL---QDVEGREHGIAVLECKVPNSRIPTAWFRED 377
            A    GQ LS   L V EP++ F +     ++V+ +      L C+V  ++    W+++ 
Sbjct: 1424 A---GGQRLS-FSLDVAEPKVVFAKEQPVHREVQAQAGASTTLSCEVAQAQTEVMWYKDG 1479

Query: 378  QRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGP---ILKRL 434
            ++L    K      G  RRL++ +      G Y CE  G  R   ++ V  P     K  
Sbjct: 1480 KKLSFSSKVRMEAVGCTRRLVVQQAGQAVAGEYSCEA-GSQRLSFHLHVAEPKAVFAKEQ 1538

Query: 435  P--RKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHALVLPGVTR 489
            P  R++    G +A L  E  +A  E  W +DG++L     +   + G    LV+    +
Sbjct: 1539 PASREVQAEAGTSATLSCEVAQAQTEVTWYKDGKKLSSSSKVRMEAVGCTRRLVVQEAGQ 1598

Query: 490  EDAGEVTFSLGNSRTTTLL-----RVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPA 544
             DAGE +   G+ R +  L     +V   K  P    + AE       +  L+ +  +  
Sbjct: 1599 ADAGEYSCKAGDQRLSFHLHVAEPKVVFAKEQPAHREVQAEAGA----SATLSCEVAQAQ 1654

Query: 545  PETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRS--P 602
             E  +    ++    S+  ++     +   V+  G      G+Y    C   G   S   
Sbjct: 1655 TEVTWYKDGKKLSSSSKVRVEAVGCTRRLVVQQAGQA--DAGEYS---CEAGGQRLSFRL 1709

Query: 603  HVVFHGSAHLVPT-ARLVAGLEDVQVYDGEDAVFSLDLSTIIQGT--WFLNGEELKSNEP 659
            HV     A L P  +      E + V + ED + +  L+T    T  W  +G E++ ++ 
Sbjct: 1710 HV-----AELEPQISERPCRREPLVVKEHEDIILTATLATPSAATVTWLKDGVEIRRSK- 1763

Query: 660  EGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILS 719
                     R+    +G  H L +H  +  DS     +SC    +     +Q   V    
Sbjct: 1764 ---------RHETASQGDTHTLTVHGAQVLDSAI---YSCRVGAEGQDFPVQVEEVAAKF 1811

Query: 720  PQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAK 779
             +    +       V L CELS       W     ++   +   +  +G    L +   +
Sbjct: 1812 CRLLEPVCGELGGTVTLACELSPACAEVVWRCGNTQLRVGKRFQMVAEGPVRSLTVLGLR 1871

Query: 780  VQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVR 839
             +D+GE+ C +        +TV  P V          V     E     C V   D  V 
Sbjct: 1872 AEDAGEYVCESRDDHTSAQLTVSVPRVVKFMSGLSTVVAEEGGEATF-QCVVSPSDVAVV 1930

Query: 840  WYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWI 899
            W++DG  ++ S+   +   G    L +      D G+    A    +   + + +    +
Sbjct: 1931 WFRDGALLQPSEKFAISQSGASHSLTISDLVLEDAGQITVEAEGASSSAALRVREAP--V 1988

Query: 900  VYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPA 959
            ++              V L  EL RPW E+RWT++   +     + +  E    RLVL  
Sbjct: 1989 LFKKKLEPQTVEERSSVTLEVELTRPWPELRWTRNATALAPGKNVEIHAEGARHRLVLHN 2048

Query: 960  VQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP 1019
            V   D G + CE  D+     +TV    VR++  R    + A       +  +LS  D  
Sbjct: 2049 VGFADRGFFGCETPDDKTQAKLTVEMRQVRLV--RGLQAVEAREQGTATMEVQLSHADVD 2106

Query: 1020 VRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPE 1079
              W +DGL  ++     L   GP   L L   +PED G  V  A        + VT  P 
Sbjct: 2107 GSWTRDGLRFQQGPTCHLAVRGPMHTLTLSGLRPEDSGLMVFKAEGVHTSARLVVTELPV 2166

Query: 1080 RIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLT 1139
                P     D+      +V L CE++     VRW KDG+E+ A   + + A+G  R+LT
Sbjct: 2167 SFSRPLQ---DVVTTEKEKVTLECELSRPNVDVRWLKDGVELRAGKTMAIAAQGACRSLT 2223

Query: 1140 LPHAQPEDAGEYVCETRHEA--------------ITFNVILAEPP--VQFLALETTPSPL 1183
            +   +  D G YVC+  H+A              + +  +LAE    +QF+A        
Sbjct: 2224 IYRCEFADQGVYVCDA-HDAQSSASVKVQGRTYTLIYRRVLAEDAGEIQFVAENAESRAQ 2282

Query: 1184 CVAPGEPV-----------------VLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGP 1226
                  PV                 VL C++SRA A V W    + +Q G   EL ++G 
Sbjct: 2283 LRVKELPVTLVRPLRDKIAMEKHRGVLECQVSRASAQVRWFKGSQELQPGPKYELVSDGL 2342

Query: 1227 RRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGD 1286
             R L I          YTC +G      S  F V+  E  + +V      T +   P   
Sbjct: 2343 YRKLIISDVHAEDEDTYTCDAGDVK--TSAQFFVE--EQSITIVRGLQDVTVMEPAPAW- 2397

Query: 1287 LELVVHLSGPG-GPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAG--EYLCDA 1343
                   S P   P +W      L + G V LEQ G    L ++   S   G   +    
Sbjct: 2398 --FECETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTGPVHFTVGK 2455

Query: 1344 PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGP 1403
             + S   +VS    + V L   L P T  E       C+  P    V W ++   ++P  
Sbjct: 2456 SRSSARLVVS---DIPVVLTRPLEPKTGRELQSVVLSCDFRPAPKAVQWYKDDTPLSPSE 2512

Query: 1404 QVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEG 1463
            + +M+  G    L +      DAG    +AGS  +S  + V   E+     LQD  A E 
Sbjct: 2513 KFKMSLEGQMAELRILRLMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQDAEATEE 2572

Query: 1464 QDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCE 1523
                   E         V W   G PL +DS   ++  G  H L +  +  AD G     
Sbjct: 2573 GWASFSCELSHEDEE--VEWSLNGMPLYNDSFHEISHKGRRHTLVLKSIQRADAGIVRAS 2630

Query: 1524 SHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGP 1583
            S    T ARL VR + +  L+ L+D++  E G+   Q E+S       W + GVQL P  
Sbjct: 2631 SLKVSTSARLEVRVKPVVFLKALDDLSAEERGTLALQCEVSDPEAHVVWRKDGVQLGPSD 2690

Query: 1584 KCH-IHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTE 1642
            K   +H+ G R  LV++ +   D+G  +    S    AR+ V ++ V I +    +EV E
Sbjct: 2691 KYDFLHTAGTRG-LVVHDVSPEDAGLYTCHVGSEETRARVRVHDLHVGITKRLKTMEVLE 2749

Query: 1643 GDTATFECELSQALAD--VTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAG--TY 1698
            G++ +FEC LS   A     W   G  +  S R +    G + +L +R   PSDAG   +
Sbjct: 2750 GESCSFECVLSHESASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAAPSDAGEVVF 2809

Query: 1699 SCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPL 1758
            S    T++A    L VRER  A++  L       G+     C +S   T   W    + +
Sbjct: 2810 SVRGLTSKAS---LIVRERPAAIIKPLEDQWVAPGEDVELRCELSRAGTPVHWLKDRKAI 2866

Query: 1759 RPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVE----ALPLQMCRHP 1814
            R   +  +  EG   +LV+     +DAGE   +   ++S A L VE        ++    
Sbjct: 2867 RKSQKYDVVCEGTMAMLVIRGASLKDAGEYTCEVEASKSTASLHVEEKANCFTEELTNLQ 2926

Query: 1815 PREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPED 1874
              EK       AV           V W +   EL    K++    G T  L I  +   D
Sbjct: 2927 VEEKGT-----AVFTCKTEHPAATVTWRKGLLELRASGKHQPSQEGLTLRLTISALEKAD 2981

Query: 1875 QGTYCCQAGQDSTHTRLLVEG 1895
              TY C  GQ  +  +LLV+G
Sbjct: 2982 SDTYTCDIGQAQSRAQLLVQG 3002



 Score =  387 bits (993), Expect = e-107
 Identities = 356/1325 (26%), Positives = 530/1325 (40%), Gaps = 69/1325 (5%)

Query: 607  HGSAHLVPTARLVA---GLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQ 662
            H SA LV T   V+    L+DV   + E      +LS   +   W  +G EL++ +    
Sbjct: 2154 HTSARLVVTELPVSFSRPLQDVVTTEKEKVTLECELSRPNVDVRWLKDGVELRAGKTMAI 2213

Query: 663  VEPGALR----YRIE---------------------QKGLQHRLILHAVKHQDSGALVGF 697
               GA R    YR E                      +G  + LI   V  +D+G  + F
Sbjct: 2214 AAQGACRSLTIYRCEFADQGVYVCDAHDAQSSASVKVQGRTYTLIYRRVLAEDAGE-IQF 2272

Query: 698  SCPGVQDSAALTIQESPVHILSP-QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKV 756
                 +  A L ++E PV ++ P +D++++      R VL C++SR      W+K  Q++
Sbjct: 2273 VAENAESRAQLRVKELPVTLVRPLRDKIAME---KHRGVLECQVSRASAQVRWFKGSQEL 2329

Query: 757  EESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVF 816
            +      +  DG   +LI+ +   +D   + C    V       V++  + IV   + V 
Sbjct: 2330 QPGPKYELVSDGLYRKLIISDVHAEDEDTYTCDAGDVKTSAQFFVEEQSITIVRGLQDVT 2389

Query: 817  VHAITSECVMLACEVDREDA-PVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGG 875
            V  +        CE       P +W      ++    V LE EG   RL+L  T  +  G
Sbjct: 2390 V--MEPAPAWFECETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTG 2447

Query: 876  EFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDG 935
                  G   +   + ++D+   +  P          L+ VVL+C+       V+W KD 
Sbjct: 2448 PVHFTVGKSRSSARLVVSDIPVVLTRPLEPK--TGRELQSVVLSCDFRPAPKAVQWYKDD 2505

Query: 936  EEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRD 995
              +  S    +  E  +  L +  +   D+G Y C+     +S  VTV    V +  P  
Sbjct: 2506 TPLSPSEKFKMSLEGQMAELRILRLMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQ 2565

Query: 996  EVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPED 1055
            +    A         CELS ED  V W  +G+ +       +   G R  LVL + Q  D
Sbjct: 2566 DAE--ATEEGWASFSCELSHEDEEVEWSLNGMPLYNDSFHEISHKGRRHTLVLKSIQRAD 2623

Query: 1056 GGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWY 1115
             G     +   S    + V   P  +V   A   DL     G + L+CEV+   + V W 
Sbjct: 2624 AGIVRASSLKVSTSARLEVRVKP--VVFLKALD-DLSAEERGTLALQCEVSDPEAHVVWR 2680

Query: 1116 KDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLA 1175
            KDG+++  SD         TR L +    PEDAG Y C    E     V + +  V    
Sbjct: 2681 KDGVQLGPSDKYDFLHTAGTRGLVVHDVSPEDAGLYTCHVGSEETRARVRVHDLHVGITK 2740

Query: 1176 LETTPSPLCVAPGEPVVLSCELSRAGA--PVVWSHNGRPVQEGEGLELHAEGPRRVLCIQ 1233
               T     V  GE     C LS   A  P +W+  G+ V      +   +G + +L ++
Sbjct: 2741 RLKTME---VLEGESCSFECVLSHESASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVR 2797

Query: 1234 AAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHL 1293
             A P+ AG             SL     V E P  ++ P   Q      PG D+EL   L
Sbjct: 2798 EAAPSDAGEVVFSVRGLTSKASLI----VRERPAAIIKPLEDQW---VAPGEDVELRCEL 2850

Query: 1294 SGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVS 1353
            S  G PV W KD + +    +  +   G   +L ++GA   DAGEY C+         + 
Sbjct: 2851 SRAGTPVHWLKDRKAIRKSQKYDVVCEGTMAMLVIRGASLKDAGEYTCEVEASKSTASLH 2910

Query: 1354 VEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSS 1413
            VEE        ELT L V E   A F C+   P A VTW +    +    + + +Q G +
Sbjct: 2911 VEEKANC-FTEELTNLQVEEKGTAVFTCKTEHPAATVTWRKGLLELRASGKHQPSQEGLT 2969

Query: 1414 RILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETG 1473
              LT+   +  D+ T T   G   + A+L V+   +  +  L+DV  +EG          
Sbjct: 2970 LRLTISALEKADSDTYTCDIGQAQSRAQLLVQGRRVHIIEDLEDVDVQEGSSATFRC--- 3026

Query: 1474 RVGAAG--AVRWVRGGQPLPHDSRLSM--AQDGHIHRLFIHGVILADQGTYGCESHHDRT 1529
            R+  A    V W     PL H + L+   AQ G  H L +  + L D GT   E+   R 
Sbjct: 3027 RISPANYEPVHWFLDKTPL-HANELNEIDAQPGGYHVLTLRQLALKDSGTIYFEAGDQRA 3085

Query: 1530 LARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHS 1589
             A L V  +     R L D TI+EG   T   E S   +   W + G  L    +C +  
Sbjct: 3086 SAALRVTEKPSVFSRELTDATITEGEDLTLVCETSTCDIPVCWTKDGKTLRGSARCQLSH 3145

Query: 1590 DGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFE 1649
            +GHR +L++ G  L DSG     A     ++ + V   PV       DLEV EG  AT  
Sbjct: 3146 EGHRAQLLITGATLQDSGRYKCEAGGACSSSIVRVHARPVRFQEALKDLEVLEGGAATLR 3205

Query: 1650 CELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGP 1709
            C LS   A V W    N L P  +  L+  G    L +R   P D+G YSC+ G      
Sbjct: 3206 CVLSSVAAPVKWCYGNNVLRPGDKYSLRQEGAMLELVVRNLRPQDSGRYSCSFGDQTTSA 3265

Query: 1710 VRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQE 1769
              LTV       + +LR+  A EG  AT  C +S+      W  G   LR G R  +RQ+
Sbjct: 3266 T-LTVTALPAQFIGKLRNKEATEGATATLRCELSKAAPV-EWRKGSETLRDGDRYCLRQD 3323

Query: 1770 GKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLE 1829
            G    L +  L   DA E     G  ++ A L +  +P         ++++  G  A L 
Sbjct: 3324 GAMCELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFIGRLRHQESI-EGATATLR 3382

Query: 1830 VTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHT 1889
              +S++   V W +    L  GD++ +R  G    L I  +   D G Y C  G++ T  
Sbjct: 3383 CELSKAAP-VEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSCVCGEERTSA 3441

Query: 1890 RLLVE 1894
             L V+
Sbjct: 3442 TLTVK 3446



 Score =  359 bits (922), Expect = 1e-98
 Identities = 442/1753 (25%), Positives = 688/1753 (39%), Gaps = 189/1753 (10%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            P  F R      +  G +  L C       PV  W K G+ L  S R     +G    LL
Sbjct: 3095 PSVFSRELTDATITEGEDLTLVCETSTCDIPVC-WTKDGKTLRGSARCQLSHEGHRAQLL 3153

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            +T A   D+G Y C       EA  A + +++   A     Q A + L            
Sbjct: 3154 ITGATLQDSGRYKC-------EAGGACSSSIVRVHARPVRFQEALKDLE----------- 3195

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED--GP 188
                    VL G    L C    +  P              W   +  L+PG        
Sbjct: 3196 --------VLEGGAATLRCVLSSVAAPVK------------WCYGNNVLRPGDKYSLRQE 3235

Query: 189  GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
            GA L L +   R  DSG Y C    + G     A L V              PA  +  L
Sbjct: 3236 GAMLELVVRNLRPQDSGRYSC----SFGDQTTSATLTV-----------TALPAQFIGKL 3280

Query: 249  KCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLY 308
            +    T    EG  A  RC  + K  P +EW  +G   L D  R   R +DG        
Sbjct: 3281 RNKEAT----EGATATLRCE-LSKAAP-VEWR-KGSETLRDGDRYCLR-QDGAM------ 3326

Query: 309  CQAKDRGL-YVCAARNSA--GQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVP 365
            C+ + RGL  V AA  S   G+  ++  L ++     F   L+  E  E   A L C++ 
Sbjct: 3327 CELQIRGLAMVDAAEYSCVCGEERTSASLTIRPMPAHFIGRLRHQESIEGATATLRCELS 3386

Query: 366  NSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVT 425
             +  P  W +  + L    ++   ++G V  L I  L   D G Y C + G  RT A +T
Sbjct: 3387 KAA-PVEWRKGRESLRDGDRHSLRQDGAVCELQICGLAVADAGEYSC-VCGEERTSATLT 3444

Query: 426  VKGPILKRLP--RKLDVLEGENAVLLVETLE-AGVEGRWS----RDGEELPVICQSSSGH 478
            VK    K     R  + +EG  A+L  E  + A VE R      RDG+   +      G 
Sbjct: 3445 VKALPAKFTEGLRNEEAVEGATAMLWCELSKVAPVEWRKGPENLRDGDRYIL---RQEGT 3501

Query: 479  MHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKN----TV 534
               L + G+   DAGE     G  RT+  L ++ +      P    E  K  +     T 
Sbjct: 3502 RCELQICGLAMADAGEYLCVCGQERTSATLTIRAL------PARFIEDVKNQEAREGATA 3555

Query: 535  LLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGA---VEVPGDCVPSEGDYRFR 591
            +L  +    AP     +R   + +   D    +S+ + G    +++ G  +   G+Y   
Sbjct: 3556 VLQCELNSAAPVE---WRKGSETLRDGDR---YSLRQDGTKCELQIRGLAMADTGEYS-- 3607

Query: 592  ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
               V G  R+  ++   +   +P  +   GL + +  +G  AV   +LS +    W+   
Sbjct: 3608 --CVCGQERTSAML---TVRALPI-KFTEGLRNEEATEGATAVLRCELSKMAPVEWWKGH 3661

Query: 652  EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQ 711
            E L+  +          R+ + Q G +  L +  +  +D+G  +   C   + SA LT++
Sbjct: 3662 ETLRDGD----------RHSLRQDGARCELQIRGLVAEDAGEYLCM-CGKERTSAMLTVR 3710

Query: 712  ESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKH 771
              P   +        T    +   L CELS+   P  W K  + + + +   ++ DG + 
Sbjct: 3711 AMPSKFIEGLRNEEAT--EGDTATLWCELSKAA-PVEWRKGHETLRDGDRHSLRQDGSRC 3767

Query: 772  RLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEV 831
             L +    V D+GE+ C          +TV+  P   ++  ++    A      +L CE+
Sbjct: 3768 ELQIRGLAVVDAGEYSCVCGQERTSATLTVRALPARFIEDVKNQ--EAREGATAVLQCEL 3825

Query: 832  DREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVT 891
             +  APV W K  + +   D   L  +G    L +     +D GE+ CV G E    T+T
Sbjct: 3826 SKA-APVEWRKGSETLRGGDRYSLRQDGTRCELQIHGLSVADTGEYSCVCGQERTSATLT 3884

Query: 892  ITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDT 951
            +       V+      + A       L CEL  P A V W+K G ++  +     + +  
Sbjct: 3885 VRAPQP--VFREPLQSLQAEEGSTATLQCELSEPTATVVWSKGGLQLQANGRREPRLQGC 3942

Query: 952  VRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRII--YPRDEVTLIAVTLECVVL 1009
               LVL  +Q ED+GEY C    ++ S T+TVT  PVR +      EV        C   
Sbjct: 3943 TAELVLQDLQREDTGEYTCTCGSQATSATLTVTAAPVRFLRELQHQEVDEGGTAHLC--- 3999

Query: 1010 MCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAF 1069
             CELSR  A V W K  L++       + +DG    L++   + ED G++ CD G   + 
Sbjct: 4000 -CELSRAGASVEWRKGSLQLFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCDTGHTQSM 4058

Query: 1070 FTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQL 1129
             +++V  P  +      +SL+   G   R+  +   A +G+ V+W K+G+E+ A    ++
Sbjct: 4059 ASLSVRVPRPKF-KTRLQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEM 4117

Query: 1130 GAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGE 1189
             ++G TR L +   + +D GEY C T  +    ++ + EP V  +          V   E
Sbjct: 4118 RSQGATRELLIHQLEAKDTGEYACVTGGQKTAASLRVTEPEVTIVRGLVDAE---VTADE 4174

Query: 1190 PVVLSCELSRAGAP-VVWSHNGRPVQEGEGLELHA-EGPRRVLCIQAAGPAHAGLYTCQS 1247
             V  SCE+SRAGA  V W   G P+Q  E  E+   +G    L ++   P  AG  +   
Sbjct: 4175 DVEFSCEVSRAGATGVQWCLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHL 4234

Query: 1248 GAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGP-VRWYKDG 1306
            G    +  L+    V  P V ++ P      V+ + G D      LS   G   RW   G
Sbjct: 4235 GNHASSAQLT----VRAPEVTILEP---LQDVQLSEGQDASFQCRLSRASGQEARWALGG 4287

Query: 1307 ERLASQ--GRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVK--- 1361
              L +     + +EQ G   +L +      DAG           +   S E  L V    
Sbjct: 4288 VPLQANEMNDITVEQ-GTLHLLTLHKVTLEDAGTV------SFHVGTCSSEAQLKVTAKN 4340

Query: 1362 -LVSELTPLTVHEGDDATFRCEVSPPD-ADVTWLRNGAVVTPGPQVEMA--QNGSSRILT 1417
             +V  L  +   EG +A F C++S P+ A  TWL +   V      E+   +NG   +L 
Sbjct: 4341 TVVRGLENVEALEGGEALFECQLSQPEVAAHTWLLDDEPVHTSENAEVVFFENGLRHLLL 4400

Query: 1418 LRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGA 1477
            L+  +  D+  VT  AG   TSA L VR   L  L  L++     G   C          
Sbjct: 4401 LKNLRPQDSCRVTFLAGDMVTSAFLTVRGWRLEILEPLKNAAVRAGAQACFTCTLSEAVP 4460

Query: 1478 AGAVRW-VRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQG--TYGCE---SHHDRTLA 1531
             G   W + G    P DS  ++  DG  H L +        G  T+ C    +    T+ 
Sbjct: 4461 VGEASWYINGAAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVASARLTVL 4520

Query: 1532 RLSVRPRQLRVL-RPLEDVTIS--------EGGSATFQLELSQEGVTGEWARGGVQLYPG 1582
             L   P    V+ R    VT+S         GG   +++E+ +EG TG+W R   +L PG
Sbjct: 4521 GLPDPPEDAEVVARSSHTVTLSWAAPMSDGGGGLCGYRVEV-KEGATGQW-RLCHELVPG 4578

Query: 1583 PKCHIH--SDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEV 1640
            P+C +   + G  +R  +  +G   +G       ++R A     + VP      P   +V
Sbjct: 4579 PECVVDGLAPGETYRFRVAAVGPVGAGEPVHLPQTVRLAEP--PKPVPPQ-PSAPESRQV 4635

Query: 1641 TEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC 1700
              G+  + E E+     +V W K    + P  R  + + G +++L ++     D G Y C
Sbjct: 4636 AAGEDVSLELEVVAEAGEVIWHKGMERIQPGGRFEVVSQGRQQMLVIKGFTAEDQGEYHC 4695

Query: 1701 AVGTARAGPVRLT 1713
             +      P   T
Sbjct: 4696 GLAQGSICPAAAT 4708



 Score =  288 bits (737), Expect = 3e-77
 Identities = 467/1975 (23%), Positives = 741/1975 (37%), Gaps = 263/1975 (13%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            P  F    + + V+ G  A L+CV+     PV  W  G   L   ++ S   +GA   L+
Sbjct: 3184 PVRFQEALKDLEVLEGGAATLRCVLSSVAAPVK-WCYGNNVLRPGDKYSLRQEGAMLELV 3242

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            +    P D+G Y C    + G+   +A +TV   PA                       F
Sbjct: 3243 VRNLRPQDSGRYSC----SFGDQTTSATLTVTALPAQ----------------------F 3276

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGA 190
            +   R++    GA   L C         + W K    L    D   + L+    +DG   
Sbjct: 3277 IGKLRNKEATEGATATLRCELS--KAAPVEWRKGSETLR---DGDRYCLR----QDGAMC 3327

Query: 191  SLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKC 250
             L +R LA  + D+  Y C      G  +  A L +              PA  +  L+ 
Sbjct: 3328 ELQIRGLA--MVDAAEYSCVC----GEERTSASLTIRP-----------MPAHFIGRLRH 3370

Query: 251  APKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQ 310
                    EG  A  RC  + K  P +EW  +GR  L D  R   R       L++    
Sbjct: 3371 QESI----EGATATLRCE-LSKAAP-VEWR-KGRESLRDGDRHSLRQDGAVCELQICGLA 3423

Query: 311  AKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP 370
              D G Y C      G+  ++  L VK    +FT  L++ E  E   A+L C++ +   P
Sbjct: 3424 VADAGEYSCVC----GEERTSATLTVKALPAKFTEGLRNEEAVEGATAMLWCEL-SKVAP 3478

Query: 371  TAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPI 430
              W +  + L    +Y   +EGT   L I  L   D G YLC + G+ RT A +T++   
Sbjct: 3479 VEWRKGPENLRDGDRYILRQEGTRCELQICGLAMADAGEYLC-VCGQERTSATLTIRALP 3537

Query: 431  LKRLP--RKLDVLEGENAVLLVETLEAG-VEGRWS----RDGEELPVICQSSSGHMHALV 483
             + +   +  +  EG  AVL  E   A  VE R      RDG+   +      G    L 
Sbjct: 3538 ARFIEDVKNQEAREGATAVLQCELNSAAPVEWRKGSETLRDGDRYSL---RQDGTKCELQ 3594

Query: 484  LPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEP 543
            + G+   D GE +   G  RT+ +L V+ +       PI  +  +G +N         E 
Sbjct: 3595 IRGLAMADTGEYSCVCGQERTSAMLTVRAL-------PI--KFTEGLRNE--------EA 3637

Query: 544  APETPFIYRLERQEVGSEDWIQCF---------SIEKAGA---VEVPGDCVPSEGDYRFR 591
                  + R E  ++   +W +           S+ + GA   +++ G      G+Y   
Sbjct: 3638 TEGATAVLRCELSKMAPVEWWKGHETLRDGDRHSLRQDGARCELQIRGLVAEDAGEY--- 3694

Query: 592  ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
            +C + G  R+  ++   +   +P+ + + GL + +  +G+ A    +LS      W    
Sbjct: 3695 LC-MCGKERTSAML---TVRAMPS-KFIEGLRNEEATEGDTATLWCELSKAAPVEWRKGH 3749

Query: 652  EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD--SAALT 709
            E L+  +          R+ + Q G +  L +  +   D+G    +SC   Q+  SA LT
Sbjct: 3750 ETLRDGD----------RHSLRQDGSRCELQIRGLAVVDAGE---YSCVCGQERTSATLT 3796

Query: 710  IQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGR 769
            ++  P   +  +D  +         VL CELS+   P  W K  + +   +   ++ DG 
Sbjct: 3797 VRALPARFI--EDVKNQEAREGATAVLQCELSKAA-PVEWRKGSETLRGGDRYSLRQDGT 3853

Query: 770  KHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLAC 829
            +  L +    V D+GE+ C          +TV+ P     +P + +   A       L C
Sbjct: 3854 RCELQIHGLSVADTGEYSCVCGQERTSATLTVRAPQPVFREPLQSL--QAEEGSTATLQC 3911

Query: 830  EVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFT 889
            E+    A V W K G +++ +       +G    LVL   Q  D GE+ C  G +    T
Sbjct: 3912 ELSEPTATVVWSKGGLQLQANGRREPRLQGCTAELVLQDLQREDTGEYTCTCGSQATSAT 3971

Query: 890  VTITDVSSWIVYPSGKVYVAAVRLERVV------------LTCELCRPWAEVRWTKDGEE 937
            +T+T               A VR  R +            L CEL R  A V W K   +
Sbjct: 3972 LTVT--------------AAPVRFLRELQHQEVDEGGTAHLCCELSRAGASVEWRKGSLQ 4017

Query: 938  VVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEV 997
            +       + ++     L++  V+ ED+G+Y C+        T ++    VR+  P+ + 
Sbjct: 4018 LFPCAKYQMVQDGAAAELLVRGVEQEDAGDYTCD-----TGHTQSMASLSVRVPRPKFKT 4072

Query: 998  TLIAV---TLECVVLMCELSRED--APVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQ 1052
             L ++   T +   L C+LS  +  A V+W K+G+E+       +   G    L++   +
Sbjct: 4073 RLQSLEQETGDIARLCCQLSDAESGAVVQWLKEGVELHAGPKYEMRSQGATRELLIHQLE 4132

Query: 1053 PEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQ- 1111
             +D GE+ C  G      ++ VT P   IV      +D    A   VE  CEV+ AG+  
Sbjct: 4133 AKDTGEYACVTGGQKTAASLRVTEPEVTIVRGL---VDAEVTADEDVEFSCEVSRAGATG 4189

Query: 1112 VRWYKDGLEVEASDALQLGA-EGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPP 1170
            V+W   GL +++++  ++   +G   TL L    PEDAG       + A +  + +  P 
Sbjct: 4190 VQWCLQGLPLQSNEVTEVAVRDGRIHTLRLKGVTPEDAGTVSFHLGNHASSAQLTVRAPE 4249

Query: 1171 VQFLALETTPSPLCVAPGEPVVLSCELSRA-GAPVVWSHNGRPVQEGEGLELHAE-GPRR 1228
            V  L        + ++ G+     C LSRA G    W+  G P+Q  E  ++  E G   
Sbjct: 4250 VTILE---PLQDVQLSEGQDASFQCRLSRASGQEARWALGGVPLQANEMNDITVEQGTLH 4306

Query: 1229 VLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLE 1288
            +L +       AG  +   G       L  T +     VR +        V +  GG+  
Sbjct: 4307 LLTLHKVTLEDAGTVSFHVGTCSSEAQLKVTAK--NTVVRGLE------NVEALEGGEAL 4358

Query: 1289 LVVHLSGPGGPVR-WYKDGERL--ASQGRVQLEQAGARQVLRVQGARSGD-------AGE 1338
                LS P      W  D E +  +    V   + G R +L ++  R  D       AG+
Sbjct: 4359 FECQLSQPEVAAHTWLLDDEPVHTSENAEVVFFENGLRHLLLLKNLRPQDSCRVTFLAGD 4418

Query: 1339 YLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSP--PDADVTWLRNG 1396
             +  A    R + + + EPL            V  G  A F C +S   P  + +W  NG
Sbjct: 4419 MVTSAFLTVRGWRLEILEPL--------KNAAVRAGAQACFTCTLSEAVPVGEASWYING 4470

Query: 1397 AVVTPGPQV-EMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVR------ETEL 1449
            A V P      +  +GS   L LR  Q   AG VT        SARL V       E   
Sbjct: 4471 AAVQPDDSDWTVTADGSHHALLLRSAQPHHAGEVTFACRDAVASARLTVLGLPDPPEDAE 4530

Query: 1450 LFLRRLQDVR-------AEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDG 1502
            +  R    V        ++ G  +C      + GA G  R      P P      +A  G
Sbjct: 4531 VVARSSHTVTLSWAAPMSDGGGGLCGYRVEVKEGATGQWRLCHELVPGPECVVDGLAP-G 4589

Query: 1503 HIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPL-EDVTISEGGSATFQL 1561
              +R  +  V     G    E  H     RL+  P+ +       E   ++ G   + +L
Sbjct: 4590 ETYRFRVAAVGPVGAG----EPVHLPQTVRLAEPPKPVPPQPSAPESRQVAAGEDVSLEL 4645

Query: 1562 ELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSG---CVSFTADSLRC 1618
            E+  E     W +G  ++ PG +  + S G +  LV+ G    D G   C          
Sbjct: 4646 EVVAEAGEVIWHKGMERIQPGGRFEVVSQGRQQMLVIKGFTAEDQGEYHCGLAQGSICPA 4705

Query: 1619 AARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQA 1678
            AA   V   P ++   P      E         L +ALA          L     L  + 
Sbjct: 4706 AATFQVALSPASVDEAPQPSLPPEAAQEGDLHLLWEALARKRRMSREPTLDSISELPEED 4765

Query: 1679 LGTRRLLQ-LRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGAT 1737
              ++RL Q      P  +  YS A   AR G              ++L   S+ +   A 
Sbjct: 4766 GRSQRLPQEAEEVAPDLSEGYSTADELARTGD-------------ADLSHTSSDDESRAG 4812

Query: 1738 FECTVSEVETTGRWELG------GRPLRPGARVRIRQEGKKHILV-LSELRAEDAGE--- 1787
                V+ ++  GR          G P  P  + + +QE    +   L +L  +D G+   
Sbjct: 4813 TPSLVTYLKKAGRPGTSPLASKVGAPAAPSVKPQQQQEPLAAVRPPLGDLSTKDLGDPSM 4872

Query: 1788 ----VRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLE-VTVSRSGGHVCWL 1842
                V+ QA         E++     M  H   +    VG    LE V  S++     WL
Sbjct: 4873 DKAAVKIQAAFKGYKVRKEMKQQEGPMFSHTFGDTEAQVGDALRLECVVASKADVRARWL 4932

Query: 1843 REGAELCPGDKYEMRSHGP-THSLVIHDVRPEDQGTYCCQAGQ---DSTHTRLLV 1893
            ++G EL  G  + +   G  T SL+I  +   D G Y CQ        TH+  +V
Sbjct: 4933 KDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCYTCQVSNKFGQVTHSACVV 4987



 Score =  178 bits (452), Expect = 4e-44
 Identities = 204/796 (25%), Positives = 316/796 (39%), Gaps = 94/796 (11%)

Query: 1178 TTPSPLCVAPGEPVVLSCELSRAGAPVV-WSHNGRPVQEGEGLELHAEGPRRVLCIQAAG 1236
            T P    V+ G+   LSC++     P V W  + +PV  G    L  +G    L I    
Sbjct: 14   TRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQDGDLYRLTILDLA 73

Query: 1237 PAHAGLYTCQSGAAPGAPSLSFTVQV-AEPPVRVVAPE--AAQTRVRSTPGGDLELVVHL 1293
               +G Y C++  A G    +  +QV AE      AP      T +R   G +      +
Sbjct: 74   LGDSGQYVCRARNAIGEAFAAVGLQVDAEAACAEQAPHFLLRPTSIRVREGSEATFRCRV 133

Query: 1294 SGPGGP-VRWYKDGERLASQG--RVQLEQAGARQVLRVQGARSGDAGEYLCDA------- 1343
             G   P V W KDG RL      RV++E+ G    LR++ AR  D G Y   A       
Sbjct: 134  GGSPRPAVSWSKDGRRLGEPDGPRVRVEELGEASALRIRAARPRDGGTYEVRAENPLGAA 193

Query: 1344 ------------------PQDSRIFLVSVEEPLLVKLVSELTPL----------TVHEGD 1375
                              P  S   L++  +     + +E  P           TV EG 
Sbjct: 194  SAAAALVVDSDAADTASRPGTSTAALLAHLQRRREAMRAEGAPASPPSTGTRTCTVTEGK 253

Query: 1376 DATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSR-ILTLRGCQLGDAGTVTLRA 1433
             A   C V+  P  +  W ++G +VT G +  + ++     +L +  C+  D G  T  A
Sbjct: 254  HARLSCYVTGEPKPETVWKKDGQLVTEGRRHVVYEDAQENFVLKILFCKQSDRGLYTCTA 313

Query: 1434 ----GSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQP 1489
                G T +S  + VRE  + F +RLQD+   E +      E  +     A  W +    
Sbjct: 314  SNLVGQTYSSVLVVVREPAVPFKKRLQDLEVREKESATFLCEVPQPSTEAA--WFKEETR 371

Query: 1490 LPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH-DRTLARLSVRPRQLRVLRPLED 1548
            L   ++  + ++G   RL +  V   D   Y CE+    RT+A L+V+   LR L     
Sbjct: 372  LWASAKYGIEEEGTERRLTVRNVSADDDAVYICETPEGSRTVAELAVQGNLLRKLPRKTA 431

Query: 1549 VTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGC 1608
            V +  G +A F +EL+       W R   ++  G +  I ++G RH L ++   L D G 
Sbjct: 432  VRV--GDTAMFCVELAVPVGPVHWLRNQEEVVAGGRVAISAEGTRHTLTISQCCLEDVGQ 489

Query: 1609 VSFTADSLRCAARLIV---REVPVT-----IVRG-------------PHDLEVTEGDTAT 1647
            V+F A   + + +  V   R+ P+      +V+              PH       D   
Sbjct: 490  VAFMAGDCQTSTQFCVSAPRKPPLQPPVDPVVKARMESSVILSWSPPPHGERPVTIDGYL 549

Query: 1648 FECELSQALADVTWEKDGNA-LTPSPRLRLQALGTRRLLQLRRCGPSDAGT--YSCAVGT 1704
             E    + L   TW +   A    +P L +  +      Q R    +  G   Y    GT
Sbjct: 550  VE---KKKLGTYTWIRCHEAEWVATPELTVADVAEEGNFQFRVSALNSFGQSPYLEFPGT 606

Query: 1705 ARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARV 1764
                P         +AV + L++V A EG   TF   ++ V + G W L G+ L+  +  
Sbjct: 607  VHLAP--------KLAVRTPLKAVQAVEGGEVTFSVDLT-VASAGEWFLDGQALKASSVY 657

Query: 1765 RIRQEGKKHILVLSELRAEDAG-EVRFQAGPAQSLALLEVEALPLQMCRHPP----REKT 1819
             I  +  +H L + E+ A   G +++F A   +S   +EV A P      PP    RE  
Sbjct: 658  EIHCDRTRHTLTIREVPASLHGAQLKFVANGIESSIRMEVRAAPGLTANKPPAAAAREVL 717

Query: 1820 VLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYC 1879
              +   A L   +S     V WL++G  L PG KYE+++      L++ DV  +D G Y 
Sbjct: 718  ARLHEEAQLLAELSDQAAAVTWLKDGRTLSPGPKYEVQASAGRRVLLVRDVARDDAGLYE 777

Query: 1880 CQAGQDSTHTRLLVEG 1895
            C +       +L V+G
Sbjct: 778  CVSRGGRIAYQLSVQG 793



 Score =  115 bits (287), Expect = 5e-25
 Identities = 114/388 (29%), Positives = 155/388 (39%), Gaps = 68/388 (17%)

Query: 126 GAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAE 185
           GAP FLT P++  V  G +  L+C+  G P P + WEKD      V   + F L    A+
Sbjct: 8   GAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKD---QQPVAAGARFRL----AQ 60

Query: 186 DGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVV 245
           DG      L IL   L DSG YVC ARNA G A A   LQV         D + A A   
Sbjct: 61  DGD--LYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLQV---------DAEAACAEQA 109

Query: 246 EPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVL 304
                 P +  V EG  A FRC V G P P + W  +GR L  PD  R+   +      L
Sbjct: 110 PHFLLRPTSIRVREGSEATFRCRVGGSPRPAVSWSKDGRRLGEPDGPRVRVEELGEASAL 169

Query: 305 KVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV---------------------------- 336
           ++   + +D G Y   A N  G   +A  L V                            
Sbjct: 170 RIRAARPRDGGTYEVRAENPLGAASAAAALVVDSDAADTASRPGTSTAALLAHLQRRREA 229

Query: 337 -------KEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFREDQRLLPCRK--- 385
                    P    TR     EG+    A L C V     P T W ++ Q +   R+   
Sbjct: 230 MRAEGAPASPPSTGTRTCTVTEGKH---ARLSCYVTGEPKPETVWKKDGQLVTEGRRHVV 286

Query: 386 YEQIEEGTVRRLIIHRLKADDDGIYLC---EMRGRVRTVANVTVKGPIL--KRLPRKLDV 440
           YE  +E  V +++    K  D G+Y C    + G+  +   V V+ P +  K+  + L+V
Sbjct: 287 YEDAQENFVLKILF--CKQSDRGLYTCTASNLVGQTYSSVLVVVREPAVPFKKRLQDLEV 344

Query: 441 LEGENAVLLVETLEAGVEGRWSRDGEEL 468
            E E+A  L E  +   E  W ++   L
Sbjct: 345 REKESATFLCEVPQPSTEAAWFKEETRL 372



 Score =  101 bits (252), Expect = 6e-21
 Identities = 102/352 (28%), Positives = 137/352 (38%), Gaps = 38/352 (10%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG-AEHGLL 70
            P FL   +   V  G      CVV G+P P V W K G+ L   +      D    H L+
Sbjct: 5126 PVFLTELQNQEVQDGYPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLI 5185

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTV------LEPPASDPE----------LQPA 114
            +TA +P D GVY C A N+ G +   A + V       +  A   E          L   
Sbjct: 5186 ITAVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSR 5245

Query: 115  ERPLPSPGSGEGA-PVFLTGPRSQWVLRGAEVV-LTCRAGGLPEPTLYWEKDGMALDEVW 172
            E+      + EG  P  +   R   V  G  +     +  G P P LYW KDG  L    
Sbjct: 5246 EQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTA-- 5303

Query: 173  DSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVH---QP 229
             S+H  +   +          L I++    DSG Y  +  NA G A + A L V    +P
Sbjct: 5304 -SAHIRMTDKKILH------TLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEP 5356

Query: 230  PESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEG--RPLL 287
             E P +D  E   P     +  PK   V +G    F   V G+P P + W  E   R +L
Sbjct: 5357 EEKPASDVHEQLVPPRMLERFTPKK--VKKGSSITFSVKVEGRPVPTVHWLREEAERGVL 5414

Query: 288  ---PDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
               PD              L +L    + +G Y C A N+AGQ L +  LHV
Sbjct: 5415 WIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHV 5466



 Score = 84.7 bits (208), Expect = 8e-16
 Identities = 63/221 (28%), Positives = 97/221 (43%), Gaps = 29/221 (13%)

Query: 142  GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
            G  V L CR  G P+P + W KDG A+    D  H  ++       P  S AL + +   
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQV--DPHHILIED------PDGSCALILDSLTG 6079

Query: 202  PDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGK 261
             DSG Y+C A +A G+      + V  PP              V  ++ +P      EG+
Sbjct: 6080 VDSGQYMCFAASAAGNCSTLGKILVQVPPR------------FVNKVRASPFV----EGE 6123

Query: 262  HAKFRCYVMGKPEPEIEWHWEGRPLLPDRR-RLMYRDRDGGFVLKVLYCQAKDRGLYVCA 320
             A+F C + G P P+I W+ +G  L    + + +   R G  VL +     +D GLY C 
Sbjct: 6124 DAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECE 6183

Query: 321  ARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLE 361
              N  G   ++ +L ++ P L+     Q+   RE  +A +E
Sbjct: 6184 LVNRLGSARASAELRIQSPMLQ----AQEQCHREQLVAAVE 6220



 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 83/279 (29%), Positives = 115/279 (41%), Gaps = 50/279 (17%)

Query: 103  EPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWE 162
            E PA  P + P   PLPS  + + APVFLT  ++Q V  G  V   C   G P P++ W 
Sbjct: 5105 ETPA--PVVPP--EPLPSLLTSDAAPVFLTELQNQEVQDGYPVSFDCVVTGQPMPSVRWF 5160

Query: 163  KDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGA 222
            KDG  L+E     H+ +     ED  G    L I A    D GVY C A N+ G +   A
Sbjct: 5161 KDGKLLEE---DDHYMIN----EDQQGGH-QLIITAVVPADMGVYRCLAENSMGVSSTKA 5212

Query: 223  LLQVH---------------------------QPPESPPADPDEAPAP-VVEPLK---CA 251
             L+V                            +  E   +  DE   P VVE L+    A
Sbjct: 5213 ELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQVVEELRDLQVA 5272

Query: 252  PKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQA 311
            P T      + AKF+  V G P P + W  +G+PL      +   D+     L+++    
Sbjct: 5273 PGT------RLAKFQLKVKGYPAPRLYWFKDGQPLTAS-AHIRMTDKKILHTLEIISVTR 5325

Query: 312  KDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDV 350
            +D G Y     N+ G   S+ +L V+ P     +P  DV
Sbjct: 5326 EDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDV 5364



 Score = 75.9 bits (185), Expect = 4e-13
 Identities = 61/229 (26%), Positives = 92/229 (40%), Gaps = 10/229 (4%)

Query: 4    SSGDQGSPPCFLRFPRPVRVVSGAE-AELKCVVLGEPPPVVVWEKGGQQLAASERLSFPA 62
            S+ D+G  P  +   R ++V  G   A+ +  V G P P + W K GQ L AS  +    
Sbjct: 5252 STTDEGQLPQVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTD 5311

Query: 63   DGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
                H L + +    D+G Y     NA G AY++A + V  P       +P E+P     
Sbjct: 5312 KKILHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPD------EPEEKPASDVH 5365

Query: 123  SGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPG 182
                 P  L     + V +G+ +  + +  G P PT++W ++      +W        PG
Sbjct: 5366 EQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPD---TPG 5422

Query: 183  RAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPE 231
                      +L +L       G Y C A NA G A   A L V   P+
Sbjct: 5423 YTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSGLPK 5471



 Score = 75.9 bits (185), Expect = 4e-13
 Identities = 127/506 (25%), Positives = 194/506 (38%), Gaps = 61/506 (12%)

Query: 947  QKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLEC 1006
            ++ED+VR+ +L A        ++ EI        + V  PP    +  +     A   E 
Sbjct: 5974 EREDSVRKYLLQARTAIIKSSWVKEICGIQQRLALPVWRPPD---FEEELADCTAELGET 6030

Query: 1007 VVLMCELSREDAPV-RWYKDG--LEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC-- 1061
            V L C ++    PV  WYKDG  ++V+    L+ + DG  C L+L +    D G+++C  
Sbjct: 6031 VKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGS-CALILDSLTGVDSGQYMCFA 6089

Query: 1062 --DAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGL 1119
               AG+ S    + V  PP R V+    S  +  G   +     E AP   Q+RWYKDG 
Sbjct: 6090 ASAAGNCSTLGKILVQVPP-RFVNKVRASPFVE-GEDAQFTCTIEGAPY-PQIRWYKDGA 6146

Query: 1120 EVEASDALQLGAEGPTRTLTL--PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALE 1177
             +   +  Q  +E  +  L L    A  ED G Y CE  +   +     AE  +Q     
Sbjct: 6147 LLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECELVNRLGSARA-SAELRIQ----- 6200

Query: 1178 TTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGP 1237
               SP+  A  +     C   +  A V  +   R  QE   +     GP+      A GP
Sbjct: 6201 ---SPMLQAQEQ-----CHREQLVAAVEDTTLERADQEVTSVLKRLLGPK------APGP 6246

Query: 1238 AHAGLYTCQSGAAPGAPSLSFTVQVAEPPVR------VVAPEAAQTRVRSTPGGDLELVV 1291
            +  G  T       GAP+L  T   ++PPV        V P   Q  +   P  + E + 
Sbjct: 6247 S-TGDLTGPGPCPRGAPALQET--GSQPPVTGTSEAPAVPPRVPQPLLHEGPEQEPEAIA 6303

Query: 1292 HLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFL 1351
                   P+R   +G      G  +L       V+R    R+     Y   A     I  
Sbjct: 6304 RAQEWTVPIR--MEGAAWPGAGTGELLWDVHSHVVRETTQRT-----YTYQA-----IDT 6351

Query: 1352 VSVEEPLLVKLVSELTPLTVHEGDDATFRCEV-SPPDADVTWLRNGAVVTPGPQVEMAQN 1410
             +   P +   + ++   T   G  A F   +   P   VTW ++   +    ++   Q 
Sbjct: 6352 HTARPPSMQVTIEDVQAQT---GGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTRLSQQQE 6408

Query: 1411 GSSRILTLRGCQLGDAGTVTLRAGST 1436
            G++  L LR     DAG  T  A +T
Sbjct: 6409 GTTYSLVLRHVASKDAGVYTCLAQNT 6434



 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 48/181 (26%), Positives = 82/181 (45%), Gaps = 11/181 (6%)

Query: 260  GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
            G+  K  C V G P+P I W+ +G+ +  D   ++  D DG   L +      D G Y+C
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMC 6087

Query: 320  AARNSAG--QTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFRE 376
             A ++AG   TL  + + V    +   R    VEG +   A   C +  +  P   W+++
Sbjct: 6088 FAASAAGNCSTLGKILVQVPPRFVNKVRASPFVEGED---AQFTCTIEGAPYPQIRWYKD 6144

Query: 377  DQRLLPCRKYEQIEE--GTVRRLIIHRLKADDDGIYLCEM---RGRVRTVANVTVKGPIL 431
               L    K++ + E    +  L+I     +D G+Y CE+    G  R  A + ++ P+L
Sbjct: 6145 GALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECELVNRLGSARASAELRIQSPML 6204

Query: 432  K 432
            +
Sbjct: 6205 Q 6205



 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 84/373 (22%), Positives = 143/373 (38%), Gaps = 80/373 (21%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASER---LSFPADGAEH 67
            PP F+   R    V G +A+  C + G P P + W K G  L    +   LS P  G   
Sbjct: 6107 PPRFVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGL-L 6165

Query: 68   GLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEP---------------PASDPELQ 112
             L++ AA   D G+Y C   N  G A A+A + +  P                  D  L+
Sbjct: 6166 VLVIRAASKEDLGLYECELVNRLGSARASAELRIQSPMLQAQEQCHREQLVAAVEDTTLE 6225

Query: 113  PAERPL------------PSPGSGEGAPVFLTG----PRSQWVLR--GAEVVLTCRAGG- 153
             A++ +            P P +G+     LTG    PR    L+  G++  +T  +   
Sbjct: 6226 RADQEVTSVLKRLLGPKAPGPSTGD-----LTGPGPCPRGAPALQETGSQPPVTGTSEAP 6280

Query: 154  -----LPEPTLY----WEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDS 204
                 +P+P L+     E + +A  + W                  ++ +R+  A  P +
Sbjct: 6281 AVPPRVPQPLLHEGPEQEPEAIARAQEW------------------TVPIRMEGAAWPGA 6322

Query: 205  GV-YVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHA 263
            G   +    ++H   +       +Q  ++  A P      +        +      G  A
Sbjct: 6323 GTGELLWDVHSHVVRETTQRTYTYQAIDTHTARPPSMQVTI--------EDVQAQTGGTA 6374

Query: 264  KFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARN 323
            +F   + G P+P + W+ +   L+ D  RL  +     + L + +  +KD G+Y C A+N
Sbjct: 6375 QFEAIIEGDPQPSVTWYKDSVQLV-DSTRLSQQQEGTTYSLVLRHVASKDAGVYTCLAQN 6433

Query: 324  SAGQTLSAVQLHV 336
            + GQ L   +L V
Sbjct: 6434 TGGQVLCKAELLV 6446



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 59/206 (28%), Positives = 81/206 (39%), Gaps = 33/206 (16%)

Query: 26   GAEAELKCVVLGEPPPVVVWEKGGQ--QLAASERLSFPADGAEHGLLLTAALPTDAGVYV 83
            G   +L C V G P PV+ W K G+  Q+     L    DG+   L+L +    D+G Y+
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGS-CALILDSLTGVDSGQYM 6086

Query: 84   CRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGA 143
            C A +AAG       + V  PP                        F+   R+   + G 
Sbjct: 6087 CFAASAAGNCSTLGKILVQVPPR-----------------------FVNKVRASPFVEGE 6123

Query: 144  EVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPD 203
            +   TC   G P P + W KDG  L     +    L   R+       L L I AA   D
Sbjct: 6124 DAQFTCTIEGAPYPQIRWYKDGALL--TTGNKFQTLSEPRS-----GLLVLVIRAASKED 6176

Query: 204  SGVYVCHARNAHGHAQAGALLQVHQP 229
             G+Y C   N  G A+A A L++  P
Sbjct: 6177 LGLYECELVNRLGSARASAELRIQSP 6202



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 126/569 (22%), Positives = 182/569 (31%), Gaps = 118/569 (20%)

Query: 26   GAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG-AEHGLLLTAALPTDAGVYVC 84
            G    L+CVV  +      W K G +L           G     LL+T     DAG Y C
Sbjct: 4912 GDALRLECVVASKADVRARWLKDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCYTC 4971

Query: 85   RARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF---------LTGPR 135
            +  N  G+   +A V V            +E    S   GE    F         L   +
Sbjct: 4972 QVSNKFGQVTHSACVVV----------SGSESEAESSSGGELDDAFRRAARRLHRLFRTK 5021

Query: 136  SQWVLRGAEVVLTCRAG-GLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLAL 194
            S   +   E+ L+   G   PE    W+          +  HF     R E    A  A+
Sbjct: 5022 SPAEVSDEELFLSADEGPAEPEEPADWQ-------TYREDEHFICI--RFEALTEARQAV 5072

Query: 195  RILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADP-------DEAPAPVVEP 247
                      G+ V       G  +    +    P    P +P       D AP  + E 
Sbjct: 5073 TRFQEMFATLGIGVEIKLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSDAAPVFLTE- 5131

Query: 248  LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVL 307
                 +   V +G    F C V G+P P + W  +G+ L  D   ++  D+ GG  L + 
Sbjct: 5132 ----LQNQEVQDGYPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLIIT 5187

Query: 308  YCQAKDRGLYVCAARNSAGQTLSAVQLHV-------------KEPRLRFT---------- 344
                 D G+Y C A NS G + +  +L V              E    F+          
Sbjct: 5188 AVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQ 5247

Query: 345  -------------------RPLQDVEGREHGIAVLECKVPNSRIPTA-WFREDQRLLPCR 384
                               R LQ   G    +A  + KV     P   WF++ Q L    
Sbjct: 5248 EGTESTTDEGQLPQVVEELRDLQVAPGTR--LAKFQLKVKGYPAPRLYWFKDGQPLTASA 5305

Query: 385  KYEQIEEGTVRRLIIHRLKADDDG---IYLCEMRGRVRTVANVTVKGPILKRLPRKLDVL 441
                 ++  +  L I  +  +D G    Y+    G   + A + V+GP         DV 
Sbjct: 5306 HIRMTDKKILHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDVH 5365

Query: 442  EGENAVLLVE-------------TLEAGVEGR------WSRD---------GEELPVICQ 473
            E      ++E             T    VEGR      W R+         G + P    
Sbjct: 5366 EQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPDTPGYTV 5425

Query: 474  SSSGHMHALVLPGVTREDAGEVTFSLGNS 502
            +SS   H+LVL  V R+  G  T    N+
Sbjct: 5426 ASSAQQHSLVLLDVGRQHQGTYTCIASNA 5454



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 40/114 (35%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            PP        V+  +G  A+ + ++ G+P P V W K   QL  S RLS   +G  + L+
Sbjct: 6356 PPSMQVTIEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTRLSQQQEGTTYSLV 6415

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVL----EPPASDPELQPAERPLPS 120
            L      DAGVY C A+N  G+    A + VL    EP   D E Q   R L S
Sbjct: 6416 LRHVASKDAGVYTCLAQNTGGQVLCKAELLVLGGDNEP---DSEKQSHRRKLHS 6466



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 108/456 (23%), Positives = 158/456 (34%), Gaps = 83/456 (18%)

Query: 914  ERVVLTCELC-RPWAEVRWTKDGEEVVESPA-LLLQKEDTVRRLVLPAVQLEDSGEYLCE 971
            E V L C +   P   + W KDG+ V   P  +L++  D    L+L ++   DSG+Y+C 
Sbjct: 6029 ETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCF 6088

Query: 972  IDDESASFT----VTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDG 1026
                + + +    + V  PP  +   R       V  E     C +     P +RWYKDG
Sbjct: 6089 AASAAGNCSTLGKILVQVPPRFVNKVRASP---FVEGEDAQFTCTIEGAPYPQIRWYKDG 6145

Query: 1027 --LEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCD----AGDDSAFFTVTVTAPPER 1080
              L        + E       LV+ AA  ED G + C+     G   A   + + +P  +
Sbjct: 6146 ALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECELVNRLGSARASAELRIQSPMLQ 6205

Query: 1081 IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGP---TRT 1137
                  R                ++  A       +   EV +     LG + P   T  
Sbjct: 6206 AQEQCHRE---------------QLVAAVEDTTLERADQEVTSVLKRLLGPKAPGPSTGD 6250

Query: 1138 LTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCEL 1197
            LT P   P  A                    P +Q    +   +    AP  P       
Sbjct: 6251 LTGPGPCPRGA--------------------PALQETGSQPPVTGTSEAPAVP------- 6283

Query: 1198 SRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAG------LYTCQSGAAP 1251
             R   P++  H G P QE E +   A      + I+  G A  G      L+   S    
Sbjct: 6284 PRVPQPLL--HEG-PEQEPEAI---ARAQEWTVPIRMEGAAWPGAGTGELLWDVHSHVVR 6337

Query: 1252 GAPSLSFTVQ-----VAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKD 1305
                 ++T Q      A PP   V  E  Q +     GG  +    + G P   V WYKD
Sbjct: 6338 ETTQRTYTYQAIDTHTARPPSMQVTIEDVQAQT----GGTAQFEAIIEGDPQPSVTWYKD 6393

Query: 1306 GERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
              +L    R+  +Q G    L ++   S DAG Y C
Sbjct: 6394 SVQLVDSTRLSQQQEGTTYSLVLRHVASKDAGVYTC 6429



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 46/179 (25%), Positives = 78/179 (43%), Gaps = 15/179 (8%)

Query: 1284 GGDLELVVHLSGPGGPV-RWYKDGERL-ASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
            G  ++L   ++G   PV  WYKDG+ +      + +E       L +      D+G+Y+C
Sbjct: 6028 GETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMC 6087

Query: 1342 DAPQD----SRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVS-PPDADVTWLRNG 1396
             A       S +  + V+ P   + V+++      EG+DA F C +   P   + W ++G
Sbjct: 6088 FAASAAGNCSTLGKILVQVP--PRFVNKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKDG 6145

Query: 1397 AVVTPGPQVEMAQNGSSRILTL--RGCQLGDAG----TVTLRAGSTATSARLHVRETEL 1449
            A++T G + +      S +L L  R     D G     +  R GS   SA L ++   L
Sbjct: 6146 ALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECELVNRLGSARASAELRIQSPML 6204



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 65/244 (26%), Positives = 98/244 (40%), Gaps = 20/244 (8%)

Query: 648  FLNGEELKSNEPEGQVEPGALRYRI--EQKGLQHRLILHAVKHQDSGALVGFSCPGVQDS 705
            F N  +L S +   QVE     + +  E++    + +L A       + V   C G+Q  
Sbjct: 5947 FRNMMKLSSIDLNDQVEGDDRAFEVWQEREDSVRKYLLQARTAIIKSSWVKEIC-GIQQR 6005

Query: 706  AALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPA-TWYKDGQ--KVEESELL 762
             AL +   P      ++    T    E V L C ++    P  +WYKDG+  +V+   +L
Sbjct: 6006 LALPVWRPPDF---EEELADCTAELGETVKLACRVTGTPKPVISWYKDGKAVQVDPHHIL 6062

Query: 763  VVKMDGRKHRLILPEAKVQDSGEFEC----RTEGVSAFFGVTVQDPPVHIVDPREHVFVH 818
            +   DG    LIL      DSG++ C         S    + VQ PP  +   R   FV 
Sbjct: 6063 IEDPDG-SCALILDSLTGVDSGQYMCFAASAAGNCSTLGKILVQVPPRFVNKVRASPFVE 6121

Query: 819  AITSECVMLACEVDREDAP-VRWYKDGQEVEESD-FVVL-ENEGPHRRLVLPATQPSDGG 875
                E     C ++    P +RWYKDG  +   + F  L E       LV+ A    D G
Sbjct: 6122 ---GEDAQFTCTIEGAPYPQIRWYKDGALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLG 6178

Query: 876  EFQC 879
             ++C
Sbjct: 6179 LYEC 6182



 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 46/159 (28%), Positives = 69/159 (43%), Gaps = 12/159 (7%)

Query: 823  ECVMLACEVDREDAPV-RWYKDGQEVE-ESDFVVLENEGPHRRLVLPATQPSDGGEFQCV 880
            E V LAC V     PV  WYKDG+ V+ +   +++E+      L+L +    D G++ C 
Sbjct: 6029 ETVKLACRVTGTPKPVISWYKDGKAVQVDPHHILIEDPDGSCALILDSLTGVDSGQYMCF 6088

Query: 881  AGD---ECAYFTVTITDVSSWIVYPSGKVYVAA-VRLERVVLTCEL-CRPWAEVRWTKDG 935
            A      C+     +  V    V    KV  +  V  E    TC +   P+ ++RW KDG
Sbjct: 6089 AASAAGNCSTLGKILVQVPPRFV---NKVRASPFVEGEDAQFTCTIEGAPYPQIRWYKDG 6145

Query: 936  EEVVESPAL--LLQKEDTVRRLVLPAVQLEDSGEYLCEI 972
              +        L +    +  LV+ A   ED G Y CE+
Sbjct: 6146 ALLTTGNKFQTLSEPRSGLLVLVIRAASKEDLGLYECEL 6184



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 32/99 (32%), Positives = 39/99 (39%), Gaps = 1/99 (1%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL- 70
            P FLR      VV G    L C V  +P     W K G  L +S R+   A      LL 
Sbjct: 7463 PTFLRELSDETVVLGQSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISATLKNFQLLT 7522

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDP 109
            +   +  D GVY C   NA G       +   E P+S P
Sbjct: 7523 ILVVVAEDLGVYTCSVSNALGTVTTTGVLRKAERPSSSP 7561



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 87/336 (25%), Positives = 116/336 (34%), Gaps = 82/336 (24%)

Query: 1639 EVTEGDTATFECELS-QALADVTWEKDGNALTPSPRLRLQA--LGTRRLLQLRRCGPSDA 1695
            EV +G   +F+C ++ Q +  V W KDG  L       +     G  +L+ +    P+D 
Sbjct: 5136 EVQDGYPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLI-ITAVVPADM 5194

Query: 1696 GTYSC------AVGTARA------------------------------------GPVRLT 1713
            G Y C       V + +A                                    G    T
Sbjct: 5195 GVYRCLAENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTT 5254

Query: 1714 VRERTVAVLSELRSVSAREGDG-ATFECTVSEVETTGR-WELGGRPLRPGARVRIRQEGK 1771
               +   V+ ELR +    G   A F+  V         W   G+PL   A +R+  +  
Sbjct: 5255 DEGQLPQVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKI 5314

Query: 1772 KHILVLSELRAEDAGE----VRFQAGPAQSLALL------EVEALPLQMCRH---PPR-- 1816
             H L +  +  ED+G+    +    G A S A L      E E  P         PPR  
Sbjct: 5315 LHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDVHEQLVPPRML 5374

Query: 1817 ----EKTVLVGRRAVLEVTVS-RSGGHVCWLREGAEL--------CPGDKYEMRSHGPTH 1863
                 K V  G      V V  R    V WLRE AE          PG  Y + S    H
Sbjct: 5375 ERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPDTPG--YTVASSAQQH 5432

Query: 1864 SLVIHDVRPEDQGTYCC----QAGQDSTHTRLLVEG 1895
            SLV+ DV  + QGTY C     AGQ      L V G
Sbjct: 5433 SLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSG 5468



 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 122/566 (21%), Positives = 184/566 (32%), Gaps = 135/566 (23%)

Query: 1001 AVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGP-RCRLVLPAAQPEDGGEF 1059
            A+ LECVV     S+ D   RW KDG+E+ +     +++ G   C L++      D G +
Sbjct: 4914 ALRLECVVA----SKADVRARWLKDGVELTDGRHHHIDQLGDGTCSLLITGLDRADAGCY 4969

Query: 1060 VCDAGDDSAFFT----VTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWY 1115
             C   +     T    V V+         +   LD  F    R   R             
Sbjct: 4970 TCQVSNKFGQVTHSACVVVSGSESEAESSSGGELDDAFRRAARRLHRLFRT--------- 5020

Query: 1116 KDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAIT--------FNVILA 1167
            K   EV   +      EGP         Q     E+    R EA+T        F  + A
Sbjct: 5021 KSPAEVSDEELFLSADEGPAEPEEPADWQTYREDEHFICIRFEALTEARQAVTRFQEMFA 5080

Query: 1168 ------------------------EPPVQFLALETTPSPLC---------------VAPG 1188
                                    E P   +  E  PS L                V  G
Sbjct: 5081 TLGIGVEIKLVEQGPRRVEMCISKETPAPVVPPEPLPSLLTSDAAPVFLTELQNQEVQDG 5140

Query: 1189 EPVVLSCELSRAGAPVV-WSHNGRPVQEGEGLELHAEGPR-RVLCIQAAGPAHAGLYTCQ 1246
             PV   C ++    P V W  +G+ ++E +   ++ +      L I A  PA  G+Y C 
Sbjct: 5141 YPVSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCL 5200

Query: 1247 SGAAPGAPSLSFTVQV---------AEPPVRVVAPEAAQTRVRS---------TPGGDLE 1288
            +  + G  S    ++V         A       +  +AQ  + S         T  G L 
Sbjct: 5201 AENSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLP 5260

Query: 1289 LVVH-------------------LSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRV 1328
             VV                    + G P   + W+KDG+ L +   +++        L +
Sbjct: 5261 QVVEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKILHTLEI 5320

Query: 1329 QGARSGDAGEY-------LCDAPQDSRIFLVSVEEP------------LLVKLVSELTPL 1369
                  D+G+Y       +  A   +R+ +   +EP            +  +++   TP 
Sbjct: 5321 ISVTREDSGQYAAYISNAMGAAYSSARLLVRGPDEPEEKPASDVHEQLVPPRMLERFTPK 5380

Query: 1370 TVHEGDDATFRCEV-SPPDADVTWLRNGA---VVTPGPQV---EMAQNGSSRILTLRGCQ 1422
             V +G   TF  +V   P   V WLR  A   V+  GP      +A +     L L    
Sbjct: 5381 KVKKGSSITFSVKVEGRPVPTVHWLREEAERGVLWIGPDTPGYTVASSAQQHSLVLLDVG 5440

Query: 1423 LGDAGTVTL----RAGSTATSARLHV 1444
                GT T      AG    SA LHV
Sbjct: 5441 RQHQGTYTCIASNAAGQALCSASLHV 5466



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 44/140 (31%), Positives = 53/140 (37%), Gaps = 11/140 (7%)

Query: 104  PPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEK 163
            PP   P L  A   L    S + AP FL     + V+ G  V L C+    P     W K
Sbjct: 7441 PPRKKPGL--ASFRLSGLKSWDRAPTFLRELSDETVVLGQSVTLACQVSAQPAAQATWSK 7498

Query: 164  DGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGH-AQAGA 222
            DG  L    +SS   L     ++       L IL     D GVY C   NA G     G 
Sbjct: 7499 DGAPL----ESSSRVLISATLKN----FQLLTILVVVAEDLGVYTCSVSNALGTVTTTGV 7550

Query: 223  LLQVHQPPESPPADPDEAPA 242
            L +  +P  SP  D  E  A
Sbjct: 7551 LRKAERPSSSPCPDIGEVYA 7570



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 42/195 (21%), Positives = 78/195 (40%), Gaps = 45/195 (23%)

Query: 825  VMLACEVDREDAP-VRWYKDGQEVEESD-FVVLENEGPHRRLVLPATQPSDGGEFQCVAG 882
            V   C V  +  P VRW+KDG+ +EE D +++ E++    +L++ A  P+D G ++C+A 
Sbjct: 5143 VSFDCVVTGQPMPSVRWFKDGKLLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCLAE 5202

Query: 883  DECAYFTV--------------TITDVSSWIVYPSGKVYVAAVRLERVVLTCELCR---- 924
            +     +               T  D +    Y S + Y+++   E    T +  +    
Sbjct: 5203 NSMGVSSTKAELRVDLTSTDYDTAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQV 5262

Query: 925  -------------------------PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPA 959
                                     P   + W KDG+ +  S  + +  +  +  L + +
Sbjct: 5263 VEELRDLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKILHTLEIIS 5322

Query: 960  VQLEDSGEYLCEIDD 974
            V  EDSG+Y   I +
Sbjct: 5323 VTREDSGQYAAYISN 5337



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 127/609 (20%), Positives = 209/609 (34%), Gaps = 144/609 (23%)

Query: 741  SRVDFPATWYKDGQKVEESELLVVKMDGRKHR----------LILPEAKVQDSGEFECRT 790
            S+ D  A W KDG ++          DGR H           L++      D+G + C+ 
Sbjct: 4923 SKADVRARWLKDGVELT---------DGRHHHIDQLGDGTCSLLITGLDRADAGCYTCQ- 4972

Query: 791  EGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEES 850
              VS  FG       V +V   E     +   E         R    +   K   EV + 
Sbjct: 4973 --VSNKFGQVTHSACV-VVSGSESEAESSSGGELDDAFRRAARRLHRLFRTKSPAEVSDE 5029

Query: 851  DFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDE---CAYFTVTITDVSSWIVYPSGKVY 907
            +  +  +EGP         +P +  ++Q    DE   C  F   +T+             
Sbjct: 5030 ELFLSADEGP--------AEPEEPADWQTYREDEHFICIRFEA-LTEARQ---------- 5070

Query: 908  VAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGE 967
             A  R + +  T  +     E++  + G   VE   + + KE        P V  E    
Sbjct: 5071 -AVTRFQEMFATLGI---GVEIKLVEQGPRRVE---MCISKETPA-----PVVPPEPLPS 5118

Query: 968  YLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGL 1027
             L    D +  F   +    V+  YP        V+ +CVV      +    VRW+KDG 
Sbjct: 5119 LLTS--DAAPVFLTELQNQEVQDGYP--------VSFDCVVT----GQPMPSVRWFKDGK 5164

Query: 1028 EVEESEALVLERDGP-RCRLVLPAAQPEDGGEFVC------------------------- 1061
             +EE +  ++  D     +L++ A  P D G + C                         
Sbjct: 5165 LLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCLAENSMGVSSTKAELRVDLTSTDYD 5224

Query: 1062 ---DAGDDSAFFTV-----------TVTAPPERIVHPAARSLDLHFGAPG----RVELRC 1103
               DA + S++F+            T +   E  +      L     APG    + +L+ 
Sbjct: 5225 TAADATESSSYFSAQGYLSSREQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAKFQLKV 5284

Query: 1104 EVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGE---YVCETRHEAI 1160
            +  PA  ++ W+KDG  + AS  +++  +    TL +     ED+G+   Y+      A 
Sbjct: 5285 KGYPA-PRLYWFKDGQPLTASAHIRMTDKKILHTLEIISVTREDSGQYAAYISNAMGAAY 5343

Query: 1161 TFNVILA-------EPPVQFLALETTP-------SPLCVAPGEPVVLSCELSRAGAPVVW 1206
            +   +L        E P   +  +  P       +P  V  G  +  S ++   G PV  
Sbjct: 5344 SSARLLVRGPDEPEEKPASDVHEQLVPPRMLERFTPKKVKKGSSITFSVKVE--GRPVPT 5401

Query: 1207 SHNGRPVQE---------GEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLS 1257
             H  R   E           G  + +   +  L +   G  H G YTC +  A G    S
Sbjct: 5402 VHWLREEAERGVLWIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCS 5461

Query: 1258 FTVQVAEPP 1266
             ++ V+  P
Sbjct: 5462 ASLHVSGLP 5470



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 26/65 (40%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 1637 DLEVTEGDTATFECELS-QALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDA 1695
            D++   G TA FE  +       VTW KD   L  S RL  Q  GT   L LR     DA
Sbjct: 6365 DVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTRLSQQQEGTTYSLVLRHVASKDA 6424

Query: 1696 GTYSC 1700
            G Y+C
Sbjct: 6425 GVYTC 6429



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 1630 TIVRGPHDLEVTEGDTATFECELS-QALADVTWEKDGNALTPSPRLRLQA-LGTRRLLQL 1687
            T +R   D  V  G + T  C++S Q  A  TW KDG  L  S R+ + A L   +LL +
Sbjct: 7464 TFLRELSDETVVLGQSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISATLKNFQLLTI 7523

Query: 1688 RRCGPSDAGTYSCAVGTA 1705
                  D G Y+C+V  A
Sbjct: 7524 LVVVAEDLGVYTCSVSNA 7541



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 7/106 (6%)

Query: 328  TLSAVQLHV-KEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA-WFREDQRLLPCRK 385
            T  A+  H  + P ++ T  ++DV+ +  G A  E  +     P+  W+++  +L+   +
Sbjct: 6345 TYQAIDTHTARPPSMQVT--IEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTR 6402

Query: 386  YEQIEEGTVRRLIIHRLKADDDGIYLC---EMRGRVRTVANVTVKG 428
              Q +EGT   L++  + + D G+Y C      G+V   A + V G
Sbjct: 6403 LSQQQEGTTYSLVLRHVASKDAGVYTCLAQNTGGQVLCKAELLVLG 6448



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 47/192 (24%), Positives = 79/192 (41%), Gaps = 32/192 (16%)

Query: 440  VLEGENAVLLVE-TLEAGVEGRWSRDGEELP----VICQSSSGHMHALVLPGVTREDAGE 494
            V+ G++  L  + + +   +  WS+DG  L     V+  ++  +   L +  V  ED G 
Sbjct: 7474 VVLGQSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISATLKNFQLLTILVVVAEDLGV 7533

Query: 495  VTFSLGNSR---TTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIY 551
             T S+ N+    TTT +  K  + S    P + E++    + VLL WKP E      +I 
Sbjct: 7534 YTCSVSNALGTVTTTGVLRKAERPSSSPCPDIGEVYA---DGVLLVWKPVESYGPVTYIV 7590

Query: 552  RLERQ-----EVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPH--- 603
            +   +      + S+ +  C+   K          +   G Y FR   VS  G  P+   
Sbjct: 7591 QCSLEGGSWTTLASDIFDCCYLTSK----------LSRGGTYTFRTACVSKAGMGPYSSP 7640

Query: 604  ---VVFHGSAHL 612
               V+  G +HL
Sbjct: 7641 SEQVLLGGPSHL 7652



 Score = 39.7 bits (91), Expect = 0.028
 Identities = 64/274 (23%), Positives = 102/274 (37%), Gaps = 57/274 (20%)

Query: 1450 LFLRRLQDVRAEEGQDVCLE-VETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHI-HRL 1507
            +FL  LQ+   ++G  V  + V TG+     +VRW + G+ L  D    + +D    H+L
Sbjct: 5127 VFLTELQNQEVQDGYPVSFDCVVTGQ--PMPSVRWFKDGKLLEEDDHYMINEDQQGGHQL 5184

Query: 1508 FIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEG 1567
             I  V+ AD G Y C + +      +S    +LRV     D+T ++  +A    E S   
Sbjct: 5185 IITAVVPADMGVYRCLAENS---MGVSSTKAELRV-----DLTSTDYDTAADATESSS-- 5234

Query: 1568 VTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGL-GLADSGCVSFTADSLRCAARLIVRE 1626
                              +  + G+       G     D G +    + LR         
Sbjct: 5235 ------------------YFSAQGYLSSREQEGTESTTDEGQLPQVVEELR--------- 5267

Query: 1627 VPVTIVRGPHDLEVTEGD-TATFECELSQALAD-VTWEKDGNALTPSPRLRLQALGTRRL 1684
                      DL+V  G   A F+ ++    A  + W KDG  LT S  +R+        
Sbjct: 5268 ----------DLQVAPGTRLAKFQLKVKGYPAPRLYWFKDGQPLTASAHIRMTDKKILHT 5317

Query: 1685 LQLRRCGPSDAGTYSCAVGTARA---GPVRLTVR 1715
            L++      D+G Y+  +  A        RL VR
Sbjct: 5318 LEIISVTREDSGQYAAYISNAMGAAYSSARLLVR 5351



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 28/84 (33%), Positives = 43/84 (51%), Gaps = 9/84 (10%)

Query: 153  GLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHAR 212
            G P+P++ W KD + L    DS+  + Q    ++G   SL LR +A++  D+GVY C A+
Sbjct: 6382 GDPQPSVTWYKDSVQLV---DSTRLSQQ----QEGTTYSLVLRHVASK--DAGVYTCLAQ 6432

Query: 213  NAHGHAQAGALLQVHQPPESPPAD 236
            N  G     A L V      P ++
Sbjct: 6433 NTGGQVLCKAELLVLGGDNEPDSE 6456



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 47/177 (26%), Positives = 67/177 (37%), Gaps = 31/177 (17%)

Query: 1483 WVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDR----TLARLSVRPR 1538
            W + GQPL   + + M     +H L I  V   D G Y     +      + ARL VR  
Sbjct: 5294 WFKDGQPLTASAHIRMTDKKILHTLEIISVTREDSGQYAAYISNAMGAAYSSARLLVRGP 5353

Query: 1539 QLRVLRPLEDV----------------TISEGGSATFQLELSQEGV-TGEWARGGVQ--- 1578
                 +P  DV                 + +G S TF +++    V T  W R   +   
Sbjct: 5354 DEPEEKPASDVHEQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPVPTVHWLREEAERGV 5413

Query: 1579 LYPGPKC---HIHSDGHRHRLVLNGLGLADSG---CV-SFTADSLRCAARLIVREVP 1628
            L+ GP      + S   +H LVL  +G    G   C+ S  A    C+A L V  +P
Sbjct: 5414 LWIGPDTPGYTVASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALCSASLHVSGLP 5470



 Score = 37.7 bits (86), Expect = 0.11
 Identities = 19/67 (28%), Positives = 30/67 (44%)

Query: 260  GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
            G+     C V  +P  +  W  +G PL    R L+        +L +L   A+D G+Y C
Sbjct: 7477 GQSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISATLKNFQLLTILVVVAEDLGVYTC 7536

Query: 320  AARNSAG 326
            +  N+ G
Sbjct: 7537 SVSNALG 7543



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 4/61 (6%)

Query: 1839 VCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA----GQDSTHTRLLVE 1894
            V W ++  +L    +   +  G T+SLV+  V  +D G Y C A    GQ      LLV 
Sbjct: 6388 VTWYKDSVQLVDSTRLSQQQEGTTYSLVLRHVASKDAGVYTCLAQNTGGQVLCKAELLVL 6447

Query: 1895 G 1895
            G
Sbjct: 6448 G 6448



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 1185 VAPGEPVVLSCELS-RAGAPVVWSHNGRPVQEGEGLELHAEGPR-RVLCIQAAGPAHAGL 1242
            V  G+ V L+C++S +  A   WS +G P++    + + A     ++L I        G+
Sbjct: 7474 VVLGQSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISATLKNFQLLTILVVVAEDLGV 7533

Query: 1243 YTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQ 1276
            YTC    A G  + +  ++ AE P     P+  +
Sbjct: 7534 YTCSVSNALGTVTTTGVLRKAERPSSSPCPDIGE 7567



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 2/71 (2%)

Query: 914  ERVVLTCEL-CRPWAEVRWTKDGEEVVESPALLLQKE-DTVRRLVLPAVQLEDSGEYLCE 971
            + V L C++  +P A+  W+KDG  +  S  +L+       + L +  V  ED G Y C 
Sbjct: 7478 QSVTLACQVSAQPAAQATWSKDGAPLESSSRVLISATLKNFQLLTILVVVAEDLGVYTCS 7537

Query: 972  IDDESASFTVT 982
            + +   + T T
Sbjct: 7538 VSNALGTVTTT 7548



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 29/98 (29%), Positives = 46/98 (46%), Gaps = 11/98 (11%)

Query: 1534 SVRPRQLRVLRPLEDVTISEGGSATFQLELS---QEGVTGEWARGGVQLYPGPKCHIHSD 1590
            + RP  ++V   +EDV    GG+A F+  +    Q  VT  W +  VQL    +     +
Sbjct: 6353 TARPPSMQVT--IEDVQAQTGGTAQFEAIIEGDPQPSVT--WYKDSVQLVDSTRLSQQQE 6408

Query: 1591 GHRHRLVLNGLGLADSG---CVS-FTADSLRCAARLIV 1624
            G  + LVL  +   D+G   C++  T   + C A L+V
Sbjct: 6409 GTTYSLVLRHVASKDAGVYTCLAQNTGGQVLCKAELLV 6446



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 26/95 (27%), Positives = 39/95 (41%), Gaps = 1/95 (1%)

Query: 1725 LRSVSAREGDGATFECTVS-EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE 1783
            +  V A+ G  A FE  +  + + +  W      L    R+  +QEG  + LVL  + ++
Sbjct: 6363 IEDVQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTRLSQQQEGTTYSLVLRHVASK 6422

Query: 1784 DAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREK 1818
            DAG     A       L + E L L     P  EK
Sbjct: 6423 DAGVYTCLAQNTGGQVLCKAELLVLGGDNEPDSEK 6457



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 13/41 (31%), Positives = 23/41 (56%)

Query: 748  TWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFEC 788
            TWYKD  ++ +S  L  + +G  + L+L     +D+G + C
Sbjct: 6389 TWYKDSVQLVDSTRLSQQQEGTTYSLVLRHVASKDAGVYTC 6429



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 817  VHAITSECVMLACEVDREDAP-VRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGG 875
            V A T         ++ +  P V WYKD  ++ +S  +  + EG    LVL      D G
Sbjct: 6366 VQAQTGGTAQFEAIIEGDPQPSVTWYKDSVQLVDSTRLSQQQEGTTYSLVLRHVASKDAG 6425

Query: 876  EFQCVA 881
             + C+A
Sbjct: 6426 VYTCLA 6431


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  461 bits (1185), Expect = e-129
 Identities = 389/1568 (24%), Positives = 676/1568 (43%), Gaps = 73/1568 (4%)

Query: 253   KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
             K   V E + A+F C +    E  + W  +G  ++    +          +L +   Q  
Sbjct: 11493 KDVTVPERRQARFECVLTR--EANVIWS-KGPDIIKSSDKFDIIADGKKHILVINDSQFD 11549

Query: 313   DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA 372
             D G+Y        G+  SA +L V   RL+F  PL+D   +E   A   C++ + ++   
Sbjct: 11550 DEGVYTAEVE---GKKTSA-RLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVV 11605

Query: 373   WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILK 432
             WF+ D +L   R      EG   +L +  +  DD    + +++ +V+ +++ T +  +L+
Sbjct: 11606 WFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDD----ISQIKAQVKELSS-TAQLKVLE 11660

Query: 433   RLPRKLDVLEGENAVLLVE-TLEAGVEG----RWSRDGEEL---PVICQSSSGHMHALVL 484
               P     L  + AV   E TL+  V      +W +DGEE+   P     + G    L +
Sbjct: 11661 ADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKI 11720

Query: 485   PGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPA 544
                  +D GE     G  +T   + V+        P    E+F G      +    P+  
Sbjct: 11721 KKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVH 11780

Query: 545   PETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHV 604
              +    ++L+ Q + +    +     K   + +    +   G+  F+    + + +S   
Sbjct: 11781 GQ----WKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQ----AANAKSAAN 11832

Query: 605   VFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
             +      L+     +  L DV+V++ ++A F  ++S   +   +L G          Q  
Sbjct: 11833 LKVKELPLI----FITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGT---------QEI 11879

Query: 665   PGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRV 724
              G  R+ + + G +H +++ +   +D    + F       S  L I+   +  L+P   V
Sbjct: 11880 TGDDRFELIKDGTKHSMVIKSAAFEDEAKYM-FEAEDKHTSGKLIIEGIRLKFLTPLKDV 11938

Query: 725   SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
               T    E  V T ELS  +    W+K+ Q++  +  + ++ +G+ H +   +  + D+ 
Sbjct: 11939 --TAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTS 11996

Query: 785   EFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDG 844
             +      G+S+   +TV +   +     +      +  + V+L CE+ + DAPV+W+KDG
Sbjct: 11997 QIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYT--GVEKDEVILQCEISKADAPVKWFKDG 12054

Query: 845   QEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSG 904
             +E++ S   V++ +G  R L+L     SD G++ C  G +     + I D    +V P  
Sbjct: 12055 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH 12114

Query: 905   KVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLED 964
              V V      R     E+        W   GE ++++P   +++E  +  LVL   +L+ 
Sbjct: 12115 SVEVMETETAR--FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQ 12172

Query: 965   SGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYK 1024
             +G    +  +  +S  + V    + ++ P  +VT+ A   E     CELS ED PV WY 
Sbjct: 12173 TGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAG--ETATFDCELSYEDIPVEWYL 12230

Query: 1025  DGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHP 1084
              G ++E S+ +V   +G    L L   + ED GE    A D      + V  PP     P
Sbjct: 12231 KGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKP 12290

Query: 1085  AARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQ 1144
                  D          L CEV+   ++V+W+K+G E+  S   ++ A+G  R L +    
Sbjct: 12291 LE---DQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCT 12347

Query: 1145  PEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPV 1204
             PED   Y C+ +    + N+ +  P V+FL   T    L V   E     CELSR  A V
Sbjct: 12348 PEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTD---LQVREKEMARFECELSRENAKV 12404

Query: 1205  VWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE 1264
              W  +G  +++G+  ++ ++G  R+L I          Y+C+   A  +  L+   + A 
Sbjct: 12405 KWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEA- 12463

Query: 1265  PPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQ 1324
                 V     A   V  T    ++LV  +S PG  V WYK  E +   GR ++   G ++
Sbjct: 12464 ----VFTKNLANIEVSETD--TIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKR 12517

Query: 1325  VLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVS 1384
             +L +Q A   DAG Y C  P       V V E L  + +S+   L + EG+ A F C +S
Sbjct: 12518 ILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHE-LAAEFISKPQNLEILEGEKAEFVCSIS 12576

Query: 1385  PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHV 1444
                  V W R+   +  G + ++  +G  R+L ++   L D GT  +  G+   +A L V
Sbjct: 12577 KESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV 12636

Query: 1445  RETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHI 1504
              E +L  +  L+D R +E Q+V    E    GA    +W R  + +   S+  + Q   +
Sbjct: 12637 IE-KLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKA--KWFRNEEAIFDSSKYIILQKDLV 12693

Query: 1505  HRLFIHGVILADQGTYGCESHHDR-----TLARLSVRPRQLRVLRPLEDVTISEGGSATF 1559
             + L I    L DQ  Y     + R     + A L V    LR++ PL+D+   E  S TF
Sbjct: 12694 YTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTF 12753

Query: 1560  QLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCA 1619
               ++++  VT +W + G ++    +     D ++H L +   G  D G    TA   +  
Sbjct: 12754 WCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSV 12813

Query: 1620  ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQAL 1679
             A L++ E P   V    D  VTE D A F C+LS+  A+V W ++G  +    + + +  
Sbjct: 12814 AELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKD 12873

Query: 1680  GTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFE 1739
             G+   L ++ C   D   Y+C V   R    RL V E  V ++   + +    G    F 
Sbjct: 12874 GSIHRLIIKDCRLDDECEYACGV-EDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFL 12932

Query: 1740  CTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLA 1799
               +++ +   +W      +  G + ++  EGK H L + +++  D GE RF A   ++ A
Sbjct: 12933 AELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARA 12992

Query: 1800  LLEVEALP 1807
              LE+ A P
Sbjct: 12993 KLELAAAP 13000



 Score =  439 bits (1128), Expect = e-122
 Identities = 392/1575 (24%), Positives = 667/1575 (42%), Gaps = 85/1575 (5%)

Query: 327   QTLSAVQ---LHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPC 383
             Q L+A+    L VKE  L F  PL+DV   E   A  EC V        W +    +   
Sbjct: 11469 QALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFEC-VLTREANVIWSKGPDIIKSS 11527

Query: 384   RKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRKLD--VL 441
              K++ I +G    L+I+  + DD+G+Y  E+ G+ +T A + V G  LK +    D  V 
Sbjct: 11528 DKFDIIADGKKHILVINDSQFDDEGVYTAEVEGK-KTSARLFVTGIRLKFMSPLEDQTVK 11586

Query: 442   EGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHALVLPGVTREDAGEVTFS 498
             EGE A  + E     +   W ++  +L     +  SS G  H L +  VT +D  ++   
Sbjct: 11587 EGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQ 11646

Query: 499   LGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPF-----IYRL 553
             +    +T  L+V  ++  P     L +     K+ + L  +  +  P   F     I   
Sbjct: 11647 VKELSSTAQLKV--LEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPS 11704

Query: 554   ERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLV 613
              +  + ++   +   I+KA         +  +G+Y   +C         +V     A L+
Sbjct: 11705 PKYSIKADGLRRILKIKKAD--------LKDKGEY---VCDCGTDKTKANVTVE--ARLI 11751

Query: 614   PTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGALRYRI 672
                + + G+E   V+ GE A F ++LS   + G W L G+ L ++ P+ +         I
Sbjct: 11752 KVEKPLYGVE---VFVGETAHFEIELSEPDVHGQWKLKGQPLTAS-PDCE---------I 11798

Query: 673   EQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSE 732
              + G +H LILH  +   +G  V F     + +A L ++E P+  ++P   V +     +
Sbjct: 11799 IEDGKKHILILHNCQLGMTGE-VSFQAANAKSAANLKVKELPLIFITPLSDVKVF--EKD 11855

Query: 733   RVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEG 792
                  CE+SR      W K  Q++   +   +  DG KH +++  A  +D  ++    E 
Sbjct: 11856 EAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAED 11915

Query: 793   VSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDF 852
                   + ++   +  + P + V   A   E  +   E+  ++  V+W+K+ Q +  +  
Sbjct: 11916 KHTSGKLIIEGIRLKFLTPLKDVT--AKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRS 11973

Query: 853   VVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVY-VAAV 911
             V +++EG    +        D  + +  A    +   +T+ +      Y +GK+     V
Sbjct: 11974 VSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDP---YFTGKLQDYTGV 12030

Query: 912   RLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCE 971
               + V+L CE+ +  A V+W KDG+E+  S   +++ +   R L+L      D G+Y C+
Sbjct: 12031 EKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD 12090

Query: 972   IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEE 1031
                +  S  + + +  ++++ P   V ++    E      E+S +D    W   G  + +
Sbjct: 12091 CGTDKTSGKLDIEDREIKLVRPLHSVEVMET--ETARFETEISEDDIHANWKLKGEALLQ 12148

Query: 1032  SEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDL 1091
             +    ++ +G    LVL   + +  G     A +  +   + V      ++ P     D+
Sbjct: 12149 TPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLK---DV 12205

Query: 1092  HFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
                A       CE++     V WY  G ++E SD +   +EG   TLTL   + EDAGE 
Sbjct: 12206 TVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEV 12265

Query: 1152  VCETRHEAITFNVILAEPPVQFLALETTP-SPLCVAPGEPVVLSCELSRAGAPVVWSHNG 1210
                 +      N+ + EPPV+F    T P     V  G   VL CE+SR  A V W  NG
Sbjct: 12266 QLTAKDFKTHANLFVKEPPVEF----TKPLEDQTVEEGATAVLECEVSRENAKVKWFKNG 12321

Query: 1211  RPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVV 1270
               + + +  E+ A+G  R L I    P     YTC +         S  + V  P V  +
Sbjct: 12322 TEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDF----KTSCNLNVVPPHVEFL 12377

Query: 1271  APEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQG 1330
              P     +VR       E    LS     V+W+KDG  +    +  +   GA ++L +  
Sbjct: 12378 RP-LTDLQVREKEMARFEC--ELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINK 12434

Query: 1331  ARSGDAGEYLCDA--PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA 1388
                 D  EY C+    + S +  V  EE +  K    L  + V E D     CEVS P A
Sbjct: 12435 CLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTK---NLANIEVSETDTIKLVCEVSKPGA 12491

Query: 1389  DVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETE 1448
             +V W +    +    + E+   G  RIL ++   L DAG    R  S+ T  ++ V E  
Sbjct: 12492 EVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELA 12551

Query: 1449  LLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLF 1508
               F+ + Q++   EG+         +   +  V+W R  + L    +  +  DG    L 
Sbjct: 12552 AEFISKPQNLEILEGEKAEFVCSISK--ESFPVQWKRDDKTLESGDKYDVIADGKKRVLV 12609

Query: 1509  IHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGV 1568
             +    L D GTY       R  A L+V  + LR++ PL+D  + E     F  E++ EG 
Sbjct: 12610 VKDATLQDMGTYVVMVGAARAAAHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGA 12668

Query: 1569  TGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGC--VSFT---ADSLRCAARLI 1623
               +W R    ++   K  I      + L +    L D     VS T    ++++ AA LI
Sbjct: 12669 KAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLI 12728

Query: 1624  VREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRR 1683
             V E  + IV    D+E  E  + TF C++++    + W K+G  +    R+  +    + 
Sbjct: 12729 VEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKH 12788

Query: 1684  LLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVS 1743
             +L ++ CG  D G Y    G  ++    L + E     +  L   +  E D A F C +S
Sbjct: 12789 MLTIKDCGFPDEGEYIVTAGQDKS-VAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLS 12847

Query: 1744  EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEV 1803
               +   +W   GR ++ G + +  ++G  H L++ + R +D  E        +S A L V
Sbjct: 12848 REKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV 12907

Query: 1804  EALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTH 1863
             E +P+++ R PP++     G   V    +++    V WLR    +  GDK++M S G  H
Sbjct: 12908 EEIPVEIIR-PPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIH 12966

Query: 1864  SLVIHDVRPEDQGTY 1878
              L I D++P DQG Y
Sbjct: 12967 RLQICDIKPRDQGEY 12981



 Score =  394 bits (1013), Expect = e-109
 Identities = 402/1699 (23%), Positives = 685/1699 (40%), Gaps = 129/1699 (7%)

Query: 228   QPPESPPADPDEAPAPVVEPLKCAPKTFWVNE------------GKHAKFRCYVMGKPEP 275
             +P       PDEAP      LK  P  F V E            G  A F C V   P  
Sbjct: 11092 RPGSGGEKPPDEAP--FTYQLKAVPLKF-VKEIKDIILTESEFVGSSAIFECLV--SPST 11146

Query: 276   EIE-WHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
              I  W  +G  +    +     D      L ++  Q  D G Y C  R    +  S  +L
Sbjct: 11147 AITTWMKDGSNIRESPKHRFIADGKDR-KLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL 11205

Query: 335   HVKEPRLRFTRPLQD----VEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIE 390
              V+E  +RF + L++    V+G+      L C++ N      W R+D +++   K  +I 
Sbjct: 11206 VVEELPVRFVKTLEEEVTVVKGQP---LYLSCEL-NKERDVVW-RKDGKIV-VEKPGRIV 11259

Query: 391   EGTV---RRLIIHRLKADDDGIYLCEMRGRVRTVANVTVK-----GPILKRLPRKLDVLE 442
              G +   R L I+     D G Y   +        +  VK        L +  R   V  
Sbjct: 11260 PGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKP 11319

Query: 443   GENAVLLVETLEAGVEGRWSRDGEELPVICQSSS-----GHMHALVLPGVTREDAGEVTF 497
                A+   +  +     +W +  +E+P      +     G+   L +     ED  E   
Sbjct: 11320 KGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAV 11379

Query: 498   SLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLER-- 555
              +   R                    A++  G +   LL  KP E       IY  E   
Sbjct: 11380 EIEGKRYP------------------AKLTLGEREVELL--KPIEDVT----IYEKESAS 11415

Query: 556   --QEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLV 613
                E+   D    + ++       P   + +EG  RF         ++  V++  + + +
Sbjct: 11416 FDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQ-ALNAI 11474

Query: 614   PTARL---------VAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
              TA L            L+DV V +   A F   L+      W    + +KS++      
Sbjct: 11475 TTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTREANVIWSKGPDIIKSSD------ 11528

Query: 665   PGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRV 724
                 ++ I   G +H L+++  +  D G        G + SA L +    +  +SP +  
Sbjct: 11529 ----KFDIIADGKKHILVINDSQFDDEGVYTA-EVEGKKTSARLFVTGIRLKFMSPLE-- 11581

Query: 725   SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
               T    E     CELS       W+K+  K+  S  +++  +G+ H+L + E  + D  
Sbjct: 11582 DQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDIS 11641

Query: 785   EFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVH---AITSECVMLACEVDREDAPVRWY 841
             + + + + +S+   + V +      DP   V +H   A+  + + L CEV + D PV+W+
Sbjct: 11642 QIKAQVKELSSTAQLKVLE-----ADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWF 11695

Query: 842   KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
             KDG+E+  S    ++ +G  R L +      D GE+ C  G +     VT   V + ++ 
Sbjct: 11696 KDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVT---VEARLIK 11752

Query: 902   PSGKVYVAAVRL-ERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV 960
                 +Y   V + E      EL  P    +W   G+ +  SP   + ++     L+L   
Sbjct: 11753 VEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNC 11812

Query: 961   QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV 1020
             QL  +GE   +  +  ++  + V E P+  I P  +V +     +     CE+SRE    
Sbjct: 11813 QLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVF--EKDEAKFECEVSREPKTF 11870

Query: 1021  RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER 1080
             RW K   E+   +   L +DG +  +V+ +A  ED  +++ +A D      + +     +
Sbjct: 11871 RWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLK 11930

Query: 1081  IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL 1140
              + P     D+            E++    +V+W+K+   +  + ++ +  EG T ++T 
Sbjct: 11931 FLTPLK---DVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITF 11987

Query: 1141  PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA 1200
                  +D  +   E    +    + + E    F               + V+L CE+S+A
Sbjct: 11988 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTG---KLQDYTGVEKDEVILQCEISKA 12044

Query: 1201  GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV 1260
              APV W  +G+ ++  +   + A+G +R+L ++ A  +  G YTC      G    S  +
Sbjct: 12045 DAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDC----GTDKTSGKL 12100

Query: 1261  QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA 1320
              + +  +++V P      V  T     E    +S       W   GE L      ++++ 
Sbjct: 12101 DIEDREIKLVRP-LHSVEVMETETARFE--TEISEDDIHANWKLKGEALLQTPDCEIKEE 12157

Query: 1321  GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR 1380
             G    L +   R    G     A        + V +P ++ L+  L  +TV  G+ ATF 
Sbjct: 12158 GKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRV-KPRVIGLLRPLKDVTVTAGETATFD 12216

Query: 1381  CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA 1440
             CE+S  D  V W   G  + P  +V     G    LTLR  +L DAG V L A    T A
Sbjct: 12217 CELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHA 12276

Query: 1441  RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ 1500
              L V+E  + F + L+D   EEG    LE E  R  A   V+W + G  +    +  +  
Sbjct: 12277 NLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENA--KVKWFKNGTEILKSKKYEIVA 12334

Query: 1501  DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ 1560
             DG + +L IH     D  TY C++   +T   L+V P  +  LRPL D+ + E   A F+
Sbjct: 12335 DGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFE 12394

Query: 1561  LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA 1620
              ELS+E    +W + G ++  G K  I S G    LV+N   L D    S    + R + 
Sbjct: 12395 CELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSG 12454

Query: 1621  RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG 1680
              L V E      +   ++EV+E DT    CE+S+  A+V W K    +  + R  +   G
Sbjct: 12455 MLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEG 12514

Query: 1681  TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC 1740
              +R+L ++     DAG Y+C + ++R    ++ V E     +S+ +++   EG+ A F C
Sbjct: 12515 RKRILVIQNAHLEDAGNYNCRLPSSRTDG-KVKVHELAAEFISKPQNLEILEGEKAEFVC 12573

Query: 1741  TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLA- 1799
             ++S+     +W+   + L  G +  +  +GKK +LV+ +   +D G      G A++ A 
Sbjct: 12574 SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH 12633

Query: 1800  LLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSH 1859
             L  +E L + +   P ++  V   +  V    V+  G    W R    +    KY +   
Sbjct: 12634 LTVIEKLRIVV---PLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQK 12690

Query: 1860  GPTHSLVIHDVRPEDQGTY 1878
                ++L I D   +DQ  Y
Sbjct: 12691 DLVYTLRIRDAHLDDQANY 12709



 Score =  385 bits (988), Expect = e-106
 Identities = 420/1813 (23%), Positives = 709/1813 (39%), Gaps = 111/1813 (6%)

Query: 105   PASDPELQPAERP-------LPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEP 157
             P S  E  P E P       +P     E   + LT   S++V  G+  +  C        
Sbjct: 11093 PGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILT--ESEFV--GSSAIFECLVSPSTAI 11148

Query: 158   TLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGH 217
             T  W KDG  + E          P       G    L I+  +L D+G Y C  R  +  
Sbjct: 11149 TT-WMKDGSNIRE---------SPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKE 11198

Query: 218   AQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEI 277
               + A L V + P              V  +K   +   V +G+     C +    E ++
Sbjct: 11199 KTSTAKLVVEELP--------------VRFVKTLEEEVTVVKGQPLYLSCEL--NKERDV 11242

Query: 278   EWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK 337
              W  +G+ ++    R++         L +      D G Y     N+     S+    V+
Sbjct: 11243 VWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVE 11302

Query: 338   EPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFR--EDQRLLPCRKYEQIEEGTVR 395
               R    +P++D   +  G A+  C +        WF+  ++    P  K E + +G   
Sbjct: 11303 VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHL 11362

Query: 396   RLIIHRLKADDDGIYLCEMRGRVRTVANVTV---KGPILKRLPRKLDVLEGENAVLLVET 452
              L I     +D   Y  E+ G+ R  A +T+   +  +LK +   + + E E+A    E 
Sbjct: 11363 YLKIKNAMPEDIAEYAVEIEGK-RYPAKLTLGEREVELLKPI-EDVTIYEKESASFDAEI 11420

Query: 453   LEAGVEGRWSRDGEEL---PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLR 509
              EA + G+W   GE L   P     + G    L L  V  + AGEV +   N+ TT +L 
Sbjct: 11421 SEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT 11480

Query: 510   VKCVK--HSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCF 567
             VK ++   + P   +     +  +   +LT        E   I+      + S D     
Sbjct: 11481 VKEIELDFAVPLKDVTVPERRQARFECVLT-------REANVIWSKGPDIIKSSDKFDII 11533

Query: 568   SIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQV 627
             +  K   + +       EG Y      V G   S  +   G        + ++ LED  V
Sbjct: 11534 ADGKKHILVINDSQFDDEGVYT---AEVEGKKTSARLFVTGIR-----LKFMSPLEDQTV 11585

Query: 628   YDGEDAVFSLDLS-TIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAV 686
              +GE A F  +LS   +   WF N  +L ++              I  +G  H+L +  V
Sbjct: 11586 KEGETATFVCELSHEKMHVVWFKNDAKLHTSRT----------VLISSEGKTHKLEMKEV 11635

Query: 687   KHQDSGALVGFSCPGVQDSAALTIQES-PVHILSPQDRVSLTFTTSERVVLTCELSRVDF 745
                D   +       +  +A L + E+ P   +   D+   T    + + L CE+S+ D 
Sbjct: 11636 TLDDISQIKA-QVKELSSTAQLKVLEADPYFTVKLHDK---TAVEKDEITLKCEVSK-DV 11690

Query: 746   PATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPP 805
             P  W+KDG+++  S    +K DG +  L + +A ++D GE+ C          VTV+   
Sbjct: 11691 PVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARL 11750

Query: 806   VHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLV 865
             + +  P   V V     E      E+   D   +W   GQ +  S    +  +G    L+
Sbjct: 11751 IKVEKPLYGVEV--FVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILI 11808

Query: 866   LPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRP 925
             L   Q    GE    A +  +   + + ++    + P   V V     +     CE+ R 
Sbjct: 11809 LHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKV--FEKDEAKFECEVSRE 11866

Query: 926   WAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTE 985
                 RW K  +E+       L K+ T   +V+ +   ED  +Y+ E +D+  S  + +  
Sbjct: 11867 PKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEG 11926

Query: 986   PPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCR 1045
               ++ + P  +VT  A   E  V   ELS ++  V+W+K+   +  + ++ ++ +G    
Sbjct: 11927 IRLKFLTPLKDVT--AKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHS 11984

Query: 1046  LVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEV 1105
             +       +D  +   +A   S+   +TV    E   +   +  D        V L+CE+
Sbjct: 11985 ITFKDLSIDDTSQIRVEAMGMSSEAKLTVL---EGDPYFTGKLQDYTGVEKDEVILQCEI 12041

Query: 1106  APAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVI 1165
             + A + V+W+KDG E++ S    + A+G  R L L  A   D G+Y C+   +  +  + 
Sbjct: 12042 SKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLD 12101

Query: 1166  LAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEG 1225
             + +  ++   L      + V   E      E+S       W   G  + +    E+  EG
Sbjct: 12102 IEDREIK---LVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEG 12158

Query: 1226  PRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGG 1285
                 L +        G      G    A ++  +  +   P RV+        V  T G 
Sbjct: 12159 KIHSLVLHNCRLDQTG------GVDFQAANVKSSAHLRVKP-RVIGLLRPLKDVTVTAGE 12211

Query: 1286  DLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQ 1345
                    LS    PV WY  G++L    +V     G    L ++  +  DAGE    A  
Sbjct: 12212 TATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 12271

Query: 1346  DSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQV 1405
                   + V+EP  V+    L   TV EG  A   CEVS  +A V W +NG  +    + 
Sbjct: 12272 FKTHANLFVKEPP-VEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKY 12330

Query: 1406  EMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQD 1465
             E+  +G  R L +  C   D  T T  A    TS  L+V    + FLR L D++  E + 
Sbjct: 12331 EIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEM 12390

Query: 1466  VCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESH 1525
                E E  R  A   V+W + G  +    +  +   G +  L I+  +L D+  Y CE  
Sbjct: 12391 ARFECELSRENAK--VKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVR 12448

Query: 1526  HDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKC 1585
               RT   L+V   +    + L ++ +SE  +     E+S+ G    W +G  ++    + 
Sbjct: 12449 TARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRY 12508

Query: 1586  HIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDT 1645
              I ++G +  LV+    L D+G  +    S R   ++ V E+    +  P +LE+ EG+ 
Sbjct: 12509 EILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEK 12568

Query: 1646  ATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTA 1705
             A F C +S+    V W++D   L    +  + A G +R+L ++     D GTY   VG A
Sbjct: 12569 AEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAA 12628

Query: 1706  RAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVR 1765
             RA    LTV E+ + ++  L+    +E     F C V+      +W      +   ++  
Sbjct: 12629 RAA-AHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYI 12686

Query: 1766  IRQEGKKHILVLSELRAEDAGE-----VRFQAGPAQSLALLEVEALPLQMCRHPPREKTV 1820
             I Q+   + L + +   +D           +    +S A L VE   L++   P ++   
Sbjct: 12687 ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIV-EPLKDIET 12745

Query: 1821  LVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC 1880
             +  +       V+R    + W + G E+   ++   R     H L I D    D+G Y  
Sbjct: 12746 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 12805

Query: 1881  QAGQDSTHTRLLV 1893
              AGQD +   LL+
Sbjct: 12806 TAGQDKSVAELLI 12818



 Score =  380 bits (975), Expect = e-105
 Identities = 317/1277 (24%), Positives = 523/1277 (40%), Gaps = 41/1277 (3%)

Query: 622   LEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRL 681
             L D    + ++     ++S  +   WF +GEE+  +           +Y I+  GL+  L
Sbjct: 11669 LHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSP----------KYSIKADGLRRIL 11718

Query: 682   ILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELS 741
              +     +D G  V   C   +  A +T++   + +  P   V +     E      ELS
Sbjct: 11719 KIKKADLKDKGEYV-CDCGTDKTKANVTVEARLIKVEKPLYGVEVF--VGETAHFEIELS 11775

Query: 742   RVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTV 801
               D    W   GQ +  S    +  DG+KH LIL   ++  +GE   +     +   + V
Sbjct: 11776 EPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKV 11835

Query: 802   QDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPH 861
             ++ P+  + P   V V     +     CEV RE    RW K  QE+   D   L  +G  
Sbjct: 11836 KELPLIFITPLSDVKV--FEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTK 11893

Query: 862   RRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCE 921
               +V+ +    D  ++   A D+     + I  +    + P   V   A   E  V T E
Sbjct: 11894 HSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDV--TAKEKESAVFTVE 11951

Query: 922   LCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTV 981
             L      V+W K+ + +  + ++ +Q E     +    + ++D+ +   E    S+   +
Sbjct: 11952 LSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKL 12011

Query: 982   TVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDG 1041
             TV E          + T   V  + V+L CE+S+ DAPV+W+KDG E++ S+  V++ DG
Sbjct: 12012 TVLEGDPYFTGKLQDYT--GVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADG 12069

Query: 1042  PRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVEL 1101
              +  L+L  A   D G++ CD G D     + +     ++V P   S+++      R E 
Sbjct: 12070 KKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPL-HSVEVMETETARFET 12128

Query: 1102  RCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAIT 1161
               E++       W   G  +  +   ++  EG   +L L + + +  G    +  +   +
Sbjct: 12129 --EISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSS 12186

Query: 1162  FNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLEL 1221
              + +  +P V  + L      + V  GE     CELS    PV W   G+ ++  + +  
Sbjct: 12187 AH-LRVKPRV--IGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVP 12243

Query: 1222  HAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRS 1281
              +EG    L ++      AG     +       +L     V EPPV    P   QT    
Sbjct: 12244 RSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLF----VKEPPVEFTKPLEDQT---V 12296

Query: 1282  TPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
               G    L   +S     V+W+K+G  +    + ++   G  + L +      D   Y C
Sbjct: 12297 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 12356

Query: 1342  DAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTP 1401
             DA        ++V  P  V+ +  LT L V E + A F CE+S  +A V W ++GA +  
Sbjct: 12357 DAKDFKTSCNLNVVPPH-VEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKK 12415

Query: 1402  GPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAE 1461
             G + ++   G+ RIL +  C L D    +    +  TS  L V E E +F + L ++   
Sbjct: 12416 GKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVS 12475

Query: 1462  EGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYG 1521
             E   + L  E  + GA   V W +G + +    R  +  +G    L I    L D G Y 
Sbjct: 12476 ETDTIKLVCEVSKPGAE--VIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYN 12533

Query: 1522  CESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYP 1581
             C     RT  ++ V       +   +++ I EG  A F   +S+E    +W R    L  
Sbjct: 12534 CRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLES 12593

Query: 1582  GPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVT 1641
             G K  + +DG +  LV+    L D G       + R AA L V E  + IV    D  V 
Sbjct: 12594 GDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVK 12652

Query: 1642  EGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA 1701
             E     F CE++   A   W ++  A+  S +  +        L++R     D   Y+ +
Sbjct: 12653 EQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVS 12712

Query: 1702  VGTARAGPVR----LTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRP 1757
             +   R   V+    L V E  + ++  L+ +   E    TF C V+ +  T +W   G  
Sbjct: 12713 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 12772

Query: 1758  LRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPRE 1817
             +    RV  R +  KH+L + +    D GE    AG  +S+A L +   P +   H   +
Sbjct: 12773 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHL-ED 12831

Query: 1818  KTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGT 1877
             +TV     AV    +SR   +V W R G E+  G KY+    G  H L+I D R +D+  
Sbjct: 12832 QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECE 12891

Query: 1878  YCCQAGQDSTHTRLLVE 1894
             Y C      +  RL VE
Sbjct: 12892 YACGVEDRKSRARLFVE 12908



 Score =  333 bits (855), Expect = 7e-91
 Identities = 462/1993 (23%), Positives = 771/1993 (38%), Gaps = 236/1993 (11%)

Query: 10   SPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
            +PP F + P PV  + G++  L+C + G PP  VVW K  +Q+  S++    +   +  L
Sbjct: 6456 APPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSL 6515

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPV 129
             +     +D G Y C+A N  G    + +V   EPP    +L                  
Sbjct: 6516 HILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTS-------------- 6561

Query: 130  FLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPG 189
                      L G  V L     G    ++ W KD   +    +++  +     A     
Sbjct: 6562 ---------TLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIA----- 6607

Query: 190  ASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLK 249
                L++ +    +SG Y+C  +N  G  +  A+L V +P            A ++E   
Sbjct: 6608 ---TLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEP------------ARIIEK-- 6650

Query: 250  CAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPD-RRRLMYRDRDGGFVLKVLY 308
              P+   V  G      C V G PE   +W  +GR L  D +  + + ++     LK+  
Sbjct: 6651 --PEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVAS--LKIPC 6706

Query: 309  CQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRL--RFTRPLQDVEGREHGIAVLECKVPN 366
             +  D+GLY    +NS G++   V +HV +  +   F R L+DV        VLEC+V  
Sbjct: 6707 AEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSG 6766

Query: 367  SR-IPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLC---EMRGRVRTVA 422
            S  I   WF++   ++   K +      V  L +  L+  D GIY C    + G     A
Sbjct: 6767 SAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSA 6826

Query: 423  NVTVKGP-ILKRLPRKLDVLEGENAVLLVETLEAGVEG------RWSRDGEELPV--ICQ 473
             +TV+ P   ++ P  ++VL G +      T  + + G      +W +   EL     C 
Sbjct: 6827 VLTVQEPPSFEQTPDSVEVLPGMSL-----TFTSVIRGTPPFKVKWFKGSRELVPGESCN 6881

Query: 474  SS-SGHMHALVLPGVTREDAGE----VTFSLGNSRTTTLLRVK----CVKHSPP-----G 519
             S    +  L L  V   ++G+    VT   G++  TT L VK     VK         G
Sbjct: 6882 ISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETG 6941

Query: 520  PPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPG 579
             PI+ E        + ++W   E        Y + + E  S         EK+  +E+  
Sbjct: 6942 SPIVLEATYTGTPPISVSWIKDE--------YLISQSERCS-----ITMTEKSTILEILE 6988

Query: 580  DCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFS--L 637
              +     Y   I   +G       +      ++     +  LE V+   GE A     +
Sbjct: 6989 STIEDYAQYSCLIENEAGQD-----ICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKV 7043

Query: 638  DLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGF 697
            D +  I+ +W+    +L+S          A  Y+++ K     L+++ V H D G    +
Sbjct: 7044 DGTPEIRISWYKEHTKLRS----------APAYKMQFKNNVASLVINKVDHSDVGE---Y 7090

Query: 698  SCPG------VQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD-FPATWY 750
            SC        V  SA L I+   +     +    +  T    V   C ++  +    +WY
Sbjct: 7091 SCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWY 7150

Query: 751  KDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECR------TEGVSAFFGVTVQD- 803
            KDG  +++   L          L + +      G++ C       T   SA   ++  + 
Sbjct: 7151 KDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEV 7210

Query: 804  PPVHIVDPREHVFVHAITSECVMLACEVDREDAPVR--WYKDGQEVEESD---FVVLENE 858
            PP   + P   V V     E     C V    AP++  W KD +E+         ++EN 
Sbjct: 7211 PPFFDLKP---VSVDLALGESGTFKCHVTGT-APIKITWAKDNREIRPGGNYKMTLVENT 7266

Query: 859  GPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVL 918
                 L +      D G++ C A +            S+ +       ++  +   R+V 
Sbjct: 7267 AT---LTVLKVGKGDAGQYTCYASNIAGK-----DSCSAQLGVQEPPRFIKKLEPSRIVK 7318

Query: 919  TCELCR--------PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLC 970
              E  R        P  +V W KD  E+ ES    +   D+V  L +  + +EDSG+Y C
Sbjct: 7319 QDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTC 7378

Query: 971  EIDDE----SASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDA-PVRWYKD 1025
            E  +     S+S ++ V EPP+    P    TL    +    L CEL       V WYKD
Sbjct: 7379 EAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVH---LECELQGTPPFHVSWYKD 7435

Query: 1026 GLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC----DAGDDSAFFTVTVTAPPERI 1081
              E+   +   +  +     + +      D GE+ C    D G D+   ++ + APP  +
Sbjct: 7436 KRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFV 7495

Query: 1082 VHPAARSLDLHFGAPGRVELRCEVAPAGS-QVRWYKD-GLEVEASDALQLGAEGPTRTLT 1139
                 +  D+       V+L+  +  A    V W+KD G  V  SD + +       TL 
Sbjct: 7496 ----KKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQ 7551

Query: 1140 LPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSR 1199
                +P +AG+Y C+ +++A           ++   +   P  + V  G+   L C +  
Sbjct: 7552 FSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTV-- 7609

Query: 1200 AGAPVV---WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSL 1256
            AG P +   W  +G+ +      ++        L I    P+ +G+Y+ +     G  S 
Sbjct: 7610 AGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSC 7669

Query: 1257 SFTVQVAEPPVRVVAPEAAQTRVRSTPG-GDLELVVHLSGPGGP---VRWYKDGERLASQ 1312
            + ++QV++  V    P +   +++ T G     +V+     G P   V W+ +G  ++S 
Sbjct: 7670 TASLQVSDRTV----PPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSG 7725

Query: 1313 GRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQ----DSRIFLVSVEEPLLVKLVSELTP 1368
             + Q         L V      D+G+Y C A      D     ++V EP     V +  P
Sbjct: 7726 RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREP--PSFVQKPDP 7783

Query: 1369 LTVHEGDDATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAG 1427
            + V  G + TF   V   P   V+W +  + + PG +  ++   S   L L       +G
Sbjct: 7784 MDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSG 7843

Query: 1428 TVTL----RAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLE-VETGRVGAAGAVR 1482
              T      AG  + +  L+++     F++RL D   E+G+ + LE   TG    +  V 
Sbjct: 7844 EYTCIVSNEAGKASCTTHLYIK-APAKFVKRLNDYSIEKGKPLILEGTFTGTPPIS--VT 7900

Query: 1483 WVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRV 1542
            W + G  +    R ++        L I    + D G Y C   +       S    Q+ +
Sbjct: 7901 WKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSA---QILI 7957

Query: 1543 LRP------LEDVTISEGGSATFQLELSQEGVTG-EWARGGVQLYPGPKCHIHSDGHRHR 1595
            L P      LE V +S G SA+ Q +L+     G  W +G  +L P     +H   +   
Sbjct: 7958 LEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVAT 8017

Query: 1596 LVLNGLGLADSGCVSFTADS----LRCAARLIVRE--VPVTIVRGPHDLEVTEGDTATFE 1649
            LV N + + DSG     A++    +  +  L V+E  +P +  R   D++ T G    F+
Sbjct: 8018 LVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFD 8077

Query: 1650 CELSQALA-DVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA----VGT 1704
            C +S +    V+W KDG  L  SP ++   L     L + +   S AG YSC     +G+
Sbjct: 8078 CAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGS 8137

Query: 1705 ARAGPVRLTVRERTVAVLSELR--SVSAREGDGATFECTVSEVETTG-RWELGGRPLRPG 1761
            A +   RL + E       ++R   V A  G+ A FEC V+  +     W    R +R G
Sbjct: 8138 ASSS-ARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSG 8196

Query: 1762 ARVRIRQ-EGKKHILVLSELRAEDAGEVRFQA----GPAQSLALLEVEA--LPLQMCRHP 1814
             + +I   E   H+ VL ++   D+G+    A    G     A L ++   +P    +  
Sbjct: 8197 GKYQISYLENSAHLTVL-KVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRL 8255

Query: 1815 PREKTVLVGRRAVLEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPE 1873
                    G    LE  V+ S    V W +   E+ P    E+     T  L +      
Sbjct: 8256 SETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMN 8315

Query: 1874 DQGTYCCQAGQDS 1886
            D G Y C+   D+
Sbjct: 8316 DAGLYTCKVSNDA 8328



 Score =  327 bits (837), Expect = 9e-89
 Identities = 255/852 (29%), Positives = 387/852 (45%), Gaps = 25/852 (2%)

Query: 1052  QPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVEL-RCEVAPAGS 1110
             +P  GGE       D A FT  + A P + V      +       G   +  C V+P+ +
Sbjct: 11092 RPGSGGE----KPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTA 11147

Query: 1111  QVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETR----HEAITFNVIL 1166
                W KDG  +  S   +  A+G  R L +   Q  DAGEY C  R     +  T  +++
Sbjct: 11148 ITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVV 11207

Query: 1167  AEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAE-G 1225
              E PV+F+  +T    + V  G+P+ LSCEL++    VVW  +G+ V E  G  +    G
Sbjct: 11208 EELPVRFV--KTLEEEVTVVKGQPLYLSCELNKE-RDVVWRKDGKIVVEKPGRIVPGVIG 11264

Query: 1226  PRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGG 1285
               R L I  A    AG YT     A      S  V+V E     +        V+  P G
Sbjct: 11265 LMRALTINDADDTDAGTYTVTVENANNL-ECSSCVKVVEVIRDWLVKPIRDQHVK--PKG 11321

Query: 1286  DLELVVHLSGPGGPVRWYKDGERLASQ--GRVQLEQAGARQVLRVQGARSGDAGEYLCDA 1343
                    ++     ++W+K  + + ++   + ++ + G    L+++ A   D  EY  + 
Sbjct: 11322 TAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEI 11381

Query: 1344  PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGP 1403
                     +++ E   V+L+  +  +T++E + A+F  E+S  D    W   G ++ P P
Sbjct: 11382 EGKRYPAKLTLGERE-VELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSP 11440

Query: 1404  QVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEG 1463
               E+   G  R LTL   +L  AG V  +A +  T+A L V+E EL F   L+DV   E 
Sbjct: 11441 TCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPER 11500

Query: 1464  QDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCE 1523
             +    E    R      V W +G   +    +  +  DG  H L I+     D+G Y  E
Sbjct: 11501 RQARFECVLTR---EANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAE 11557

Query: 1524  SHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGP 1583
                 +T ARL V   +L+ + PLED T+ EG +ATF  ELS E +   W +   +L+   
Sbjct: 11558 VEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSR 11617

Query: 1584  KCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEG 1643
                I S+G  H+L +  + L D   +      L   A+L V E         HD    E 
Sbjct: 11618 TVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEK 11677

Query: 1644  DTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVG 1703
             D  T +CE+S+ +  V W KDG  + PSP+  ++A G RR+L++++    D G Y C  G
Sbjct: 11678 DEITLKCEVSKDVP-VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCG 11736

Query: 1704  TARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGAR 1763
             T +     +TV  R + V   L  V    G+ A FE  +SE +  G+W+L G+PL     
Sbjct: 11737 TDKT-KANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPD 11795

Query: 1764  VRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVG 1823
               I ++GKKHIL+L   +    GEV FQA  A+S A L+V+ LPL     P  +  V   
Sbjct: 11796 CEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFIT-PLSDVKVFEK 11854

Query: 1824  RRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAG 1883
               A  E  VSR      WL+   E+   D++E+   G  HS+VI     ED+  Y  +A 
Sbjct: 11855 DEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAE 11914

Query: 1884  QDSTHTRLLVEG 1895
                T  +L++EG
Sbjct: 11915 DKHTSGKLIIEG 11926



 Score =  322 bits (825), Expect = 2e-87
 Identities = 449/1979 (22%), Positives = 756/1979 (38%), Gaps = 205/1979 (10%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            PP F+     V  V G  A L+C V G P   + W K   +L ++             L+
Sbjct: 7019 PPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLV 7078

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            +     +D G Y C+A N+ G A A++AV V++            R LP        P F
Sbjct: 7079 INKVDHSDVGEYSCKADNSVG-AVASSAVLVIKA-----------RKLP--------PFF 7118

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGA 190
                +      G  V   CR  G     + W KDG+ L +  D++   LQ     +    
Sbjct: 7119 ARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKD--DAN---LQTSFVHN---- 7169

Query: 191  SLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKC 250
               L+IL       G Y C A N  G A + A L + +  E PP   D  P  V   L  
Sbjct: 7170 VATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEH-EVPPFF-DLKPVSVDLAL-- 7225

Query: 251  APKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQ 310
                     G+   F+C+V G    +I W  + R + P     M    +    L VL   
Sbjct: 7226 ---------GESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTA-TLTVLKVG 7275

Query: 311  AKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVE-GREHGIAVLECKVPNS-R 368
              D G Y C A N AG+   + QL V+EP  RF + L+     ++      ECK+  S  
Sbjct: 7276 KGDAGQYTCYASNIAGKDSCSAQLGVQEPP-RFIKKLEPSRIVKQDEFTRYECKIGGSPE 7334

Query: 369  IPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTV-- 426
            I   W++++  +    K+      +V  L +H L  +D G Y CE      + ++ T   
Sbjct: 7335 IKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLK 7394

Query: 427  --KGPILKRLPRKLDVLEGENAVLLVET-------LEAGVEGRWSRDGEELPVICQSSSG 477
              + PI ++ P  ++ L+G +  L  E        +    + R  R G++  ++ ++   
Sbjct: 7395 VKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLT 7454

Query: 478  HMHALVLPGVTREDAGEVTFSLGNS-RTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLL 536
             +H L    V   D GE      N   + T +    +K  P     L+++       V L
Sbjct: 7455 SIHIL---NVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQL 7511

Query: 537  TWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVS 596
                    P +   ++ + + V   D I     E    ++       + G Y  +I   +
Sbjct: 7512 QTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDA 7571

Query: 597  GHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI--IQGTWFLNGEEL 654
            G           +  ++  A +V   E ++V  G+       ++    +   WF +G+EL
Sbjct: 7572 GMQEC-----FATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKEL 7626

Query: 655  KSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGAL-VGFSCPGVQDSAALTIQES 713
             S+           +Y+I        L +  V   DSG        P  +DS   ++Q S
Sbjct: 7627 TSDN----------KYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS 7676

Query: 714  PVHILSPQDRVSLTFT---TSERVVLTCEL-SRVDFPATWYKDGQKVEESELLVVKMDGR 769
                + P     L  T   +   VV+ C++        +W+ +G ++         +   
Sbjct: 7677 D-RTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDN 7735

Query: 770  KHRLILPEAKVQDSGEFECRTEGVSAF----FGVTVQDPPVHIVDPREHVFVHAITSECV 825
               L +   +  DSG++ C    ++        +TV++PP  +  P     +  +T   V
Sbjct: 7736 TCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDP---MDVLTGTNV 7792

Query: 826  MLACEVDREDA-PVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDE 884
                 V       V W+K   E+   D   +  E     L L     S  GE+ C+  +E
Sbjct: 7793 TFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNE 7852

Query: 885  CAYFTVTITDVSSWIVYPSGKV-----YVAAVRLERVVLTCELCRPWAEVRWTKDGEEVV 939
                + T      +I  P+  V     Y        ++       P   V W K+G  V 
Sbjct: 7853 AGKASCT---THLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVT 7909

Query: 940  ESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD----ESASFTVTVTEPPVRIIYPRD 995
             S    +   +    L +P+  +ED+G+Y C I++    +S S  + + EPP    Y   
Sbjct: 7910 PSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPP----YFVK 7965

Query: 996  EVTLIAVTL-ECVVLMCELS-REDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQP 1053
            ++  + V++ +   L C+L+   +  V WYK   ++  +    +        LV      
Sbjct: 7966 QLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDI 8025

Query: 1054 EDGGEFVCDAGDD------SAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAP 1107
             D GE++C A +       S F TV     P        R +    G P  V   C ++ 
Sbjct: 8026 NDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQL-RDVQETVGLP--VVFDCAIS- 8081

Query: 1108 AGSQ---VRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHE----AI 1160
             GS+   V WYKDG  ++ S  +Q      T TL +       AG+Y C   +     + 
Sbjct: 8082 -GSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASS 8140

Query: 1161 TFNVILAE---PPVQFLALETTPSPLCVAPGEPVVLSCELSRAGA-PVVWSHNGRPVQEG 1216
            +  +IL E   PP   + L    +P+    GE     C ++      V W+ + R ++ G
Sbjct: 8141 SARLILTEGKNPPFFDIRL----APVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSG 8196

Query: 1217 EGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQ 1276
               ++        L +       +G YTC +    G  S +  + + E  +     +   
Sbjct: 8197 GKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLS 8256

Query: 1277 TRVRSTPGGDLELVVHLSGPGG-PVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGD 1335
              V  T G   +L   ++G     V WYK+   +      ++       VL+V+ A   D
Sbjct: 8257 ETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMND 8316

Query: 1336 AGEYLCDAPQDSRIFL----VSVEEPLLVKLVSE-LTPLTVHEGDDATFRCEVSPPDA-D 1389
            AG Y C    D+   L    + ++EP    +  + LTP+TV EG+     C V   +   
Sbjct: 8317 AGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIR 8376

Query: 1390 VTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVR 1445
            + WL+ G  + P  +   +    + +L LR     D+G    +A    GS  T +++ ++
Sbjct: 8377 IQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIK 8436

Query: 1446 ET--------------ELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGG-QPL 1490
            +                L F+   Q +R  E        + G       V+W +G  + L
Sbjct: 8437 DKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPN-VKWTKGKWRQL 8495

Query: 1491 PHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSV------RPRQLRV-- 1542
                R+ + Q G   +L I      D G Y C + ++      +V      R +Q ++  
Sbjct: 8496 NQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEG 8555

Query: 1543 -LRPLEDVT--ISEGGSATFQLELSQ----------------EGVTGEWARGGVQLYPGP 1583
             LR +   T  + +G     ++++ +                 G+T    RG +Q +   
Sbjct: 8556 DLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITD--FRGLLQAFELL 8613

Query: 1584 KCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEG 1643
            K     +   HRL +  +  ++     F         RL   E PVT+++   +  V + 
Sbjct: 8614 KQS--QEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTE-PVTLIKDIENQTVLKD 8670

Query: 1644 DTATFECELSQALADV--TWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA 1701
            + A FE ++     ++  +W K    L PS +  +   G R  L+++ C   D G Y   
Sbjct: 8671 NDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLV 8730

Query: 1702 VGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPG 1761
             G   A   +LTV E   A    L+ V+ +EG   T  C  S       W   GR L+P 
Sbjct: 8731 CGPHIAS-AKLTVIEP--AWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQ 8787

Query: 1762 ARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVL 1821
             R +   E K H L ++++RAED G+   +    ++ A L +EA P+Q  +   R + ++
Sbjct: 8788 GRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTK---RIQNIV 8844

Query: 1822 VG--RRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTY 1878
            V   + A  E  VS     V W +   EL    KY  R+ G  H + IH+V P+D+G Y
Sbjct: 8845 VSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVY 8903



 Score =  315 bits (807), Expect = 3e-85
 Identities = 253/996 (25%), Positives = 429/996 (43%), Gaps = 47/996 (4%)

Query: 917   VLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEI---- 972
             +  C +    A   W KDG  + ESP      +   R+L +  VQL D+GEY C +    
Sbjct: 11137 IFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGN 11196

Query: 973   DDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDG-LEVEE 1031
              +++++  + V E PVR +   +E   + V  + + L CEL++E   V W KDG + VE+
Sbjct: 11197 KEKTSTAKLVVEELPVRFVKTLEEEVTV-VKGQPLYLSCELNKE-RDVVWRKDGKIVVEK 11254

Query: 1032  SEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGD----DSAFFTVTVTAPPERIVHPAAR 1087
                +V    G    L +  A   D G +     +    + +     V    + +V P   
Sbjct: 11255 PGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR- 11313

Query: 1088  SLDLHFGAPGRVELRCEVAPAGSQVRWYK--DGLEVEASDALQLGAEGPTRTLTLPHAQP 1145
               D H    G     C++A     ++W+K  D +  E +D  ++  +G    L + +A P
Sbjct: 11314 --DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMP 11371

Query: 1146  EDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVV 1205
             ED  EY  E   +     + L E  V+ L        + +   E      E+S A  P  
Sbjct: 11372 EDIAEYAVEIEGKRYPAKLTLGEREVELL---KPIEDVTIYEKESASFDAEISEADIPGQ 11428

Query: 1206  WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAG--LYTCQSGAAPGAPSL-SFTVQV 1262
             W   G  ++     E+ AEG +R L +       AG  LY   +       ++    +  
Sbjct: 11429 WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDF 11488

Query: 1263  AEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGA 1322
             A P   V  PE  Q R       +  ++           W K  + + S  +  +   G 
Sbjct: 11489 AVPLKDVTVPERRQARFECVLTREANVI-----------WSKGPDIIKSSDKFDIIADGK 11537

Query: 1323  RQVLRVQGARSGDAGEYLCDA---PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATF 1379
             + +L +  ++  D G Y  +       +R+F+  +     +K +S L   TV EG+ ATF
Sbjct: 11538 KHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIR----LKFMSPLEDQTVKEGETATF 11593

Query: 1380  RCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATS 1439
              CE+S     V W +N A +     V ++  G +  L ++   L D   +  +    +++
Sbjct: 11594 VCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSST 11653

Query: 1440  ARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMA 1499
             A+L V E +  F  +L D  A E  ++ L+ E   V     V+W + G+ +    + S+ 
Sbjct: 11654 AQLKVLEADPYFTVKLHDKTAVEKDEITLKCE---VSKDVPVKWFKDGEEIVPSPKYSIK 11710

Query: 1500  QDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATF 1559
              DG    L I    L D+G Y C+   D+T A ++V  R ++V +PL  V +  G +A F
Sbjct: 11711 ADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHF 11770

Query: 1560  QLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCA 1619
             ++ELS+  V G+W   G  L   P C I  DG +H L+L+   L  +G VSF A + + A
Sbjct: 11771 EIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSA 11830

Query: 1620  ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQAL 1679
             A L V+E+P+  +    D++V E D A FECE+S+      W K    +T   R  L   
Sbjct: 11831 ANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKD 11890

Query: 1680  GTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFE 1739
             GT+  + ++     D   Y            +L +    +  L+ L+ V+A+E + A F 
Sbjct: 11891 GTKHSMVIKSAAFEDEAKYMFEAEDKHTSG-KLIIEGIRLKFLTPLKDVTAKEKESAVFT 11949

Query: 1740  CTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA-GPAQSL 1798
               +S      +W    + L     V ++ EGK H +   +L  +D  ++R +A G +   
Sbjct: 11950 VELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEA 12009

Query: 1799  ALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRS 1858
              L  +E  P    +   ++ T +     +L+  +S++   V W ++G E+ P     +++
Sbjct: 12010 KLTVLEGDPYFTGK--LQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKA 12067

Query: 1859  HGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVE 1894
              G    L++      D G Y C  G D T  +L +E
Sbjct: 12068 DGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIE 12103



 Score =  310 bits (794), Expect = 9e-84
 Identities = 404/1760 (22%), Positives = 689/1760 (39%), Gaps = 205/1760 (11%)

Query: 233  PPADPDEAPAPVVEPLKCAPKTF------WVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL 286
            P   PD+     + P   APK F       V +G  A FR  V+GKP+PE EW+  G  +
Sbjct: 2062 PTFKPDKIE---LSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKI 2118

Query: 287  LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRL-RFTR 345
                R   Y   D    L +    A+D    +  A N AG+T S   L V+  +L  FT+
Sbjct: 2119 ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQ 2178

Query: 346  PLQDVEGREHG-IAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKA 404
             LQDV  +E   +A  EC+     +   W+++   +    KY    +  V  L I  +  
Sbjct: 2179 ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDT 2238

Query: 405  DDDGIYLCEM--RGRVRTVANVTVKGPILKRLP--RKLDVLEGENAVLLVETLEAGVEGR 460
             D   Y C +     V+T A + V+G +++ +   + ++V E  +  L        +EG+
Sbjct: 2239 SDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGK 2298

Query: 461  WSRDGEEL----PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHS 516
            W  +  EL         S  G  + L +  VT+ED GE +F +   +TT  L++K     
Sbjct: 2299 WYHNDVELKSNGKYTITSRRGRQN-LTVKDVTKEDQGEYSFVIDGKKTTCKLKMK----- 2352

Query: 517  PPGPPILAEMFKGHK----NTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKA 572
             P P  + +     K    + V L  K    + E   ++  + QEV   D +     +++
Sbjct: 2353 -PRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEG--VWMKDGQEVQPSDRVHIVIDKQS 2409

Query: 573  GAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGED 632
              + +        G+Y F I  + G   S  V  +    + P       L+DV V +G  
Sbjct: 2410 HMLLIEDMTKEDAGNYSFTIPAL-GLSTSGRVSVYSVDVITP-------LKDVNVIEGTK 2461

Query: 633  AVFSLDLST--IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQD 690
            AV    +S   +    W+LN E++K ++          R +   KG + RL+++     D
Sbjct: 2462 AVLECKVSVPDVTSVKWYLNDEQIKPDD----------RVQAIVKGTKQRLVINRTHASD 2511

Query: 691  SG---ALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPA 747
             G    +VG     V+ +  L++++  + I   +D   LT T ++ VV   ELS      
Sbjct: 2512 EGPYKLIVG----RVETNCNLSVEKIKI-IRGLRD---LTCTETQNVVFEVELSHSGIDV 2563

Query: 748  TWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEF-----ECRTEGVSAFFGVTVQ 802
             W    ++++ S    ++  G+ ++L +      D G++     E  T G     G  + 
Sbjct: 2564 LWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS 2623

Query: 803  DPPVH--IVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGP 860
             P     + + +E VF            CEV   D+   W +DG+ +  ++ +  E++G 
Sbjct: 2624 KPLTDQTVAESQEAVF-----------ECEVANPDSKGEWLRDGKHLPLTNNIRSESDGH 2672

Query: 861  HRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKV-----YVAAVRLER 915
             RRL++ AT+  D GE+          + V  +  S+ +   + K+      +     + 
Sbjct: 2673 KRRLIIAATKLDDIGEYT---------YKVATSKTSAKLKVEAVKIKKTLKNLTVTETQD 2723

Query: 916  VVLTCELCRPWAE-VRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD 974
             V T EL  P  + V+W K+G  +  +    +  + T+  L +    + D   Y   +  
Sbjct: 2724 AVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGR 2783

Query: 975  ESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEA 1034
              AS  + V    V+II    +VT  A+    V     +S +  PV+W+   +E++ S+ 
Sbjct: 2784 LGASARLHV--ETVKIIKKPKDVT--ALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK 2839

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDAGD---DSAFF--TVTVTAPPERIVHPAARSL 1089
              L  +    +L+L    P D GE+    G     +  F  T+ +T   + I  P  ++ 
Sbjct: 2840 HRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKT- 2898

Query: 1090 DLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAG 1149
                         CEV+       W K+G+E+E S+  ++  +G    L + +   ED+ 
Sbjct: 2899 ---------ASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2949

Query: 1150 EY--VCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWS 1207
            EY  VC     + T  V     P+   ++      +     + +     ++  G    W 
Sbjct: 2950 EYTFVCGNDQVSATLTV----TPIMITSM---LKDINAEEKDTITFEVTVNYEGISYKWL 3002

Query: 1208 HNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE--- 1264
             NG  ++  +  ++  +     L I+      A  YT  +G A    +L    +  E   
Sbjct: 3003 KNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRK 3062

Query: 1265 --PPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGA 1322
                ++V+  + A                 +S P   V+W KD + L    R+++++   
Sbjct: 3063 HIKDIKVLEKKRAM------------FECEVSEPDITVQWMKDDQELQITDRIKIQKEKY 3110

Query: 1323 RQVLRVQGARSGDAGEYLCDA---PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATF 1379
               L +   R  DAG+Y   A      +++F+    E   V++ S    + V E   A  
Sbjct: 3111 VHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFV----EGRDVRIRSIKKEVQVIEKQRAVV 3166

Query: 1380 RCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRI--LTLRGCQLGDAGTVTLRAGSTA 1437
              EV+  D D  W ++G  +    Q         RI  + +   +  DAG  T  AG   
Sbjct: 3167 EFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNR 3226

Query: 1438 TSARLHVRETE-LLFLRRLQDVRAEEGQDV-CLEVETGRVGAAGAVRWVRGGQPLPHDSR 1495
            +S  L+V   E    L+ LQ V  + G+      V +GR      + W +  Q L    +
Sbjct: 3227 SSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGR--PQPKISWYKEEQLLSTGFK 3284

Query: 1496 LSMAQDGHIHRLFIHGVILADQGTYGCESHHD----RTLARLSVRPRQL----------- 1540
                 DG  + L +      D   Y CE+ +D     T A LSV   ++           
Sbjct: 3285 CKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3344

Query: 1541 -RVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLN 1599
              ++ PL+D   SEG  A FQ  +S   +   W     ++ P     +      ++L + 
Sbjct: 3345 PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIA 3404

Query: 1600 GLGLADSGCVSFTADS----LRCAARL------------IVREVPVTIVRGP------HD 1637
                 D G  +F A +    +   A L            I +E+ + +   P        
Sbjct: 3405 EAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEP 3464

Query: 1638 LEVTEGDTATFECELSQA-LADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAG 1696
            LEV  G  A F CE+  A      W K G  +  S +  +++      L++ R    D G
Sbjct: 3465 LEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCG 3524

Query: 1697 TYSCAVGTARAG---PVRLTVRER-TVAVLSELRSVSAREGDGATFECTVS---EVETTG 1749
             Y+C              LTV E      LS  +S++   G  A F CTV+    +ET  
Sbjct: 3525 EYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETI- 3583

Query: 1750 RWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQ 1809
             W+  G  L P    RI     KHIL LS L  +D G    +A       + + E + + 
Sbjct: 3584 -WQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIID 3642

Query: 1810 MCRHPPREKTV--LVGRRAVLEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLV 1866
                    + V   + ++  LE  V       V W ++G +L PG  Y++       +L 
Sbjct: 3643 KPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLE 3702

Query: 1867 IHDVRPEDQGTYCCQAGQDS 1886
            I   + +D GTY C A  ++
Sbjct: 3703 IPLAKLKDSGTYVCTASNEA 3722



 Score =  299 bits (766), Expect = 2e-80
 Identities = 459/1989 (23%), Positives = 777/1989 (39%), Gaps = 251/1989 (12%)

Query: 20   PVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDA 79
            P+ V  G    L+C V G P   V W K G+ L +S++  F        L + +    DA
Sbjct: 5712 PMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDA 5771

Query: 80   GVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWV 139
            G Y  + +N  G++   A V V            ++R +P        P F    ++   
Sbjct: 5772 GTYTFQVQNNVGKSSCTAVVDV------------SDRAVP--------PSFTRRLKNTGG 5811

Query: 140  LRGAEVVLTCRAGGLPEPTLYW--EKDGMALDEVWDSSHFALQPGRAEDGPGASLALRIL 197
            + GA  +L C+  G    ++ W  EK  +     + ++                  L++ 
Sbjct: 5812 VLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTF-----------SDNVCTLQLN 5860

Query: 198  AARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWV 257
            +    D G Y C A N  G  +  A+L V +PP S   +P        EPL+  P     
Sbjct: 5861 SLDSSDMGNYTCVAANVAGSDECRAVLTVQEPP-SFVKEP--------EPLEVLP----- 5906

Query: 258  NEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLY 317
              GK+  F   + G P  ++ W    R L+   R  +Y + D    L++        G Y
Sbjct: 5907 --GKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFE-DTVAELELFNIDISQSGEY 5963

Query: 318  VCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNS-RIPTAWFRE 376
             C   N+AGQ     +L VKEP   F + L D         +LE     +  I   W ++
Sbjct: 5964 TCVVSNNAGQASCTTRLFVKEP-AAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKD 6022

Query: 377  DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRV-RTVANV---TVKGPILK 432
               +    K   +       L I      D G Y CE+     R V      T++ P   
Sbjct: 6023 GFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFV 6082

Query: 433  RLPRKLDVLEGENAVLLVETL-EAGVEGRWSRDGEEL---PVICQSSSGHMHALVLPGVT 488
                 L+   G++  L  +      +   W +   +L   P      + ++  LV   V 
Sbjct: 6083 TELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVN 6142

Query: 489  REDAGEVTF----SLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNT----VLLTWKP 540
              D+GE T     S+G + + T+ R++        PP  A   K  + T    V LT + 
Sbjct: 6143 INDSGEYTCKAENSIGTASSKTVFRIQ----ERQLPPSFARQLKDIEQTVGLPVTLTCRL 6198

Query: 541  PEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR 600
               AP     YR +   +  ++ +Q   ++    +++    +   G Y    C+ S    
Sbjct: 6199 NGSAPIQVCWYR-DGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYS---CSAS---- 6250

Query: 601  SPHVVFHGSAHLVPTARLVAGLEDVQ-----VYDGEDAVFSLDLSTI--IQGTWFLNGEE 653
            +P      SA L       +   D++     V  GE A F   ++    ++ TW  + +E
Sbjct: 6251 NPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKE 6310

Query: 654  LKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD------SAA 707
            ++         PG   Y I   G    L +  V   DSG    ++C    D      SA 
Sbjct: 6311 IR---------PGG-NYTITCVGNTPHLRILKVGKGDSGQ---YTCQATNDVGKDMCSAQ 6357

Query: 708  LTIQESPVHILSPQDRVSLTFTTSERVVLTCELS-RVDFPATWYKDGQKVEESELLVVKM 766
            L+++E P  +   +   S      E + L C++S   +   +W+++  ++ ES    +  
Sbjct: 6358 LSVKEPPKFVKKLE--ASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSF 6415

Query: 767  DGRKHRLILPEAKVQDSGEFECRTEG----VSAFFGVTVQDPPVHIVDPREHVFVHAITS 822
                  L + EA  +DSG++ C         S    +TV+ PPV    P     V A+  
Sbjct: 6416 INSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSP---VGALKG 6472

Query: 823  ECVMLACEVD-REDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQC-- 879
              V+L CE+       V W KD ++V  S    + ++     L +   + SD GE+ C  
Sbjct: 6473 SDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKA 6532

Query: 880  ---VAGDECA---------YFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWA 927
               V  D C+          F   ++D S+ I          AV L  +V   E  +P  
Sbjct: 6533 TNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLI--------GDAVELRAIV---EGFQP-I 6580

Query: 928  EVRWTKD-GEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDES----ASFTVT 982
             V W KD GE + ES    +   D +  L L + +  +SG+Y+C+I +++     S  +T
Sbjct: 6581 SVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLT 6640

Query: 983  VTEPPVRIIYPRDEVTLIA---VTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLER 1039
            V E P RII   + +T+       LECVV        +   +W+KDG E+       +  
Sbjct: 6641 VLE-PARIIEKPEPMTVTTGNPFALECVV----TGTPELSAKWFKDGRELSADSKHHITF 6695

Query: 1040 DGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTA-PPERIVHPA--ARSLDLHFGAP 1096
                  L +P A+  D G +  +  +       TV+    +RIV P+   +  D++    
Sbjct: 6696 INKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILG 6755

Query: 1097 GRVELRCEVA-PAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCET 1155
              V L C V+  A   V W++DG E+ +    Q        TL L   +P D G Y C  
Sbjct: 6756 ASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVA 6815

Query: 1156 RHEA----ITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP---VVWSH 1208
             + A     +  + + EPP    + E TP  + V PG  +  +  +   G P   V W  
Sbjct: 6816 ANVAGSDECSAVLTVQEPP----SFEQTPDSVEVLPGMSLTFTSVI--RGTPPFKVKWFK 6869

Query: 1209 NGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPP-- 1266
              R +  GE   +  E     L +    P  +G Y+C      G+ S +  + V EP   
Sbjct: 6870 GSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATF 6929

Query: 1267 VRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGARQV 1325
            V+ +A  + +T      G  + L    +G P   V W KD   ++   R  +       +
Sbjct: 6930 VKRLADFSVET------GSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTI 6983

Query: 1326 LRVQGARSGDAGEYLC----DAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRC 1381
            L +  +   D  +Y C    +A QD    LVSV EP     +  L  +    G+ AT +C
Sbjct: 6984 LEILESTIEDYAQYSCLIENEAGQDICEALVSVLEP--PYFIEPLEHVEAVIGEPATLQC 7041

Query: 1382 EV-SPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRA----GST 1436
            +V   P+  ++W +    +   P  +M    +   L +      D G  + +A    G+ 
Sbjct: 7042 KVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAV 7101

Query: 1437 ATSARLHVRETEL--LFLRRLQDVRAEEGQDVCLEVETGRVGAAG--AVRWVRGGQPLPH 1492
            A+SA L ++  +L   F R+L+DV    G  V  E    R+  +    V W + G  L  
Sbjct: 7102 ASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFEC---RINGSEPLQVSWYKDGVLLKD 7158

Query: 1493 DSRLSMAQDGHIHRLFIHGVILADQ---GTYGCESHHD----RTLARLSVRPRQLRVLRP 1545
            D+ L   Q   +H +    ++  DQ   G Y C + +      + A+L +   ++     
Sbjct: 7159 DANL---QTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFD 7215

Query: 1546 LEDVTI--SEGGSATFQLELSQEG-VTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLG 1602
            L+ V++  + G S TF+  ++    +   WA+   ++ PG    +    +   L +  +G
Sbjct: 7216 LKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVG 7275

Query: 1603 LADSGCVSFTADSL----RCAARLIVREVPVTIVRGPHDLEVTEGDTATFECEL-SQALA 1657
              D+G  +  A ++     C+A+L V+E P  I +      V + +   +EC++      
Sbjct: 7276 KGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEI 7335

Query: 1658 DVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC----AVGTARAGPVRLT 1713
             V W KD   +  S + R+  + +  +L++      D+G Y+C    A G+A +    L 
Sbjct: 7336 KVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSA-SSSTSLK 7394

Query: 1714 VRERTVAVLSELRSVSAREGDGATFECTVSEVETTG----RWELGGRPLRPGARVRIRQE 1769
            V+E  +    +   +   +G     EC   E++ T      W    R LR G + +I  E
Sbjct: 7395 VKEPPI-FRKKPHPIETLKGADVHLEC---ELQGTPPFHVSWYKDKRELRSGKKYKIMSE 7450

Query: 1770 GKKHILVLSELRAEDAGEVRFQA----GPAQSLALLEVEALPLQMCRHPPR------EKT 1819
                 + +  + A D GE + +A    G    +  + ++A        PPR      + +
Sbjct: 7451 NFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKA--------PPRFVKKLSDIS 7502

Query: 1820 VLVGRRAVLEVTVSRSGG-HVCWLREGAELC-PGDKYEMRSHGPTHSLVIHDVRPEDQGT 1877
             +VG+   L+ T+  +    V W ++  E+    D   +       +L    V P + G 
Sbjct: 7503 TVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGK 7562

Query: 1878 YCCQAGQDS 1886
            Y CQ   D+
Sbjct: 7563 YTCQIKNDA 7571



 Score =  298 bits (763), Expect = 3e-80
 Identities = 428/1996 (21%), Positives = 767/1996 (38%), Gaps = 238/1996 (11%)

Query: 14   FLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTA 73
            F +  + ++V+    A  +C V  EP   V W K  Q+L  ++R+    +   H LL+ +
Sbjct: 3060 FRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPS 3118

Query: 74   ALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTG 133
               +DAG Y       AG   + A + V                       EG  V +  
Sbjct: 3119 TRMSDAGKYTV----VAGGNVSTAKLFV-----------------------EGRDVRIRS 3151

Query: 134  PRSQ-WVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASL 192
             + +  V+     V+        +   +W KDG+ ++      H  +   R         
Sbjct: 3152 IKKEVQVIEKQRAVVEFEVNE-DDVDAHWYKDGIEINFQVQERHKYVVERRIH------- 3203

Query: 193  ALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAP 252
             + I   R  D+G Y   A    G  ++   L V+ P           P  V++ L+  P
Sbjct: 3204 RMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAP----------EPPQVLQELQ--P 3247

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
             T  V  GK A+F   + G+P+P+I W+ E   LL    +  +      + L ++    +
Sbjct: 3248 VT--VQSGKPARFCAVISGRPQPKISWYKE-EQLLSTGFKCKFLHDGQEYTLLLIEAFPE 3304

Query: 313  DRGLYVCAARNSAGQTLSAVQLHVKEPRL------------RFTRPLQDVEGREHGIAVL 360
            D  +Y C A+N  G   ++  L V+ P +                PLQD    E   A  
Sbjct: 3305 DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF 3364

Query: 361  ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIY---LCEMRGR 417
            +C+V  + +  +W+ +D+++ P R +   +     +L I     +D+G Y        G+
Sbjct: 3365 QCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3424

Query: 418  VRTVANVTVK--------------------GPILKRLPRKLDVLEGENAVLLVETLEA-G 456
            V + AN++++                     P++KR    L+V  G  A    E   A  
Sbjct: 3425 VSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPN 3484

Query: 457  VEGRWSRDGEEL---PVICQSSSGHMHALVLPGVTREDAGEVTFSLGN-----SRTTTLL 508
            V  +W + G E+         SS ++ +L +      D GE T    N     S T TL 
Sbjct: 3485 VRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLT 3544

Query: 509  RVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVG----SEDWI 564
              +    +    P     F G     + T         TP I  + +++      S +W 
Sbjct: 3545 VTEAYPPTFLSRPKSLTTFVGKAAKFICT------VTGTPVIETIWQKDGAALSPSPNW- 3597

Query: 565  QCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLED 624
            +    E    +E+    +   G Y  +     G       +      ++     +  LE 
Sbjct: 3598 RISDAENKHILELSNLTIQDRGVYSCKASNKFGAD-----ICQAELIIIDKPHFIKELEP 3652

Query: 625  VQ--VYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLI 682
            VQ  +         +D    +  TW  +G++L          P    Y+I  +     L 
Sbjct: 3653 VQSAINKKVHLECQVDEDRKVTVTWSKDGQKL----------PPGKDYKICFEDKIATLE 3702

Query: 683  LHAVKHQDSGALVGFSCPGVQD------SAALTIQESPVHILSPQDRVSLTFTTSERVVL 736
            +   K +DSG  V   C    +      SA +T++E P  +       S      E   L
Sbjct: 3703 IPLAKLKDSGTYV---CTASNEAGSSSCSATVTVREPPSFVKKVDP--SYLMLPGESARL 3757

Query: 737  TCELSRVD-FPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECR----TE 791
             C+L        TW+K+ +++ ES  + +     +  L + + KV+DSG + C       
Sbjct: 3758 HCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVG 3817

Query: 792  GVSAFFGVTVQDPP--VHIVDPREHVFVHAITSECVMLACEVDREDA-PVRWYKDGQEVE 848
              S    + +++PP  +  ++P +      +     +L CEV       + W+KD +++ 
Sbjct: 3818 SDSCSTEIVIKEPPSFIKTLEPAD-----IVRGTNALLQCEVSGTGPFEISWFKDKKQIR 3872

Query: 849  ESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDE---CAYFTVTITDVSSWIVYPSGK 905
             S    L ++     L + +   +D GE++CV  +E   C      +       V     
Sbjct: 3873 SSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDD 3932

Query: 906  VYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDS 965
            +     +   +        P   V W K  E + E   + +   + V  L++P VQ+   
Sbjct: 3933 LIALGGQTVTLQAAVRGSEP-ISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFG 3991

Query: 966  GEYLCEIDDESASFTVT---VTEPPVRIIYPRDEVTLIA---VTLECVVLMCELSREDAP 1019
            G+Y C  ++E+ S T     + + P +II   + + + A    TLE  V        +  
Sbjct: 3992 GKYTCLAENEAGSQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTV----AGTPELK 4047

Query: 1020 VRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC----DAGDDSAFFTVTVT 1075
             +WYKDG  +  S+   +       +L   +A+  D G++      + G  S   T TV 
Sbjct: 4048 PKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVL 4107

Query: 1076 APPERIVHP----AARSLDLHFGAPGRVELRCEVAPA-GSQVRWYKDGLEVEASDALQLG 1130
               +R + P      R++D      G   L C++A +   +V W+KDG E+ ASD  ++ 
Sbjct: 4108 ---DRDIAPFFTKPLRNVDSVVN--GTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIA 4162

Query: 1131 AEGPTRTLTLPHAQPEDAGEYVCETRHEAITFN----VILAEPPVQFLALETTPSPLCVA 1186
                T +L +      DAG + C   +   + +    +I+ EPP    +  T P    V 
Sbjct: 4163 FVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPP----SFVTKPGSKDVL 4218

Query: 1187 PGEPVVLSCELSRAGAPVV--WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYT 1244
            PG  V L     +   P+   W    + +  G    +  E     L +     + +G YT
Sbjct: 4219 PGSAVCLKSTF-QGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYT 4277

Query: 1245 CQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWY 1303
            C+     G    S  + V EP   V   E +Q   +   G   +L   ++G P   + W+
Sbjct: 4278 CKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKK---GDATQLACKVTGTPPIKITWF 4334

Query: 1304 KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQD------SRIFLVSVEEP 1357
             +   +    + ++    +  VLR+      D+GEY+C+A  +      S I +V  E P
Sbjct: 4335 ANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVK-ESP 4393

Query: 1358 LLVKLVSELTPLTVHEGDDATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRIL 1416
               K   E  P+ V +  D     EV+  P  ++TW ++  ++  G + +         L
Sbjct: 4394 YFTK---EFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSL 4450

Query: 1417 TLRGCQLGDAG----TVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVET 1472
             +      DAG     VT   GS+  SAR+ +RE    F+++++   +  G     +  T
Sbjct: 4451 QILKFVAADAGEYQCRVTNEVGSSICSARVTLREPP-SFIKKIESTSSLRGGTAAFQA-T 4508

Query: 1473 GRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHD----R 1528
             +      V W++    +  D  + M  + ++  L++ G+ +   G Y C++ +D    R
Sbjct: 4509 LKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQR 4568

Query: 1529 TLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELS-QEGVTGEWARGGVQLYPGPKCHI 1587
              A LSV+     +      + +++G  AT Q++ S  + +T +W + G +L  G K  I
Sbjct: 4569 CSALLSVK-EPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKI 4627

Query: 1588 HSDGHRHRLVLNGLGLADSGCVSFTADS----LRCAARLIVRE--VPVTIVRGPHDLEVT 1641
                    L +      DSG  +F   +      C AR+ V +  +P +  +    ++  
Sbjct: 4628 SVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSI 4687

Query: 1642 EGDTATFECELSQA-LADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC 1700
            +G     EC ++ +    + W KD   ++ S + +         L++ +   +D+GTY+C
Sbjct: 4688 KGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTC 4747

Query: 1701 AVGTARAG----PVRLTVRERTVAVLSELRSVSAREGDGATFECTV-SEVETTGRWELGG 1755
            +  T +AG       LTV+E    V  + +S           +  V      T +W    
Sbjct: 4748 S-ATNKAGHNQCSGHLTVKEPPYFV-EKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDN 4805

Query: 1756 RPLRPGARVRIRQEGKKHILVLSELRAEDAG----EVRFQAGPAQSLALLEVEALPLQMC 1811
            + L  GA   + ++     L L   +A D+G    ++    G A S A L V+  P Q  
Sbjct: 4806 KELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKE-PPQFI 4864

Query: 1812 RHPPREKTVLVGRRAVLEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLVIHDV 1870
            + P     +  G+    E  ++ +    V W  +G E+    K+ +       +  I   
Sbjct: 4865 KKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGA 4924

Query: 1871 RPEDQGTYCCQAGQDS 1886
            R E+ GTY C+A  D+
Sbjct: 4925 RVENSGTYVCEARNDA 4940



 Score =  292 bits (747), Expect = 2e-78
 Identities = 442/1993 (22%), Positives = 753/1993 (37%), Gaps = 233/1993 (11%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            PP FL  P+ +    G  A+  C V G P    +W+K G  L+ S          +H L 
Sbjct: 3550 PPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILE 3609

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            L+     D GVY C+A N  G     A + +++ P    EL+P +  +            
Sbjct: 3610 LSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAI------------ 3657

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRA-----E 185
                         +V L C+     + T+ W KDG  L            PG+      E
Sbjct: 3658 -----------NKKVHLECQVDEDRKVTVTWSKDGQKLP-----------PGKDYKICFE 3695

Query: 186  DGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVV 245
            D       L I  A+L DSG YVC A N  G +   A + V +PP               
Sbjct: 3696 D---KIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSF------------- 3739

Query: 246  EPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLK 305
              +K    ++ +  G+ A+  C + G P  ++ W    + L       MY       +L 
Sbjct: 3740 --VKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEA-ILD 3796

Query: 306  VLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVP 365
            +   + +D G Y C A N  G    + ++ +KEP   F + L+  +      A+L+C+V 
Sbjct: 3797 ITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPP-SFIKTLEPADIVRGTNALLQCEVS 3855

Query: 366  NSR-IPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANV 424
             +     +WF++ +++   +KY    + ++  L I    + D G Y C +   V     +
Sbjct: 3856 GTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCM 3915

Query: 425  TVKGPILKRLP---RKLDVLEGENAVLLVETLEAGVEGR------WSRDGE---ELPVIC 472
                 +LK  P   +K+D L       +  TL+A V G       W +  E   E   I 
Sbjct: 3916 ATH--LLKEPPTFVKKVDDLIALGGQTV--TLQAAVRGSEPISVTWMKGQEVIREDGKIK 3971

Query: 473  QSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKN 532
             S S  +  L++P V      +++F     + T L   +    +  G  I+ E  K  + 
Sbjct: 3972 MSFSNGVAVLIIPDV------QISFG---GKYTCLAENEAGSQTSVGELIVKEPAKIIER 4022

Query: 533  TVLLTWKPPEPA---------PET-PFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCV 582
              L+     +PA         PE  P  Y+  R  V S+ +   F    A       +  
Sbjct: 4023 AELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELH 4082

Query: 583  PSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI 642
             S G Y F I    G              + P         D  V         +  S  
Sbjct: 4083 DS-GQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLP 4141

Query: 643  IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP-- 700
            ++ +WF +G+E+ +++          RYRI        L +  V   D+G    F+C   
Sbjct: 4142 MRVSWFKDGKEIAASD----------RYRIAFVEGTASLEIIRVDMNDAG---NFTCRAT 4188

Query: 701  ---GVQDSA-ALTIQESPVHILSPQDR-------VSLTFTTSERVVLTCELSRVDFPATW 749
               G +DS+ AL +QE P  +  P  +       V L  T      LT           W
Sbjct: 4189 NSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIR---------W 4239

Query: 750  YKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE----GVSAFFGVTVQDPP 805
            +K  +++       +  +  +  L L   K  DSG + C+      GV     + V++P 
Sbjct: 4240 FKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPA 4299

Query: 806  VHI--VDPREHVFVHAITSECVMLACEVD-REDAPVRWYKDGQEVEESDFVVLENEGPHR 862
              +  ++P + +       +   LAC+V       + W+ + +E++ES    +       
Sbjct: 4300 TFVEKLEPSQLLK----KGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTA 4355

Query: 863  RLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVY-------VAAVRLER 915
             L L      D GE+ C A +E        +D  S IV      Y       +  ++   
Sbjct: 4356 VLRLTDVGIEDSGEYMCEAQNEAG------SDHCSSIVIVKESPYFTKEFKPIEVLKEYD 4409

Query: 916  VVLTCELC-RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD 974
            V+L  E+   P  E+ W KD   +          +D +  L +      D+GEY C + +
Sbjct: 4410 VMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTN 4469

Query: 975  ESASFT----VTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP--VRWYKDGLE 1028
            E  S      VT+ EPP  I       +L   T      +    +   P  V W KD  E
Sbjct: 4470 EVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATL----KGSLPITVTWLKDSDE 4525

Query: 1029 VEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAF--FTVTVTAPPERIVHPAA 1086
            + E + + +  +     L L   + +  G++VC A +D+     +  ++      +   A
Sbjct: 4526 ITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEA 4585

Query: 1087 RSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPE 1146
             S+D+  G P  ++++          +W+KDG E+      ++        L +   + +
Sbjct: 4586 VSIDVTQGDPATLQVKFS-GTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKK 4644

Query: 1147 DAGEYVCETRHEA------ITFNVI-LAEPPVQFLALETTPSPLCVAPGEPVVLSCELSR 1199
            D+GEY  E +++          NV+ L  PP     L+   S      G  + L C ++ 
Sbjct: 4645 DSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDS----IKGSFIDLECIVAG 4700

Query: 1200 AGA-PVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSF 1258
            +    + W  + + +   E  +         L I       +G YTC +    G    S 
Sbjct: 4701 SHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSG 4760

Query: 1259 TVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGG-PVRWYKDGERLASQGRVQL 1317
             + V EPP  V  P++        P   ++L   + G     ++W+KD + L S     +
Sbjct: 4761 HLTVKEPPYFVEKPQSQDVN----PNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSV 4816

Query: 1318 EQAGARQVLRVQGARSGDAGEYLCDAPQD-----SRIFLVSVEEPLLVKLVSELTPLTVH 1372
             +      L +  A++ D+G Y+C    D     S+  L   E P  +K  S +  L + 
Sbjct: 4817 WKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPV--LVLR 4874

Query: 1373 EGDDATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTL 1431
             G   TF C+++  P   V+W  +G  +T   +  ++         + G ++ ++GT   
Sbjct: 4875 NGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVC 4934

Query: 1432 RA----GSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVE-TGRVGAAGAVRWVRG 1486
             A    G+ + S  L V+E    F+R L+ V   +  DV LE E TG       V W++ 
Sbjct: 4935 EARNDAGTASCSIELKVKEPPT-FIRELKPVEVVKYSDVELECEVTGT--PPFEVTWLKN 4991

Query: 1487 GQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVR---PRQLRVL 1543
             + +    + ++     +  L I     +D G Y C   ++      S R         +
Sbjct: 4992 NREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFI 5051

Query: 1544 RPLEDVTISEGGSATFQLELS-QEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLG 1602
            + +E+ T     SATFQ  ++    ++  W +    L      +I        L +  + 
Sbjct: 5052 KKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVD 5111

Query: 1603 LADSGCVSFTADSL----RCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALA- 1657
               SG  +  A +     RC A L+V+E P  IV     ++VTE D  T EC ++     
Sbjct: 5112 NGHSGRYTCQAKNESGVERCYAFLLVQE-PAQIVEKAKSVDVTEKDPMTLECVVAGTPEL 5170

Query: 1658 DVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGT---ARAGPVRLTV 1714
             V W KDG  + PS    +         +++     D+G Y+  V     + +    L V
Sbjct: 5171 KVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV 5230

Query: 1715 RERTV--AVLSELRSVSAREGDGATFECTVS-EVETTGRWELGGRPLRPGARVRIRQEGK 1771
             ++ +  +   +L  +    G     EC VS  +  + +W   G+ +   A+ R+    +
Sbjct: 5231 LDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHER 5290

Query: 1772 KHILVLSELRAEDAG----EVRFQAGPAQSLALLEVEALPLQMCRHPPREKTV---LVGR 1824
               L ++ L  ED      +V   AG      +L V+  P  + + P R++ +    V  
Sbjct: 5291 SVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVK-PGRQQAIPDSTVEF 5349

Query: 1825 RAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC---- 1880
            +A+L+ T       + W ++  EL  G K  +   G T  L ++ V     G Y C    
Sbjct: 5350 KAILKGTPPFK---IKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTN 5406

Query: 1881 QAGQDSTHTRLLV 1893
              G DS  T LLV
Sbjct: 5407 DVGSDSCTTMLLV 5419



 Score =  291 bits (746), Expect = 3e-78
 Identities = 426/1910 (22%), Positives = 711/1910 (37%), Gaps = 212/1910 (11%)

Query: 7    DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE 66
            D+  PP F+R  + V  + GA   L+C V G  P  V W + G ++ +  +         
Sbjct: 6736 DRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENV 6795

Query: 67   HGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEG 126
              L L+   P+D G+Y C A N AG    +A +TV EPP+                    
Sbjct: 6796 CTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPS-------------------- 6835

Query: 127  APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
               F   P S  VL G  +  T    G P   + W K    L    +S + +L+    E 
Sbjct: 6836 ---FEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSREL-VPGESCNISLEDFVTE- 6890

Query: 187  GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
                   L +   +  +SG Y C   N  G A     L V +            PA  V+
Sbjct: 6891 -------LELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKE------------PATFVK 6931

Query: 247  PLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKV 306
             L      F V  G          G P   + W  +   L+    R      +   +L++
Sbjct: 6932 RL----ADFSVETGSPIVLEATYTGTPPISVSW-IKDEYLISQSERCSITMTEKSTILEI 6986

Query: 307  LYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
            L    +D   Y C   N AGQ +    + V EP   F  PL+ VE      A L+CKV  
Sbjct: 6987 LESTIEDYAQYSCLIENEAGQDICEALVSVLEPPY-FIEPLEHVEAVIGEPATLQCKVDG 7045

Query: 367  S-RIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVT 425
            +  I  +W++E  +L     Y+   +  V  L+I+++   D G Y C+    V  VA+  
Sbjct: 7046 TPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSA 7105

Query: 426  VKGPILKRLP----RKL-DVLEGENAVLLVETLEAGVEG---RWSRDGEELPVICQSSSG 477
            V     ++LP    RKL DV E     +  E    G E     W +DG  L       + 
Sbjct: 7106 VLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTS 7165

Query: 478  HMHALVLPGVTRED---AGEVTFSLGNSRTTTLLRVKCV--KHSPPG----PPILAEMFK 528
             +H +    + + D    G+   S  N   T     K +  +H  P      P+  ++  
Sbjct: 7166 FVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLAL 7225

Query: 529  GHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDY 588
            G   T         P   T   +  + +E+      +   +E    + V        G Y
Sbjct: 7226 GESGTFKCHVTGTAPIKIT---WAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQY 7282

Query: 589  RFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAV---FSLDLSTIIQG 645
                  ++G              +    R +  LE  ++   ++       +  S  I+ 
Sbjct: 7283 TCYASNIAGKDSC-----SAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKV 7337

Query: 646  TWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP----- 700
             W+ +  E++ +           ++R+        L +H +  +DSG    ++C      
Sbjct: 7338 LWYKDETEIQESS----------KFRMSFVDSVAVLEMHNLSVEDSG---DYTCEAHNAA 7384

Query: 701  -GVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRV-DFPATWYKDGQKVEE 758
                 S +L ++E P+    P    +L       V L CEL     F  +WYKD +++  
Sbjct: 7385 GSASSSTSLKVKEPPIFRKKPHPIETL---KGADVHLECELQGTPPFHVSWYKDKRELRS 7441

Query: 759  SELLVVKMDGRKHRLILPEAKVQDSGEFECRTE---GVSAFFG-VTVQDPPVHIVDPREH 814
             +   +  +     + +      D GE++C+     G     G + ++ PP  +   ++ 
Sbjct: 7442 GKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFV---KKL 7498

Query: 815  VFVHAITSECVMLACEVD-REDAPVRWYKD-GQEVEESDFVVLENEGPHRRLVLPATQPS 872
              +  +  + V L   ++  E   V W+KD G+ V ESD + +        L     +P+
Sbjct: 7499 SDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPA 7558

Query: 873  DGGEFQCV----AGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELC-RPWA 927
            + G++ C     AG +  + T+++ + ++ +  P     +     +   L C +   P  
Sbjct: 7559 NAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPES---IKVTTGDTCTLECTVAGTPEL 7615

Query: 928  EVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD----ESASFTVTV 983
              +W KDG+E+       +   + V  L +  V   DSG Y  E+ +    +S + ++ V
Sbjct: 7616 STKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQV 7675

Query: 984  TEPPVRIIYPRDEVTLIAVTLECVVLMCEL-SREDAPVRWYKDGLEVEESEALVLERDGP 1042
            ++  V   + R       ++   VV+ C++       V W+ +G E+             
Sbjct: 7676 SDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDN 7735

Query: 1043 RCRLVLPAAQPEDGGEFVC----DAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGR 1098
             C L +   +  D G++ C     AG D     +TV  PP  +  P    +D+  G    
Sbjct: 7736 TCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKP--DPMDVLTGTNVT 7793

Query: 1099 VELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHE 1158
                 +  P  S V W+K   E+   D   +  E     L L       +GEY C   +E
Sbjct: 7794 FTSIVKGTPPFS-VSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNE 7852

Query: 1159 AITFNV---ILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP---VVWSHNGRP 1212
            A   +    +  + P +F+      S   +  G+P++L  E +  G P   V W  NG  
Sbjct: 7853 AGKASCTTHLYIKAPAKFVKRLNDYS---IEKGKPLIL--EGTFTGTPPISVTWKKNGIN 7907

Query: 1213 VQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAP 1272
            V   +   +       +L I ++    AG Y C    A G  S S  + + EPP  V   
Sbjct: 7908 VTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQL 7967

Query: 1273 EAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGA 1331
            E  +  V    G    L   L+G P   V WYK   +L      ++        L     
Sbjct: 7968 EPVKVSV----GDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQV 8023

Query: 1332 RSGDAGEYLCDAPQ-----DSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPP 1386
               D+GEY+C A        +  FL   E+ L      +L  +    G    F C +S  
Sbjct: 8024 DINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGS 8083

Query: 1387 D-ADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAG----TVTLRAGSTATSAR 1441
            +   V+W ++G  +   P V+ +   ++  L +       AG    T T   GS ++SAR
Sbjct: 8084 EPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSAR 8143

Query: 1442 LHVRE--TELLFLRRLQDVRAEEGQDVCLEVE-TGRVGAAGAVRWVRGGQPLPHDSRLSM 1498
            L + E      F  RL  V A  G+    E   TG       V W +  + +    +  +
Sbjct: 8144 LILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPI--KVSWAKDSREIRSGGKYQI 8201

Query: 1499 AQDGHIHRLFIHGVILADQGTYGC----ESHHDRTLARLSVRPRQLR---VLRPLEDVTI 1551
            +   +   L +  V   D G Y C    E   D   A+L+++ R +      R  E V  
Sbjct: 8202 SYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEE 8261

Query: 1552 SEGGSATFQLE---LSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGC 1608
            +EG S  F+LE      + +T  W +  +++ P   C I    +   L +   G+ D+G 
Sbjct: 8262 TEGNS--FKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGL 8319

Query: 1609 ----VSFTADSLRCAARLIVREVPVTIVRGPH--DLEVTEGDTATFECEL-SQALADVTW 1661
                VS  A S  C + ++++E     V   H   + V+EG+     C +       + W
Sbjct: 8320 YTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQW 8379

Query: 1662 EKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPV---RLTVRERT 1718
             K G  + PS R          +L+LR    +D+G Y C             ++T++++ 
Sbjct: 8380 LKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKP 8439

Query: 1719 VAV--------------LSELRSVSAREGDGATFECTV------SEVETTGRWELGGRPL 1758
                             +SE +S+   E   ATF   V      +   T G+W    R L
Sbjct: 8440 AVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKW----RQL 8495

Query: 1759 RPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA----GPAQSLALLEVE 1804
              G RV I Q+G +  L + +    D+G  R  A    G  +S   L+V+
Sbjct: 8496 NQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVD 8545



 Score =  291 bits (745), Expect = 4e-78
 Identities = 315/1294 (24%), Positives = 508/1294 (39%), Gaps = 122/1294 (9%)

Query: 674  QKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAA-LTIQESPVHILSPQDRVSLTFTTSE 732
            +KGLQ    L  + H+  GAL G +    +     + +   PV +L             E
Sbjct: 1810 RKGLQRIEELERMAHE--GALTGVTTDQKEKQKPDIVLYPEPVRVLE-----------GE 1856

Query: 733  RVVLTCELSRVDFP-ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE 791
                 C ++    P   WY +GQ + +S+   V+ DG  H L + + K  D+GE +   E
Sbjct: 1857 TARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGEVKVTAE 1915

Query: 792  GVSAFFGVTVQDPPVHIV-------------DPREHVFVHAITSECVMLACEVDREDAPV 838
                  GV      + I              +PR    VH    E   L  EV + D PV
Sbjct: 1916 NPE---GVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH----EPGKLQFEVQKVDRPV 1968

Query: 839  -----------------RWYKDGQEVEE--SDFVVLENEGPHRRLV---LPATQPSDG-G 875
                                K  +E EE  S F     EG +  +    L + +  +   
Sbjct: 1969 DTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYE 2028

Query: 876  EFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCEL------------- 922
            E      DE  ++T  +T+     +   GK+ +   + +++ L+  +             
Sbjct: 2029 ELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2088

Query: 923  --------------CRPWAEVRWTKDGEEVVESPALLLQ-KEDTVRRLVLPAVQLEDSGE 967
                           +P  E  W K+G ++  S  +     ED V  LV+  V  EDS  
Sbjct: 2089 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSAS 2148

Query: 968  YLCE---IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLM-CELSREDAPVRWY 1023
             + +   I  E++S    + +    I + ++   ++A   + +    CE S     V+WY
Sbjct: 2149 IMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWY 2208

Query: 1024 KDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVH 1083
            KDG+EV E +   +  D     L +      D  ++ C   +D    T         +V 
Sbjct: 2209 KDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVE 2268

Query: 1084 PAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHA 1143
                  D+        EL C V+P   + +WY + +E++++    + +    + LT+   
Sbjct: 2269 FVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDV 2328

Query: 1144 QPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP 1203
              ED GEY      +  T  + +   P+  L      S   V  G+ V L  ++S     
Sbjct: 2329 TKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQ---GLSDQKVCEGDIVQLEVKVSLESVE 2385

Query: 1204 VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVA 1263
             VW  +G+ VQ  + + +  +    +L I+      AG Y+    A      LS + +V+
Sbjct: 2386 GVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPAL----GLSTSGRVS 2441

Query: 1264 EPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPG-GPVRWYKDGERLASQGRVQLEQAGA 1322
               V V+ P      V    G    L   +S P    V+WY + E++    RVQ    G 
Sbjct: 2442 VYSVDVITP---LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGT 2498

Query: 1323 RQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCE 1382
            +Q L +    + D G Y     +      +SVE+   +K++  L  LT  E  +  F  E
Sbjct: 2499 KQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK---IKIIRGLRDLTCTETQNVVFEVE 2555

Query: 1383 VSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARL 1442
            +S    DV W      + P  + ++  +G    LT+      D G  T  AG   TS +L
Sbjct: 2556 LSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKL 2615

Query: 1443 HVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDG 1502
             V    +   + L D    E Q+   E E     + G   W+R G+ LP  + +    DG
Sbjct: 2616 TVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKG--EWLRDGKHLPLTNNIRSESDG 2671

Query: 1503 HIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLE 1562
            H  RL I    L D G Y  +    +T A+L V    +++ + L+++T++E   A F +E
Sbjct: 2672 HKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA--VKIKKTLKNLTVTETQDAVFTVE 2729

Query: 1563 LSQEGVTG-EWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAAR 1621
            L+   V G +W + GV L    K  I   G  + L +    + D     F    L  +AR
Sbjct: 2730 LTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASAR 2789

Query: 1622 LIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGT 1681
            L V  V   I++ P D+   E  T  FE  +S     V W      + PS + RL +   
Sbjct: 2790 LHVETVK--IIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERK 2847

Query: 1682 RRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECT 1741
               L L+   PSDAG Y+  VG       +  +   T+ +   ++++   E   A+FEC 
Sbjct: 2848 VHKLMLQNISPSDAGEYTAVVGQLEC---KAKLFVETLHITKTMKNIEVPETKTASFECE 2904

Query: 1742 VSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALL 1801
            VS       W   G  +    + +I  +GK H L++     ED+ E  F  G  Q  A L
Sbjct: 2905 VSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATL 2964

Query: 1802 EVEALPL-QMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG 1860
             V  + +  M +    E+   +      EVTV+  G    WL+ G E+   DK +MR+  
Sbjct: 2965 TVTPIMITSMLKDINAEEKDTI----TFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK 3020

Query: 1861 PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVE 1894
             THSL I +V   D   Y   AG+ ++   L VE
Sbjct: 3021 LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVE 3054



 Score =  291 bits (745), Expect = 4e-78
 Identities = 432/1991 (21%), Positives = 744/1991 (37%), Gaps = 224/1991 (11%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLL 71
            P F   P  + V++G  A+ +C V G  P  + W K  +++      +    G    L +
Sbjct: 6271 PFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRI 6330

Query: 72   TAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFL 131
                  D+G Y C+A N  G+   +A ++V EPP    +L+                   
Sbjct: 6331 LKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEA------------------ 6372

Query: 132  TGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGAS 191
                S+   +G  + L C+  G PE  + W ++   L E W  +   +          + 
Sbjct: 6373 ----SKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFIN---------SV 6419

Query: 192  LALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCA 251
              L I  A   DSG Y+C A N  G A     L V  PP        + P+PV       
Sbjct: 6420 ALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFT-----QKPSPV------- 6467

Query: 252  PKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQA 311
                   +G     +C + G P  E+ W  + R  + + ++     +     L +L  +A
Sbjct: 6468 ----GALKGSDVILQCEISGTPPFEVVWV-KDRKQVRNSKKFKITSKHFDTSLHILNLEA 6522

Query: 312  KDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSR-IP 370
             D G Y C A N  G    +  +  KEP  RF + L D          L   V   + I 
Sbjct: 6523 SDVGEYHCKATNEVGSDTCSCSVKFKEPP-RFVKKLSDTSTLIGDAVELRAIVEGFQPIS 6581

Query: 371  TAWFREDQRLLPCRKYEQIEEGTVRRLIIHRL---KADDDGIYLCEMR---GRVRTVANV 424
              W ++   ++  R+ E      +  +   +L   +A + G Y+C+++   G     A +
Sbjct: 6582 VVWLKDRGEVI--RESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVL 6639

Query: 425  TVKGPI-LKRLPRKLDVLEGENAVL-LVETLEAGVEGRWSRDGEELPVICQSSSGHMH-- 480
            TV  P  +   P  + V  G    L  V T    +  +W +DG EL    +     ++  
Sbjct: 6640 TVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKV 6699

Query: 481  -ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKN----TVL 535
             +L +P     D G  +F + NS   +   V         PP      K        +V+
Sbjct: 6700 ASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVV 6759

Query: 536  LTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTV 595
            L  +    AP +   ++ +  E+ S    Q    E    + +        G Y      V
Sbjct: 6760 LECRVSGSAPISVGWFQ-DGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANV 6818

Query: 596  SGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGT------WFL 649
            +G      V+   +    P+       + V+V  G     SL  +++I+GT      WF 
Sbjct: 6819 AGSDECSAVL---TVQEPPSFEQTP--DSVEVLPG----MSLTFTSVIRGTPPFKVKWFK 6869

Query: 650  NGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAA-- 707
               EL   E             I  +     L L  V+  +SG    +SC    D+ +  
Sbjct: 6870 GSRELVPGES----------CNISLEDFVTELELFEVQPLESG---DYSCLVTNDAGSAS 6916

Query: 708  ----LTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD-FPATWYKDGQKVEESELL 762
                L ++E    +    D    +  T   +VL    +       +W KD   + +SE  
Sbjct: 6917 CTTHLFVKEPATFVKRLAD---FSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERC 6973

Query: 763  VVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF----FGVTVQDPPVHIVDPREHVFVH 818
             + M  +   L + E+ ++D  ++ C  E  +        V+V +PP + ++P EHV   
Sbjct: 6974 SITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPP-YFIEPLEHV--E 7030

Query: 819  AITSECVMLACEVD-REDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEF 877
            A+  E   L C+VD   +  + WYK+  ++  +    ++ +     LV+     SD GE+
Sbjct: 7031 AVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEY 7090

Query: 878  QCVAGDECA-----------------YFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTC 920
             C A +                    +F   + DV   + +P             V   C
Sbjct: 7091 SCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFP-------------VAFEC 7137

Query: 921  EL--CRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE--- 975
             +    P  +V W KDG  + +   L       V  L +        G+Y C   +    
Sbjct: 7138 RINGSEP-LQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGT 7196

Query: 976  -SASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVR--WYKDGLEVEES 1032
             S+S  + ++E  V   +    V++     E     C ++   AP++  W KD  E+   
Sbjct: 7197 ASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGT-APIKITWAKDNREIRPG 7255

Query: 1033 EALVLERDGPRCRLVLPAAQPEDGGEFVCDA----GDDSAFFTVTVTAPPERIVHPAARS 1088
                +        L +      D G++ C A    G DS    + V  PP R +     S
Sbjct: 7256 GNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPP-RFIKKLEPS 7314

Query: 1089 LDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDA 1148
              +      R E +   +P   +V WYKD  E++ S   ++        L + +   ED+
Sbjct: 7315 RIVKQDEFTRYECKIGGSPE-IKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDS 7373

Query: 1149 GEYVCETRHEA----ITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP- 1203
            G+Y CE  + A     + ++ + EPP+        P P+    G  V L CEL   G P 
Sbjct: 7374 GDYTCEAHNAAGSASSSTSLKVKEPPI----FRKKPHPIETLKGADVHLECELQ--GTPP 7427

Query: 1204 --VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQ 1261
              V W  + R ++ G+  ++ +E     + I     A  G Y C++    G+ +   ++ 
Sbjct: 7428 FHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIA 7487

Query: 1262 VAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGG-PVRWYKD-GERLASQGRVQLEQ 1319
            +  PP  V       T V    G +++L   + G     V W+KD GE +     + +  
Sbjct: 7488 LKAPPRFVKKLSDISTVV----GKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY 7543

Query: 1320 AGARQVLRVQGARSGDAGEYLC----DAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGD 1375
            +     L+       +AG+Y C    DA        +SV EP  +  V +   + V  GD
Sbjct: 7544 SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATI--VEKPESIKVTTGD 7601

Query: 1376 DATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRA- 1433
              T  C V+  P+    W ++G  +T   + +++       L +      D+G  +    
Sbjct: 7602 TCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQ 7661

Query: 1434 ---GSTATSARLHVRETEL--LFLRRLQDVRAEEGQDVCLEVETGRVGAAG-AVRWVRGG 1487
               G  + +A L V +  +   F R+L++     G  V +E +    G+   +V W   G
Sbjct: 7662 NPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKV--YGSPPISVSWFHEG 7719

Query: 1488 QPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH----DRTLARLSVRPRQLRVL 1543
              +    +       +   L ++ +  +D G Y C + +    D   A L+VR     V 
Sbjct: 7720 NEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQ 7779

Query: 1544 RPLEDVTISEGGSATF-QLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLG 1602
            +P + + +  G + TF  +       +  W +G  +L PG +C++  +     L L  + 
Sbjct: 7780 KP-DPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVD 7838

Query: 1603 LADSG----CVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALA- 1657
             + SG     VS  A    C   L ++  P   V+  +D  + +G     E   +     
Sbjct: 7839 TSQSGEYTCIVSNEAGKASCTTHLYIK-APAKFVKRLNDYSIEKGKPLILEGTFTGTPPI 7897

Query: 1658 DVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTAR---AGPVRLTV 1714
             VTW+K+G  +TPS R  +       +L++      DAG Y+C +  A    +   ++ +
Sbjct: 7898 SVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 7957

Query: 1715 RERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RWELGGRPLRPGARVRIRQEGKKH 1773
             E    V  +L  V    GD A+ +C ++     G  W  G   LRP    ++       
Sbjct: 7958 LEPPYFV-KQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVA 8016

Query: 1774 ILVLSELRAEDAGEVRFQAG------PAQSLALLEVEALPLQMCRHPPREKTVLVGRRAV 1827
             LV +++   D+GE   +A        A +   ++ + LP    R   R+    VG   V
Sbjct: 8017 TLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQ-LRDVQETVGLPVV 8075

Query: 1828 LEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA---- 1882
             +  +S S    V W ++G  L      +      T +L I        G Y C A    
Sbjct: 8076 FDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPI 8135

Query: 1883 GQDSTHTRLLV 1893
            G  S+  RL++
Sbjct: 8136 GSASSSARLIL 8146



 Score =  289 bits (740), Expect = 2e-77
 Identities = 434/1981 (21%), Positives = 741/1981 (37%), Gaps = 197/1981 (9%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            PP  L+  +PV V SG  A    V+ G P P + W K  Q L+   +  F  DG E+ LL
Sbjct: 3238 PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLL 3297

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            L  A P DA VY C A+N  G A  +A+++V  P    P+ +    P          P  
Sbjct: 3298 LIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP----------PAI 3347

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGA 190
            +T  +      G      CR  G      ++ KD     ++  S  F +   + ED    
Sbjct: 3348 ITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKD----KKIKPSRFFRMT--QFED---- 3397

Query: 191  SLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPE------SPPADPDEAPAPV 244
            +  L I  A   D G Y   A NA G   + A L +  P            + +   APV
Sbjct: 3398 TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPV 3457

Query: 245  ----VEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG 300
                +EPL+ A        G  AKF C +   P    +W   GR +  +  +   R    
Sbjct: 3458 IKRKIEPLEVA-------LGHLAKFTCEIQSAPNVRFQWFKAGREIY-ESDKCSIRSSKY 3509

Query: 301  GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKE--PRLRFTRP--LQDVEGREHG 356
               L++L  Q  D G Y C A N  G       L V E  P    +RP  L    G+   
Sbjct: 3510 ISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGK--- 3566

Query: 357  IAVLECKVPNSR-IPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMR 415
             A   C V  +  I T W ++   L P   +   +      L +  L   D G+Y C+  
Sbjct: 3567 AAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKAS 3626

Query: 416  GRVRTVANVTVKGPILKRLPRKLDVLEG-ENAVLLVETLEAGVEG------RWSRDGEEL 468
             +    A++     I+   P  +  LE  ++A+     LE  V+        WS+DG++L
Sbjct: 3627 NKFG--ADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKL 3684

Query: 469  P-----VICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPG---- 519
            P      IC      +  L +P    +D+G    +  N   ++          PP     
Sbjct: 3685 PPGKDYKICFEDK--IATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKK 3742

Query: 520  --PPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEV 577
              P  L  M  G    +    K    +P     +    +E+   + ++ + +     +++
Sbjct: 3743 VDPSYL--MLPGESARLHCKLK---GSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDI 3797

Query: 578  PGDCVPSEGDYRFR-ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFS 636
                V   G Y    +  V     S  +V       + T      LE   +  G +A+  
Sbjct: 3798 TDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKT------LEPADIVRGTNALLQ 3851

Query: 637  LDLSTI--IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGAL 694
             ++S     + +WF + ++++S++          +YR+     Q  L+   +   +S  +
Sbjct: 3852 CEVSGTGPFEISWFKDKKQIRSSK----------KYRLFS---QKSLVCLEIFSFNSADV 3898

Query: 695  VGFSCPGVQD------SAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD-FPA 747
              + C    +       A   ++E P  +    D ++L     + V L   +   +    
Sbjct: 3899 GEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIAL---GGQTVTLQAAVRGSEPISV 3955

Query: 748  TWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE---GVSAFFGVTVQDP 804
            TW K  + + E   + +        LI+P+ ++   G++ C  E   G     G  +   
Sbjct: 3956 TWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE 4015

Query: 805  PVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRL 864
            P  I++  E + V A     +        E  P +WYKDG+ +  S    +  +    +L
Sbjct: 4016 PAKIIERAELIQVTAGDPATLEYTVAGTPELKP-KWYKDGRPLVASKKYRISFKNNVAQL 4074

Query: 865  VLPATQPSDGGEFQCVAGDEC------AYFTVTITDVSSWIVYPSGKVYVAAVRLERVVL 918
               + +  D G++     +E         FTV   D++ +   P     V +V      L
Sbjct: 4075 KFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRN--VDSVVNGTCRL 4132

Query: 919  TCELCRPW-AEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLC----EID 973
             C++       V W KDG+E+  S    +   +    L +  V + D+G + C     + 
Sbjct: 4133 DCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVG 4192

Query: 974  DESASFTVTVTEPPVRIIYP--RDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEE 1031
             + +S  + V EPP  +  P  +D +   AV L+              +RW+K   E+  
Sbjct: 4193 SKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTF----QGSTPLTIRWFKGNKELVS 4248

Query: 1032 SEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTV---TAPPERIVHPAARS 1088
              +  + ++     L L   +  D G + C   + +     +       P   V     S
Sbjct: 4249 GGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPS 4308

Query: 1089 LDLHFGAPGRVELRCEVAPAGS-QVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPED 1147
              L  G     +L C+V      ++ W+ +  E++ S   ++     T  L L     ED
Sbjct: 4309 QLLKKG--DATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIED 4366

Query: 1148 AGEYVCETRHEA----ITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP 1203
            +GEY+CE ++EA     +  VI+ E P  +   E    P+ V     V+L  E+  AG P
Sbjct: 4367 SGEYMCEAQNEAGSDHCSSIVIVKESP--YFTKEF--KPIEVLKEYDVMLLAEV--AGTP 4420

Query: 1204 ---VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV 1260
               + W  +   ++ G   +   +     L I     A AG Y C+     G+   S  V
Sbjct: 4421 PFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARV 4480

Query: 1261 QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGP-GGPVRWYKDGERLASQGRVQLEQ 1319
             + EPP  +   E+      S  GG       L G     V W KD + +     +++  
Sbjct: 4481 TLREPPSFIKKIESTS----SLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTF 4536

Query: 1320 AGARQVLRVQGARSGDAGEYLCDAPQDSRI----FLVSVEEPLLVKLVSELTPLTVHEGD 1375
                  L + G      G+Y+C A  D+ I     L+SV+EP    +  E   + V +GD
Sbjct: 4537 ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEP--ATITEEAVSIDVTQGD 4594

Query: 1376 DATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR-- 1432
             AT + + S   +    W ++G  +T G + +++   +  IL +   +  D+G  T    
Sbjct: 4595 PATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQ 4654

Query: 1433 --AGSTATSARLHVRETEL--LFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQ 1488
               G ++  AR++V +  +   F ++L+ + + +G  + LE          +++W +  Q
Sbjct: 4655 NDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPI-SIQWFKDDQ 4713

Query: 1489 PLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGC----ESHHDRTLARLSVRPRQLRVLR 1544
             +    +   +   +   L I  +   D GTY C    ++ H++    L+V+     V +
Sbjct: 4714 EISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEK 4773

Query: 1545 P-LEDVTISEGGSATFQLELSQEG---VTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNG 1600
            P  +DV      +   QL+    G   +T +W +   +L+ G    +  D     L L  
Sbjct: 4774 PQSQDV----NPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFA 4829

Query: 1601 LGLADSGC----VSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELS-QA 1655
                DSG     +S    +    A L V+E P  I +    L +  G + TFEC+++   
Sbjct: 4830 AKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTP 4889

Query: 1656 LADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA----VGTARAGPVR 1711
               V+W  DGN +T   +  +  +      Q+      ++GTY C      GTA    + 
Sbjct: 4890 KIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCS-IE 4948

Query: 1712 LTVRERTVAVLSELRSVSAREGDGATFECTVS---EVETTGRWELGGRPLRPGARVRIRQ 1768
            L V+E     + EL+ V   +      EC V+     E T  W    R +R   +  +  
Sbjct: 4949 LKVKE-PPTFIRELKPVEVVKYSDVELECEVTGTPPFEVT--WLKNNREIRSSKKYTLTD 5005

Query: 1769 EGKKHILVLSELRAEDAGE---VRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRR 1825
                  L +++    D GE   +    G + S +       P    +      TVL    
Sbjct: 5006 RVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSA 5065

Query: 1826 AVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQD 1885
                         + WL++   L   D   +       +L I  V     G Y CQA  +
Sbjct: 5066 TFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNE 5125

Query: 1886 S 1886
            S
Sbjct: 5126 S 5126



 Score =  284 bits (726), Expect = 7e-76
 Identities = 441/1958 (22%), Positives = 748/1958 (38%), Gaps = 188/1958 (9%)

Query: 11   PPCFLRFPRPVRVVSGAEA-ELKCVVLGEPPPVVVWEKGGQQLAASE--RLSFPADGAEH 67
            P  F+    P +++   +A +L C V G PP  + W    +++  S   R+SF    A  
Sbjct: 4298 PATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAV- 4356

Query: 68   GLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGA 127
             L LT     D+G Y+C A+N AG  + ++ V V E P    E +P E            
Sbjct: 4357 -LRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIE------------ 4403

Query: 128  PVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDG 187
                       VL+  +V+L     G P   + W KD   L        F          
Sbjct: 4404 -----------VLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDH------ 4446

Query: 188  PGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEP 247
                ++L+IL     D+G Y C   N  G +   A + + +PP                 
Sbjct: 4447 ---LVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSF--------------- 4488

Query: 248  LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRR-RLMYRDRDGGFVLKV 306
            +K    T  +  G  A F+  + G     + W  +   +  D   R+ + +      L  
Sbjct: 4489 IKKIESTSSLRGGT-AAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSG 4547

Query: 307  LYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
            +  + K  G YVC A+N AG    +  L VKEP    T     ++  +   A L+ K   
Sbjct: 4548 I--EVKHDGKYVCQAKNDAGIQRCSALLSVKEPAT-ITEEAVSIDVTQGDPATLQVKFSG 4604

Query: 367  SRIPTA-WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMR---GRVRTVA 422
            ++  TA WF++ Q L    KY+     TV  L I   +  D G Y  E++   GR    A
Sbjct: 4605 TKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKA 4664

Query: 423  NVTVKGPIL-----KRLPRKLDVLEGENAVLLVETLEAG---VEGRWSRDGEELPVICQ- 473
             + V   I+     K+L +K+D ++G  + + +E + AG   +  +W +D +E+    + 
Sbjct: 4665 RINVLDLIIPPSFTKKL-KKMDSIKG--SFIDLECIVAGSHPISIQWFKDDQEISASEKY 4721

Query: 474  --SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKH-SPPGPPILAEMFKG- 529
              S   +   L +  +   D+G  T S  N         +C  H +   PP   E  +  
Sbjct: 4722 KFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHN----QCSGHLTVKEPPYFVEKPQSQ 4777

Query: 530  --HKNT-VLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEG 586
              + NT V L       AP T   ++ + +E+ S      +  + + ++E+        G
Sbjct: 4778 DVNPNTRVQLKALVGGTAPMTIKWFK-DNKELHSGAARSVWKDDTSTSLELFAAKATDSG 4836

Query: 587  DYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI--IQ 644
             Y  ++    G   S   +F       P   +      + + +G+   F   ++    I+
Sbjct: 4837 TYICQLSNDVGTATSKATLFVKE----PPQFIKKPSPVLVLRNGQSTTFECQITGTPKIR 4892

Query: 645  GTWFLNGEELKSNEPEG-QVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQ 703
             +W+L+G E+ + +  G     G   ++I    +++          D+G     SC    
Sbjct: 4893 VSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTA---SC---- 4945

Query: 704  DSAALTIQESPVHI--LSPQDRVSLTFTTSERVVLTCELSRVD-FPATWYKDGQKVEESE 760
             S  L ++E P  I  L P + V  +      V L CE++    F  TW K+ +++  S+
Sbjct: 4946 -SIELKVKEPPTFIRELKPVEVVKYS-----DVELECEVTGTPPFEVTWLKNNREIRSSK 4999

Query: 761  LLVVKMDGRKHRLILPEAKVQDSGEFEC--RTEGVSAFFG--VTVQDPPVHIVDPREHVF 816
               +        L + +    D+GE++C    EG S      V +++PP  I        
Sbjct: 5000 KYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTT 5059

Query: 817  VHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGE 876
            V  + S     +         + W KD Q ++E D V +        L + +      G 
Sbjct: 5060 V--LKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGR 5117

Query: 877  FQCVAGDECAY---FTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELC-RPWAEVRWT 932
            + C A +E      +   +    + IV  +  V V     + + L C +   P  +V+W 
Sbjct: 5118 YTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVT--EKDPMTLECVVAGTPELKVKWL 5175

Query: 933  KDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFT----VTVTEPPV 988
            KDG+++V S    +  E+ V    + +V  +DSG+Y  +++++  S +    + V +  +
Sbjct: 5176 KDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNI 5235

Query: 989  RIIYPRDEVTLIAVTLECVVLMCELSRE-DAPVRWYKDGLEVEESEALVLERDGPRCRLV 1047
               + +    +  V    + + C++S       +W+KDG E+  S    L        L 
Sbjct: 5236 PPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLE 5295

Query: 1048 LPAAQPEDGGEFVCD----AGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRC 1103
            +   + ED   + C     AGDD+    +TV  PP  +V P  +          +  L+ 
Sbjct: 5296 VNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILK- 5354

Query: 1104 EVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRH----EA 1159
                   +++W+KD +E+ +     +G EG T  L L        G+Y C   +    ++
Sbjct: 5355 --GTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDS 5412

Query: 1160 ITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP---VVWSHNGRPVQEG 1216
             T  +++ EPP     LE +     V  G+   L C++  AG+P   VVW  N   +   
Sbjct: 5413 CTTMLLVTEPPKFVKKLEASK---IVKAGDSSRLECKI--AGSPEIRVVWFRNEHELPAS 5467

Query: 1217 EGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQ 1276
            +   +       V+ +       +G + C++    G+ S S  V V EPPV    P   +
Sbjct: 5468 DKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVE 5527

Query: 1277 TRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGD 1335
            T        ++ L   LSG P   V WYKD  +L S  + ++        + +    + D
Sbjct: 5528 T----LKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSD 5583

Query: 1336 AGEYLCDAP----QDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEV-SPPDADV 1390
             GEY C A      D+ +  V ++EP   + VS+L  LTV  G+ A  +  +       V
Sbjct: 5584 IGEYHCKAQNEVGSDTCVCTVKLKEP--PRFVSKLNSLTVVAGEPAELQASIEGAQPIFV 5641

Query: 1391 TWLR-NGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR----AGSTATSARLHVR 1445
             WL+    V+     + +    +   L     +  +AG    +     G     A L V 
Sbjct: 5642 QWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVL 5701

Query: 1446 ETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIH 1505
            E  ++ + +   +    G+   LE +        +V W + G+ L    +   +    I 
Sbjct: 5702 EPAVI-VEKAGPMTVTVGETCTLECKVAGTPEL-SVEWYKDGKLLTSSQKHKFSFYNKIS 5759

Query: 1506 RLFIHGVILADQGTYGCESHHD------RTLARLSVRPRQLRVLRPLEDVTISEGGSATF 1559
             L I  V   D GTY  +  ++        +  +S R       R L++     G S   
Sbjct: 5760 SLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCIL 5819

Query: 1560 QLELS-QEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSG---CVSF-TAD 1614
            + +++    ++  W     ++  G K       +   L LN L  +D G   CV+   A 
Sbjct: 5820 ECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAG 5879

Query: 1615 SLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECEL-SQALADVTWEKDGNALTPSPR 1673
            S  C A L V+E P + V+ P  LEV  G   TF   +       V W +    L    R
Sbjct: 5880 SDECRAVLTVQE-PPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDR 5938

Query: 1674 LRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVR---ERTVAVLSELRSVSA 1730
              +    T   L+L     S +G Y+C V    AG    T R   +   A L  L   S 
Sbjct: 5939 CNIYFEDTVAELELFNIDISQSGEYTCVVSN-NAGQASCTTRLFVKEPAAFLKRLSDHSV 5997

Query: 1731 REGDGATFECT-VSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAG--- 1786
              G     E T    +  +  W+  G  +    +  I    K  IL +      DAG   
Sbjct: 5998 EPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYS 6057

Query: 1787 -EVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGG-HVCWLRE 1844
             E+  +AG     AL+     P  +    P E    VG    L+  V+ +    V W + 
Sbjct: 6058 CEIENEAGRDVCGALVSTLEPPYFVTELEPLE--AAVGDSVSLQCQVAGTPEITVSWYKG 6115

Query: 1845 GAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA 1882
              +L P  +Y         +LV + V   D G Y C+A
Sbjct: 6116 DTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKA 6153



 Score =  283 bits (725), Expect = 9e-76
 Identities = 451/1993 (22%), Positives = 724/1993 (36%), Gaps = 223/1993 (11%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            PP F++ P P+ V+ G       V+ G PP  V W +G ++L   +R +   +     L 
Sbjct: 5892 PPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELE 5951

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            L     + +G Y C   N AG+A     + V EP A                       F
Sbjct: 5952 LFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAA-----------------------F 5988

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGA 190
            L       V  G  ++L     G    ++ W+KDG  +      +    +          
Sbjct: 5989 LKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTE---------K 6039

Query: 191  SLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKC 250
            +  L IL +   D+G Y C   N  G    GAL+   +PP              +EPL+ 
Sbjct: 6040 TCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYF---------VTELEPLEA 6090

Query: 251  APKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLY-- 308
            A        G     +C V G PE  + W+     L P      YR      V  +++  
Sbjct: 6091 A-------VGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPE---YRTYFTNNVATLVFNK 6140

Query: 309  CQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRL--RFTRPLQDVEGREHGIAVLECKVPN 366
                D G Y C A NS G   S     ++E +L   F R L+D+E        L C++  
Sbjct: 6141 VNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNG 6200

Query: 367  SR-IPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCE-------MRGRV 418
            S  I   W+R+   L      +      V  L I +      G Y C             
Sbjct: 6201 SAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSA 6260

Query: 419  RTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEG------RWSRDGEEL---- 468
            R  A    K P     P  +DV+ GE+A       E  V G       WS+D +E+    
Sbjct: 6261 RLTAREPKKSPFFDIKPVSIDVIAGESA-----DFECHVTGAQPMRITWSKDNKEIRPGG 6315

Query: 469  --PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEM 526
               + C  ++ H+  L    V + D+G+ T    N     +   +     PP      E 
Sbjct: 6316 NYTITCVGNTPHLRIL---KVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEA 6372

Query: 527  FKGHK--NTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFS-IEKAGAVEVPGDCVP 583
             K  K   ++ L  K    +PE    +     E+  E W    S I     + +      
Sbjct: 6373 SKVAKQGESIQLECK-ISGSPEIKVSWFRNDSEL-HESWKYNMSFINSVALLTINEASAE 6430

Query: 584  SEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI- 642
              GDY   IC    H          +  +            V    G D +   ++S   
Sbjct: 6431 DSGDY---IC--EAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTP 6485

Query: 643  -IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPG 701
              +  W  + +++++++          +++I  K     L +  ++  D G    + C  
Sbjct: 6486 PFEVVWVKDRKQVRNSK----------KFKITSKHFDTSLHILNLEASDVGE---YHCKA 6532

Query: 702  VQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRV-----DFPATWYKD-GQK 755
              +  + T   S V    P   V     TS  +    EL  +          W KD G+ 
Sbjct: 6533 TNEVGSDTCSCS-VKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEV 6591

Query: 756  VEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE---GVSAFFGVTVQDPPVHIVDPR 812
            + ESE   +        L L   +  +SG++ C+ +   G+     V     P  I++  
Sbjct: 6592 IRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKP 6651

Query: 813  EHVFV---HAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPAT 869
            E + V   +    ECV+        +   +W+KDG+E+       +        L +P  
Sbjct: 6652 EPMTVTTGNPFALECVV----TGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCA 6707

Query: 870  QPSDGGEFQCVAGDECAYFTVTIT-DVSSWIVYPS---GKVYVAAVRLERVVLTCELC-R 924
            + SD G +     +       T++  VS  IV PS       V A+    VVL C +   
Sbjct: 6708 EMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGS 6767

Query: 925  PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLC----EIDDESASFT 980
                V W +DG E+V  P       + V  L L  ++  D+G Y C        +  S  
Sbjct: 6768 APISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAV 6827

Query: 981  VTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP--VRWYKDGLEVEESEALVLE 1038
            +TV EPP     P     L  ++L        + R   P  V+W+K   E+   E+  + 
Sbjct: 6828 LTVQEPPSFEQTPDSVEVLPGMSL----TFTSVIRGTPPFKVKWFKGSRELVPGESCNIS 6883

Query: 1039 RDGPRCRLVLPAAQPEDGGEFVC----DAGDDSAFFTVTVTAPPERIVHPAARSLDLHFG 1094
             +     L L   QP + G++ C    DAG  S    + V  P   +   A  S++   G
Sbjct: 6884 LEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVET--G 6941

Query: 1095 APGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCE 1154
            +P  +E      P  S V W KD   +  S+   +     +  L +  +  ED  +Y C 
Sbjct: 6942 SPIVLEATYTGTPPIS-VSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCL 7000

Query: 1155 TRHEA----ITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP---VVWS 1207
              +EA        V + EPP     LE   + +    GEP  L C++   G P   + W 
Sbjct: 7001 IENEAGQDICEALVSVLEPPYFIEPLEHVEAVI----GEPATLQCKVD--GTPEIRISWY 7054

Query: 1208 HNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPV 1267
                 ++     ++  +     L I     +  G Y+C++  + GA + S  + +     
Sbjct: 7055 KEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVI---KA 7111

Query: 1268 RVVAPEAAQ--TRVRSTPGGDLELVVHLSGPGG-PVRWYKDGERLASQGRVQLEQAGARQ 1324
            R + P  A+    V  T G  +     ++G     V WYKDG  L     +Q        
Sbjct: 7112 RKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVA 7171

Query: 1325 VLRVQGARSGDAGEYLCD-------APQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDA 1377
             L++        G+Y C        A   +++ L   E P    L      L +  G+  
Sbjct: 7172 TLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLAL--GESG 7229

Query: 1378 TFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR---- 1432
            TF+C V+      +TW ++   + PG   +M    ++  LT+     GDAG  T      
Sbjct: 7230 TFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNI 7289

Query: 1433 AGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVR--WVRGGQPL 1490
            AG  + SA+L V+E    F+++L+  R  + QD     E  ++G +  ++  W +    +
Sbjct: 7290 AGKDSCSAQLGVQEPP-RFIKKLEPSRIVK-QDEFTRYEC-KIGGSPEIKVLWYKDETEI 7346

Query: 1491 PHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH------DRTLARLSVRPRQLRVLR 1544
               S+  M+    +  L +H + + D G Y CE+H+        T  ++   P   +   
Sbjct: 7347 QESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPH 7406

Query: 1545 PLEDVTISEGGSATFQLELSQEGVTG---EWARGGVQLYPGPKCHIHSDGHRHRLVLNGL 1601
            P+E +       A   LE   +G       W +   +L  G K  I S+     + +  +
Sbjct: 7407 PIETLK-----GADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNV 7461

Query: 1602 GLADSG---CVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQA-LA 1657
              AD G   C +            I  + P   V+   D+    G     +  +  A   
Sbjct: 7462 DAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPI 7521

Query: 1658 DVTWEKD-GNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGP----VRL 1712
             V W KD G  +  S  + +        LQ  R  P++AG Y+C +    AG       L
Sbjct: 7522 SVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKN-DAGMQECFATL 7580

Query: 1713 TVRERTVAVLSELRSVSAREGDGATFECTVSEV-ETTGRWELGGRPLRPGARVRIRQEGK 1771
            +V E    ++ +  S+    GD  T ECTV+   E + +W   G+ L    + +I    K
Sbjct: 7581 SVLE-PATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNK 7639

Query: 1772 KHILVLSELRAEDAG----EVRFQAGPAQSLALLEV--EALPLQMCRHPPREKTVLVGRR 1825
               L +  +   D+G    EV+   G     A L+V    +P    R   +E   L G  
Sbjct: 7640 VSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTR-KLKETNGLSGSS 7698

Query: 1826 AVLEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC---- 1880
             V+E  V  S    V W  EG E+  G KY+      T +L ++ +   D G Y C    
Sbjct: 7699 VVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATN 7758

Query: 1881 QAGQDSTHTRLLV 1893
             AG D     L V
Sbjct: 7759 MAGSDECSAPLTV 7771



 Score =  283 bits (723), Expect = 1e-75
 Identities = 253/1072 (23%), Positives = 449/1072 (41%), Gaps = 36/1072 (3%)

Query: 831  VDREDAPVRWYKDGQEVEESDFVVLE-NEGPHRRLVLPATQPSDGGEFQC----VAGDEC 885
            V + D    WYK+G ++E SD +     E     LV+      D          +AG+  
Sbjct: 2102 VGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETS 2161

Query: 886  AYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALL 945
            ++  + +            +  VA  +       CE   P+ +V+W KDG EV E     
Sbjct: 2162 SHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYR 2221

Query: 946  LQKEDTVRRLVLPAVQLEDSGEYLCE-IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTL 1004
            +  +  V  L +  +   D+ +Y C  ++DE+   T  +      + + ++   +     
Sbjct: 2222 MHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPES 2281

Query: 1005 ECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAG 1064
                L C +S E+   +WY + +E++ +    +     R  L +     ED GE+     
Sbjct: 2282 YSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVID 2341

Query: 1065 DDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEAS 1124
                   + +   P  I+   +   D        V+L  +V+    +  W KDG EV+ S
Sbjct: 2342 GKKTTCKLKMKPRPIAILQGLS---DQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPS 2398

Query: 1125 DALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLC 1184
            D + +  +  +  L +     EDAG Y        ++ +  ++   V  +   T    + 
Sbjct: 2399 DRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVI---TPLKDVN 2455

Query: 1185 VAPGEPVVLSCELSRAGAPVV-WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLY 1243
            V  G   VL C++S      V W  N   ++  + ++   +G ++ L I     +  G Y
Sbjct: 2456 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2515

Query: 1244 TCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWY 1303
                G      +LS         V  +        +  T   ++   V LS  G  V W 
Sbjct: 2516 KLIVGRVETNCNLS---------VEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWN 2566

Query: 1304 KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLV 1363
               + +    + ++E  G    L V      D G+Y   A ++     ++V    + K  
Sbjct: 2567 FKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISK-- 2624

Query: 1364 SELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQL 1423
              LT  TV E  +A F CEV+ PD+   WLR+G  +     +    +G  R L +   +L
Sbjct: 2625 -PLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKL 2683

Query: 1424 GDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRW 1483
             D G  T +  ++ TSA+L V   ++   + L+++   E QD    VE       G V+W
Sbjct: 2684 DDIGEYTYKVATSKTSAKLKVEAVKIK--KTLKNLTVTETQDAVFTVELTHPNVKG-VQW 2740

Query: 1484 VRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVL 1543
            ++ G  L  + + +++  G I+ L I    + D+  YG         ARL V    ++++
Sbjct: 2741 IKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVET--VKII 2798

Query: 1544 RPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGL 1603
            +  +DVT  E  +  F++ +S + V  +W    V++ P  K  + S+   H+L+L  +  
Sbjct: 2799 KKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2858

Query: 1604 ADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEK 1663
            +D+G  +     L C A+L V  + +T  +   ++EV E  TA+FECE+S       W K
Sbjct: 2859 SDAGEYTAVVGQLECKAKLFVETLHIT--KTMKNIEVPETKTASFECEVSHFNVPSMWLK 2916

Query: 1664 DGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLS 1723
            +G  +  S + ++   G    L +      D+  Y+   G  +   V  T+    + + S
Sbjct: 2917 NGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQ---VSATLTVTPIMITS 2973

Query: 1724 ELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE 1783
             L+ ++A E D  TFE TV+    + +W   G  ++   + ++R +   H L +  +   
Sbjct: 2974 MLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFG 3033

Query: 1784 DAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLR 1843
            DA +  F AG A S A L VEA  ++  +H  ++  VL  +RA+ E  VS     V W++
Sbjct: 3034 DAADYTFVAGKATSTATLYVEARHIEFRKHI-KDIKVLEKKRAMFECEVSEPDITVQWMK 3092

Query: 1844 EGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEG 1895
            +  EL   D+ +++     H L+I   R  D G Y   AG + +  +L VEG
Sbjct: 3093 DDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEG 3144



 Score =  278 bits (710), Expect = 5e-74
 Identities = 404/1933 (20%), Positives = 729/1933 (37%), Gaps = 206/1933 (10%)

Query: 43   VVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVL 102
            V+W    +++  S +    A G  + L +   +  D G Y       AGE   +  +TV 
Sbjct: 2563 VLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAGENMTSGKLTVA 2618

Query: 103  EPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWE 162
                S P                     LT    Q V    E V  C     P+    W 
Sbjct: 2619 GGAISKP---------------------LT---DQTVAESQEAVFECEVAN-PDSKGEWL 2653

Query: 163  KDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGA 222
            +DG          H  L      +  G    L I A +L D G Y          ++  A
Sbjct: 2654 RDG---------KHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVAT----SKTSA 2700

Query: 223  LLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWE 282
             L+V                     +K   K   V E + A F   +       ++W   
Sbjct: 2701 KLKVE-----------------AVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKN 2743

Query: 283  GRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLR 342
            G  +L    +     +   + L++  C   D  +Y        G+  ++ +LHV+   ++
Sbjct: 2744 G-VVLESNEKYAISVKGTIYSLRIKNCAIVDESVY----GFRLGRLGASARLHVE--TVK 2796

Query: 343  FTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRL 402
              +  +DV   E+     E  V +  +P  WF +   + P  K+  + E  V +L++  +
Sbjct: 2797 IIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNI 2856

Query: 403  KADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWS 462
               D G Y   + G++   A + V+   + +  + ++V E + A    E     V   W 
Sbjct: 2857 SPSDAGEYTAVV-GQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWL 2915

Query: 463  RDGEELPVICQSS---SGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPG 519
            ++G E+ +  +      G +H L++   + ED+ E TF  GN + +  L V  +  +   
Sbjct: 2916 KNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSML 2975

Query: 520  PPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPG 579
              I AE     K+T+  T++         + +     E+ S D  Q  + +   ++ +  
Sbjct: 2976 KDINAE----EKDTI--TFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRN 3029

Query: 580  DCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDL 639
                   DY F    V+G   S   ++  + H+         ++D++V + + A+F  ++
Sbjct: 3030 VHFGDAADYTF----VAGKATSTATLYVEARHI----EFRKHIKDIKVLEKKRAMFECEV 3081

Query: 640  S-TIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFS 698
            S   I   W  + +EL+  +          R +I+++   HRL++ + +  D+G      
Sbjct: 3082 SEPDITVQWMKDDQELQITD----------RIKIQKEKYVHRLLIPSTRMSDAGKYT-VV 3130

Query: 699  CPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDG----Q 754
              G   +A L ++   V I S +  V +     +R V+  E++  D  A WYKDG     
Sbjct: 3131 AGGNVSTAKLFVEGRDVRIRSIKKEVQV--IEKQRAVVEFEVNEDDVDAHWYKDGIEINF 3188

Query: 755  KVEESELLVVKMDGRKHRLILPEAKVQDSGE--FECRTEGVSAFFGVTVQDPPVHIVDPR 812
            +V+E    VV  + R HR+ + E +  D+GE  F       S    V   +PP  ++   
Sbjct: 3189 QVQERHKYVV--ERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPP-QVLQEL 3245

Query: 813  EHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPS 872
            + V V +        A    R    + WYK+ Q +         ++G    L+L    P 
Sbjct: 3246 QPVTVQS-GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPE 3304

Query: 873  DGGEFQCVAGDE------CAYFTVTITDVSS----WIVYPSGKVY----VAAVRLERVVL 918
            D   + C A ++       A  +V + +V S      VYP   +           +    
Sbjct: 3305 DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF 3364

Query: 919  TCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESAS 978
             C +     +V W    +++  S    + + +   +L +     ED G Y     +    
Sbjct: 3365 QCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3424

Query: 979  FTVTVT---EPPVRIIYPRDE----------------VTLIAVTL-ECVVLMCEL-SRED 1017
             + T     E P  I++ R E                +  + V L       CE+ S  +
Sbjct: 3425 VSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPN 3484

Query: 1018 APVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDD------SAFFT 1071
               +W+K G E+ ES+   +        L +   Q  D GE+ C A ++      +A  T
Sbjct: 3485 VRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLT 3544

Query: 1072 VTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGA 1131
            VT   PP  +  P  +SL    G   +        P    + W KDG  +  S   ++  
Sbjct: 3545 VTEAYPPTFLSRP--KSLTTFVGKAAKFICTVTGTPVIETI-WQKDGAALSPSPNWRISD 3601

Query: 1132 EGPTRTLTLPHAQPEDAGEYVCETRH----EAITFNVILAEPPVQFLALETTPSPLCVAP 1187
                  L L +   +D G Y C+  +    +     +I+ + P     LE    P+  A 
Sbjct: 3602 AENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELE----PVQSAI 3657

Query: 1188 GEPVVLSCELSR-AGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQ 1246
             + V L C++       V WS +G+ +  G+  ++  E     L I  A    +G Y C 
Sbjct: 3658 NKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCT 3717

Query: 1247 SGAAPGAPSLSFTVQVAEPP--VRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWY 1303
            +    G+ S S TV V EPP  V+ V P          PG    L   L G P   V W+
Sbjct: 3718 ASNEAGSSSCSATVTVREPPSFVKKVDPSYLM-----LPGESARLHCKLKGSPVIQVTWF 3772

Query: 1304 KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC----DAPQDSRIFLVSVEEPLL 1359
            K+ + L+    V++    +  +L +   +  D+G Y C    D   DS    + ++EP  
Sbjct: 3773 KNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEP-- 3830

Query: 1360 VKLVSELTPLTVHEGDDATFRCEVSPPDA-DVTWLRNGAVVTPGPQVEMAQNGS---SRI 1415
               +  L P  +  G +A  +CEVS     +++W ++   +    +  +    S     I
Sbjct: 3831 PSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEI 3890

Query: 1416 LTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRV 1475
             +     +G+   V             H+ +    F++++ D+ A  GQ V L+    R 
Sbjct: 3891 FSFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAV-RG 3949

Query: 1476 GAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGC----ESHHDRTLA 1531
                +V W++G + +  D ++ M+    +  L I  V ++  G Y C    E+    ++ 
Sbjct: 3950 SEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVG 4009

Query: 1532 RLSVRPRQLRVLRPLEDVTISEGGSATFQLELS-QEGVTGEWARGGVQLYPGPKCHIHSD 1590
             L V+    +++   E + ++ G  AT +  ++    +  +W + G  L    K  I   
Sbjct: 4010 ELIVK-EPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFK 4068

Query: 1591 GHRHRLVLNGLGLADSGCVSFT------ADSLRCAARLIVREVPVTIVRGPHDLEVTEGD 1644
             +  +L      L DSG  +F       + S      ++ R++     +   +++     
Sbjct: 4069 NNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNG 4128

Query: 1645 TATFECELSQAL-ADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC--- 1700
            T   +C+++ +L   V+W KDG  +  S R R+  +     L++ R   +DAG ++C   
Sbjct: 4129 TCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRAT 4188

Query: 1701 -AVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTV-SEVETTGRWELGGRPL 1758
             +VG+  +    +   +   + +++  S     G     + T       T RW  G + L
Sbjct: 4189 NSVGSKDSSGALIV--QEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKEL 4246

Query: 1759 RPGARVRIRQEGKKHILVLSELRAEDAG----EVRFQAGPAQSLALLEVEALPLQMCRHP 1814
              G    I +E  +  L L  ++  D+G    +V   AG  +  A L V+  P       
Sbjct: 4247 VSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKE-PATFVEKL 4305

Query: 1815 PREKTVLVGRRAVLEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPE 1873
               + +  G    L   V+ +    + W     E+    K+ M     T  L + DV  E
Sbjct: 4306 EPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIE 4365

Query: 1874 DQGTYCCQAGQDS 1886
            D G Y C+A  ++
Sbjct: 4366 DSGEYMCEAQNEA 4378



 Score =  275 bits (702), Expect = 4e-73
 Identities = 443/1995 (22%), Positives = 737/1995 (36%), Gaps = 226/1995 (11%)

Query: 7    DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE 66
            D+   P F +  R V  V      L C + G  P  V W K G+++AAS+R         
Sbjct: 4108 DRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGT 4167

Query: 67   HGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEG 126
              L +      DAG + CRA N+ G   ++ A+ V EPP+                    
Sbjct: 4168 ASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPS-------------------- 4207

Query: 127  APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
               F+T P S+ VL G+ V L     G    T+ W K    L  V   S +  +      
Sbjct: 4208 ---FVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKEL--VSGGSCYITK------ 4256

Query: 187  GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
                  +L +   +  DSG Y C   N  G  +  A L V +            PA  VE
Sbjct: 4257 -EALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKE------------PATFVE 4303

Query: 247  PLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKV 306
             L+    +  + +G   +  C V G P  +I W    R +    +  M    +   VL++
Sbjct: 4304 KLE---PSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRM-SFVESTAVLRL 4359

Query: 307  LYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEG-REHGIAVLECKVP 365
                 +D G Y+C A+N AG    +  + VKE    FT+  + +E  +E+ + +L     
Sbjct: 4360 TDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPY-FTKEFKPIEVLKEYDVMLLAEVAG 4418

Query: 366  NSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT---VA 422
                   WF+++  L   RKY+   +  +  L I +  A D G Y C +   V +    A
Sbjct: 4419 TPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSA 4478

Query: 423  NVTVKGP--ILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSG 477
             VT++ P   +K++     +  G  A          +   W +D +E+     I  +   
Sbjct: 4479 RVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFEN 4538

Query: 478  HMHALVLPGVTREDAGEVTFSLGN----SRTTTLLRVK----------CVKHSPPGPPIL 523
            ++ +L L G+  +  G+      N     R + LL VK           +  +   P  L
Sbjct: 4539 NVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATL 4598

Query: 524  AEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVP 583
               F G K    +T K  +   E     + +     +   ++  S EK            
Sbjct: 4599 QVKFSGTKE---ITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEK-----------K 4644

Query: 584  SEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTII 643
              G+Y F +   +  GRS          L+        L+ +    G      +DL  I+
Sbjct: 4645 DSGEYTFEV--QNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGS----FIDLECIV 4698

Query: 644  QGT------WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGF 697
             G+      WF + +E+ ++E          +Y+         L +  ++  DSG    +
Sbjct: 4699 AGSHPISIQWFKDDQEISASE----------KYKFSFHDNTAFLEISQLEGTDSGT---Y 4745

Query: 698  SCPGV------QDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCEL-SRVDFPATWY 750
            +C         Q S  LT++E P  +  PQ   S     + RV L   +         W+
Sbjct: 4746 TCSATNKAGHNQCSGHLTVKEPPYFVEKPQ---SQDVNPNTRVQLKALVGGTAPMTIKWF 4802

Query: 751  KDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEG----VSAFFGVTVQDPPV 806
            KD +++       V  D     L L  AK  DSG + C+        ++   + V++PP 
Sbjct: 4803 KDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQ 4862

Query: 807  HIVDPREHVFV---HAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRR 863
             I  P   + +    + T EC +      R    V WY DG E+       +        
Sbjct: 4863 FIKKPSPVLVLRNGQSTTFECQITGTPKIR----VSWYLDGNEITAIQKHGISFIDGLAT 4918

Query: 864  LVLPATQPSDGGEFQCVAGDECAYFTVTI-TDVSSWIVYPSGKVYVAAVRLERVVLTCEL 922
              +   +  + G + C A ++    + +I   V     +      V  V+   V L CE+
Sbjct: 4919 FQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEV 4978

Query: 923  C-RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE----SA 977
               P  EV W K+  E+  S    L    +V  L +      D+GEY C + +E    S 
Sbjct: 4979 TGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSC 5038

Query: 978  SFTVTVTEPPVRIIYPRDEVTLI--AVTLECVVLMCELSREDAPVRWYKDGLEVEESEAL 1035
            S  V + EPP  I    +  T++  + T +  V           + W KD   ++E + +
Sbjct: 5039 STRVALKEPPSFIKKIENTTTVLKSSATFQSTV----AGSPPISITWLKDDQILDEDDNV 5094

Query: 1036 VLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAF---FTVTVTAPPERIVHPAARSLDLH 1092
             +        L + +      G + C A ++S     +   +   P +IV   A+S+D+ 
Sbjct: 5095 YISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVE-KAKSVDVT 5153

Query: 1093 FGAPGRVELRCEVAPAGS-QVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
               P  + L C VA     +V+W KDG ++  S    +  E    +  +     +D+G+Y
Sbjct: 5154 EKDP--MTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQY 5211

Query: 1152 VCETRHEAITFNVILAEPPVQFLALETTPS------PLCVAPGEPVVLSCELSRAGAPV- 1204
              +  ++   F     +  ++ L     PS       +    G  + + C++S    P+ 
Sbjct: 5212 TFKVEND---FGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVS-GSLPIS 5267

Query: 1205 -VWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVA 1263
              W  +G+ +       L        L +          YTC+     G  + S  + V 
Sbjct: 5268 AQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVK 5327

Query: 1264 EPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGA 1322
            EPP  +V P     R ++ P   +E    L G P   ++W+KD   L S  +  +   G+
Sbjct: 5328 EPPSFLVKP----GRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGS 5383

Query: 1323 RQVLRVQGARSGDAGEYLC----DAPQDSRIFLVSVEEPLLVKLVSEL-TPLTVHEGDDA 1377
               L +    +   G+Y C    D   DS   ++ V EP   K V +L     V  GD +
Sbjct: 5384 TSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP--PKFVKKLEASKIVKAGDSS 5441

Query: 1378 TFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR---- 1432
               C+++  P+  V W RN   +    +  M    S  ++ +      D+G         
Sbjct: 5442 RLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNP 5501

Query: 1433 AGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPH 1492
            AGST+ S ++ V+E   +F      V   +  +V LE E         V W +  + L  
Sbjct: 5502 AGSTSCSTKVIVKEPP-VFSSFPPIVETLKNAEVSLECELSGTPPFEVV-WYKDKRQLRS 5559

Query: 1493 DSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH----DRTLARLSVRPRQLRVLRPLED 1548
              +  +A       + I  V  +D G Y C++ +    D  +  + ++    R +  L  
Sbjct: 5560 SKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLK-EPPRFVSKLNS 5618

Query: 1549 VTISEGGSATFQLEL-SQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSG 1607
            +T+  G  A  Q  +   + +  +W +   ++         S+  R   V N   L  + 
Sbjct: 5619 LTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIR------ESENIRITFVENVATLQFAK 5672

Query: 1608 CVSFTADSLRC-----------AARLIVREVPVTIVRGPHDLEVTEGDTATFECELS-QA 1655
                 A    C            A L+V E P  IV     + VT G+T T EC+++   
Sbjct: 5673 AEPANAGKYICQIKNDGGMRENMATLMVLE-PAVIVEKAGPMTVTVGETCTLECKVAGTP 5731

Query: 1656 LADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA----VGTARAGPVR 1711
               V W KDG  LT S + +         L++      DAGTY+      VG +    V 
Sbjct: 5732 ELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAV- 5790

Query: 1712 LTVRERTV--AVLSELRSVSAREGDGATFECTVS-EVETTGRWELGGRPLRPGARVRIRQ 1768
            + V +R V  +    L++     G     EC V+     +  W      +  GA+ +   
Sbjct: 5791 VDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTF 5850

Query: 1769 EGKKHILVLSELRAEDAGE----VRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGR 1824
                  L L+ L + D G         AG  +  A+L V+  P  +    P E  VL G+
Sbjct: 5851 SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLE--VLPGK 5908

Query: 1825 RAVLEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC--- 1880
                   +  +    V W R   EL  GD+  +        L + ++     G Y C   
Sbjct: 5909 NVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVS 5968

Query: 1881 -QAGQDSTHTRLLVE 1894
              AGQ S  TRL V+
Sbjct: 5969 NNAGQASCTTRLFVK 5983



 Score =  271 bits (694), Expect = 3e-72
 Identities = 257/1164 (22%), Positives = 461/1164 (39%), Gaps = 42/1164 (3%)

Query: 740  LSRVDFPATWYKDGQKVEESELLVVKM-DGRKHRLILPEAKVQDSGEFECRTEGV----S 794
            + + D    WYK+G K+E S+ +     +     L++ +   +DS     +   +    S
Sbjct: 2102 VGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETS 2161

Query: 795  AFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVV 854
            +   + VQ   +          V           CE       V+WYKDG EV E D   
Sbjct: 2162 SHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYR 2221

Query: 855  LENEGPHRRLVLPATQPSDGGEFQCV-AGDECAYFTVTITDVSSWIVYPSGKVYVAAVRL 913
            + ++     L +     SD  ++ CV   DE    T  +    + + +      +     
Sbjct: 2222 MHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPES 2281

Query: 914  ERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEID 973
                L C +     E +W  +  E+  +    +      + L +  V  ED GEY   ID
Sbjct: 2282 YSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVID 2341

Query: 974  DESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESE 1033
             +  +  + +   P+ I+    +  +    +  V L  ++S E     W KDG EV+ S+
Sbjct: 2342 GKKTTCKLKMKPRPIAILQGLSDQKVCEGDI--VQLEVKVSLESVEGVWMKDGQEVQPSD 2399

Query: 1034 ALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHF 1093
             + +  D     L++     ED G +           +  V+     ++ P     D++ 
Sbjct: 2400 RVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLK---DVNV 2456

Query: 1094 GAPGRVELRCEVA-PAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYV 1152
                +  L C+V+ P  + V+WY +  +++  D +Q   +G  + L +      D G Y 
Sbjct: 2457 IEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYK 2516

Query: 1153 CETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRP 1212
                      N+      V+ + +      L     + VV   ELS +G  V+W+   + 
Sbjct: 2517 LIVGRVETNCNL-----SVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKE 2571

Query: 1213 VQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAP 1272
            ++     ++ A G    L +        G YT  +G    +  L+        P+     
Sbjct: 2572 IKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTV 2631

Query: 1273 EAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGAR 1332
              +Q  V             ++ P     W +DG+ L     ++ E  G ++ L +   +
Sbjct: 2632 AESQEAV---------FECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATK 2682

Query: 1333 SGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDAD-VT 1391
              D GEY            + VE    VK+   L  LTV E  DA F  E++ P+   V 
Sbjct: 2683 LDDIGEYTYKVATSKTSAKLKVEA---VKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQ 2739

Query: 1392 WLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLF 1451
            W++NG V+    +  ++  G+   L ++ C + D      R G    SARLHV   +++ 
Sbjct: 2740 WIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKII- 2798

Query: 1452 LRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHG 1511
             ++ +DV A E   V  EV          V+W      +    +  +  +  +H+L +  
Sbjct: 2799 -KKPKDVTALENATVAFEVSVSHDTVP--VKWFHKSVEIKPSDKHRLVSERKVHKLMLQN 2855

Query: 1512 VILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGE 1571
            +  +D G Y          A+L V    L + + ++++ + E  +A+F+ E+S   V   
Sbjct: 2856 ISPSDAGEYTAVVGQLECKAKLFVET--LHITKTMKNIEVPETKTASFECEVSHFNVPSM 2913

Query: 1572 WARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTI 1631
            W + GV++    K  I   G  H+L++      DS   +F   + + +A L V   P+ I
Sbjct: 2914 WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMI 2971

Query: 1632 VRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCG 1691
                 D+   E DT TFE  ++       W K+G  +  + + +++       L +R   
Sbjct: 2972 TSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVH 3031

Query: 1692 PSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRW 1751
              DA  Y+   G A +    L V  R +     ++ +   E   A FEC VSE + T +W
Sbjct: 3032 FGDAADYTFVAGKATS-TATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQW 3090

Query: 1752 ELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMC 1811
                + L+   R++I++E   H L++   R  DAG+    AG   S A L VE   +++ 
Sbjct: 3091 MKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRI- 3149

Query: 1812 RHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELC--PGDKYEMRSHGPTHSLVIHD 1869
            R   +E  V+  +RAV+E  V+       W ++G E+     ++++       H + I +
Sbjct: 3150 RSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISE 3209

Query: 1870 VRPEDQGTYCCQAGQDSTHTRLLV 1893
             R  D G Y   AG++ +   L V
Sbjct: 3210 TRQSDAGEYTFVAGRNRSSVTLYV 3233



 Score =  269 bits (688), Expect = 2e-71
 Identities = 427/1942 (21%), Positives = 710/1942 (36%), Gaps = 258/1942 (13%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            PP F R  + V    G     +C + G  P  V W K G  L     L        H + 
Sbjct: 7115 PPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQ---TSFVHNVA 7171

Query: 71   LTAALPTDA---GVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGA 127
                L TD    G Y C A N  G A ++A + + E                     E  
Sbjct: 7172 TLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEH--------------------EVP 7211

Query: 128  PVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDG 187
            P F   P S  +  G      C   G     + W KD     E+    ++ +     E+ 
Sbjct: 7212 PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNR---EIRPGGNYKMT--LVEN- 7265

Query: 188  PGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEP 247
               +  L +L     D+G Y C+A N  G     A L V +PP              +EP
Sbjct: 7266 ---TATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRF---------IKKLEP 7313

Query: 248  LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVL 307
             +       V + +  ++ C + G PE ++ W+ +    + +  +      D   VL++ 
Sbjct: 7314 SRI------VKQDEFTRYECKIGGSPEIKVLWY-KDETEIQESSKFRMSFVDSVAVLEMH 7366

Query: 308  YCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNS 367
                +D G Y C A N+AG   S+  L VKEP + F +    +E  +     LEC++  +
Sbjct: 7367 NLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPI-FRKKPHPIETLKGADVHLECELQGT 7425

Query: 368  R-IPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT---VAN 423
                 +W+++ + L   +KY+ + E  +  + I  + A D G Y C+    V +   V +
Sbjct: 7426 PPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGS 7485

Query: 424  VTVKGPILKRLPRKLDVLEGENAVLLVET-LEAGVEGR------WSRDGEEL----PVIC 472
            + +K P     PR +  L   + V+  E  L+  +EG       W +D  E+      I 
Sbjct: 7486 IALKAP-----PRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIW 7540

Query: 473  QSSSGHMHALVLPGVTREDAGEVTFSLGNSR-------TTTLLRVKCVKHSPPGPPILAE 525
             S S ++  L    V   +AG+ T  + N         T ++L    +   P    +   
Sbjct: 7541 ISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTG 7600

Query: 526  MFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSE 585
                 + TV  T       PE    +  + +E+ S++  +     K   +++        
Sbjct: 7601 DTCTLECTVAGT-------PELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDS 7653

Query: 586  GDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDL--STII 643
            G Y F +    G   S       S   VP +     L++     G   V    +  S  I
Sbjct: 7654 GVYSFEVQNPVGKD-SCTASLQVSDRTVPPS-FTRKLKETNGLSGSSVVMECKVYGSPPI 7711

Query: 644  QGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSG--ALVGFSCPG 701
              +WF  G E+ S            +Y+         L ++ ++  DSG    +  +  G
Sbjct: 7712 SVSWFHEGNEISSGR----------KYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAG 7761

Query: 702  VQD-SAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD-FPATWYKDGQKVEES 759
              + SA LT++E P  +  P     LT T    V  T  +     F  +W+K   ++   
Sbjct: 7762 SDECSAPLTVREPPSFVQKPDPMDVLTGTN---VTFTSIVKGTPPFSVSWFKGSSELVPG 7818

Query: 760  ELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHA 819
            +   V ++     L L +     SGE+ C     +     T     ++I  P +  FV  
Sbjct: 7819 DRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTH---LYIKAPAK--FVKR 7873

Query: 820  ITSECVM----LACEVDREDAP---VRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPS 872
            +    +     L  E      P   V W K+G  V  S    +        L +P++   
Sbjct: 7874 LNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVE 7933

Query: 873  DGGEFQC----VAGDECAYFTVTITDVSSWIVYPSG-KVYVAAVRLERVVLTCELC-RPW 926
            D G++ C     +G +     + I +   ++      KV V     +   L C+L   P 
Sbjct: 7934 DAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVG----DSASLQCQLAGTPE 7989

Query: 927  AEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE----SASFTVT 982
              V W K   ++  +    +   + V  LV   V + DSGEY+C+ ++     SAS  +T
Sbjct: 7990 IGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLT 8049

Query: 983  VTE---PPVRIIYPRDEVTLIAVTLECVVLMCELS-REDAPVRWYKDGLEVEESEAL--- 1035
            V E   PP      RD    + +    VV  C +S  E   V WYKDG  +++S  +   
Sbjct: 8050 VQEQKLPPSFSRQLRDVQETVGLP---VVFDCAISGSEPISVSWYKDGKPLKDSPNVQTS 8106

Query: 1036 ---------VLERDGP-----RCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERI 1081
                     + + D        C    P          +   G +  FF + + AP + +
Sbjct: 8107 FLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRL-APVDAV 8165

Query: 1082 VHPAARSLDLHFGAPGRVELRCEVAPAGSQ---VRWYKDGLEVEASDALQLGAEGPTRTL 1138
            V  +A             +  C V   G+Q   V W KD  E+ +    Q+     +  L
Sbjct: 8166 VGESA-------------DFECHVT--GTQPIKVSWAKDSREIRSGGKYQISYLENSAHL 8210

Query: 1139 TLPHAQPEDAGEYVC----ETRHEAITFNVILAE---PPVQFLALETTPSPLCVAPGEPV 1191
            T+      D+G+Y C    E   ++ T  + + E   PP     L  T     V   E  
Sbjct: 8211 TVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSET-----VEETEGN 8265

Query: 1192 VLSCELSRAGAP---VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSG 1248
                E   AG+    V W  N   +Q     E+  +    VL ++ AG   AGLYTC+  
Sbjct: 8266 SFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVS 8325

Query: 1249 AAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVR--WYKDG 1306
               G+   + ++ + EP    V  +   T V  + G  ++L  H+ G   P+R  W K G
Sbjct: 8326 NDAGSALCTSSIVIKEPKKPPVFDQHL-TPVTVSEGEYVQLSCHVQG-SEPIRIQWLKAG 8383

Query: 1307 ERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAP----QDSRIFLVSVEEPLLVK- 1361
              +    R     A    VL ++     D+G+Y+C A      D+    V++++   V  
Sbjct: 8384 REIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAP 8443

Query: 1362 ------------LVSELTPLTVHEGDDATFRCEV-SPPDADVTWLR-NGAVVTPGPQVEM 1407
                         VSE   + V E   ATF  +V   P  +V W +     +  G +V +
Sbjct: 8444 ATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFI 8503

Query: 1408 AQNGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELLFLRRLQ-----DV 1458
             Q G    L +R     D+G     A    G   ++  L V E      R+ Q     D+
Sbjct: 8504 HQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDE------RKKQEKIEGDL 8557

Query: 1459 RAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHD------------------SRLSMAQ 1500
            RA   +   L+   G       +  ++   P  ++                    L  +Q
Sbjct: 8558 RAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQ 8617

Query: 1501 DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ 1560
            +   HRL I  +  +++     E        RLS +   + +++ +E+ T+ +   A F+
Sbjct: 8618 EEETHRLEIEEIERSERDEKEFEELVSFIQQRLS-QTEPVTLIKDIENQTVLKDNDAVFE 8676

Query: 1561 LE--LSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRC 1618
            ++  ++   +   W +G  +L P  K  I  DG RH L +    L D G           
Sbjct: 8677 IDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIA 8736

Query: 1619 AARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQA 1678
            +A+L V  +     R   D+ + EG T T  C+ S       W ++G  L P  R + + 
Sbjct: 8737 SAKLTV--IEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEV 8794

Query: 1679 LGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATF 1738
                  L +      D G Y+C           L +    +     ++++   E   ATF
Sbjct: 8795 EHKVHKLTIADVRAEDQGQYTCKYEDLETS-AELRIEAEPIQFTKRIQNIVVSEHQSATF 8853

Query: 1739 ECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA-----G 1793
            EC VS  +    W  G   L    +   R +G+ H + +  +  +D G     A     G
Sbjct: 8854 ECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRG 8913

Query: 1794 PAQSLALLEVEALPLQMCRHPP 1815
             A+S A L +    +++   PP
Sbjct: 8914 EARSTAELYLTTKEIKLELKPP 8935



 Score =  260 bits (664), Expect = 1e-68
 Identities = 449/2015 (22%), Positives = 755/2015 (37%), Gaps = 272/2015 (13%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            P   +  P P+ V +G    L+CVV G P     W K G++L+A  +           L 
Sbjct: 6644 PARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLK 6703

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            +  A  +D G+Y    +N+ G++    +V V            ++R +P        P F
Sbjct: 6704 IPCAEMSDKGLYSFEVKNSVGKSNCTVSVHV------------SDRIVP--------PSF 6743

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGA 190
            +   +    + GA VVL CR  G    ++ W +DG  +      S    Q   +E+    
Sbjct: 6744 IRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEI-----VSGPKCQSSFSENVCTL 6798

Query: 191  SLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKC 250
            +L+L        D+G+Y C A N  G  +  A+L V +PP                  + 
Sbjct: 6799 NLSL----LEPSDTGIYTCVAANVAGSDECSAVLTVQEPPS----------------FEQ 6838

Query: 251  APKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQ 310
             P +  V  G    F   + G P  +++W    R L+P     +  + D    L++   Q
Sbjct: 6839 TPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLE-DFVTELELFEVQ 6897

Query: 311  AKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSR-I 369
              + G Y C   N AG       L VKEP   F + L D         VLE     +  I
Sbjct: 6898 PLESGDYSCLVTNDAGSASCTTHLFVKEPAT-FVKRLADFSVETGSPIVLEATYTGTPPI 6956

Query: 370  PTAWFREDQRLLPCRKYE--QIEEGTVRRLIIHRLKADDDGIYLCEMR---GRVRTVANV 424
              +W +++  +    +      E+ T+  ++   +  +D   Y C +    G+    A V
Sbjct: 6957 SVSWIKDEYLISQSERCSITMTEKSTILEILESTI--EDYAQYSCLIENEAGQDICEALV 7014

Query: 425  TVKGPILKRLPRKLDVLEGENAVL-LVETLEAGVEGR------WSRDGEEL---PVICQS 474
            +V  P     P  ++ LE   AV+    TL+  V+G       W ++  +L   P     
Sbjct: 7015 SVLEP-----PYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQ 7069

Query: 475  SSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTV 534
               ++ +LV+  V   D GE +    NS          V  +   PP  A   K    T+
Sbjct: 7070 FKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETL 7129

Query: 535  LLTWKPPEPAPETPFIYRLERQEVGSEDW------------IQCFSIEKAGAVEVPGDCV 582
                          F  R+   E     W            +Q   +     +++     
Sbjct: 7130 GFP---------VAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQ 7180

Query: 583  PSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYD-----GEDAVFSL 637
               G Y    C+ S    +P      SA L+ +   V    D++        GE   F  
Sbjct: 7181 SHIGQYN---CSAS----NPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKC 7233

Query: 638  DLSTI--IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALV 695
             ++    I+ TW  +  E++         PG   Y++        L +  V   D+G   
Sbjct: 7234 HVTGTAPIKITWAKDNREIR---------PGG-NYKMTLVENTATLTVLKVGKGDAGQYT 7283

Query: 696  GFSC--PGVQD-SAALTIQESPVHI--LSPQDRVSLT-FTTSERVVLTCELS-RVDFPAT 748
             ++    G    SA L +QE P  I  L P   V    FT  E     C++    +    
Sbjct: 7284 CYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYE-----CKIGGSPEIKVL 7338

Query: 749  WYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGV----SAFFGVTVQDP 804
            WYKD  +++ES    +        L +    V+DSG++ C         S+   + V++P
Sbjct: 7339 WYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEP 7398

Query: 805  PVHIVDPREHVFVHAITSECVMLACEVDREDA-PVRWYKDGQEVEESDFVVLENEGPHRR 863
            P+    P     +  +    V L CE+       V WYKD +E+       + +E     
Sbjct: 7399 PIFRKKPHP---IETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTS 7455

Query: 864  LVLPATQPSDGGEFQC-----VAGDECA---------YFTVTITDVSSWIVYPSGKVYVA 909
            + +     +D GE+QC     V  D C           F   ++D+S+ +    GK    
Sbjct: 7456 IHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVV----GK---- 7507

Query: 910  AVRLERVVLTCELCRPWAEVRWTKD-GEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEY 968
             V+L+    T E   P + V W KD GE V ES  + +   + +  L    V+  ++G+Y
Sbjct: 7508 EVQLQT---TIEGAEPISVV-WFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKY 7563

Query: 969  LCEIDDESAS----FTVTVTEPPVRIIYPRD--EVTLIAVTLECVVLMCELSREDAPVRW 1022
             C+I +++       T++V EP   +  P      T    TLEC V        +   +W
Sbjct: 7564 TCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVA----GTPELSTKW 7619

Query: 1023 YKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDA----GDDSAFFTVTVTAPP 1078
            +KDG E+       +        L +    P D G +  +     G DS   ++ V+   
Sbjct: 7620 FKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS--- 7676

Query: 1079 ERIVHPA-ARSLDLHFGAPGR-VELRCEVAPAGS-QVRWYKDGLEVEASDALQLGAEGPT 1135
            +R V P+  R L    G  G  V + C+V  +    V W+ +G E+ +    Q      T
Sbjct: 7677 DRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNT 7736

Query: 1136 RTLTLPHAQPEDAGEYVCETRHEA----ITFNVILAEPPVQFLALETTPSPLCVAPGEPV 1191
              LT+   +  D+G+Y C   + A     +  + + EPP    +    P P+ V  G  V
Sbjct: 7737 CALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPP----SFVQKPDPMDVLTGTNV 7792

Query: 1192 VLSCELSRAGAP---VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSG 1248
              +  +   G P   V W      +  G+   +  E     L +     + +G YTC   
Sbjct: 7793 TFTSIVK--GTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVS 7850

Query: 1249 AAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGP---VRWYKD 1305
               G  S +  + + + P + V      +  +  P     L++  +  G P   V W K+
Sbjct: 7851 NEAGKASCTTHLYI-KAPAKFVKRLNDYSIEKGKP-----LILEGTFTGTPPISVTWKKN 7904

Query: 1306 GERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC-----DAPQDSRIFLVSVEEPLLV 1360
            G  +    R  +       +L +  +   DAG+Y C              ++ +E P  V
Sbjct: 7905 GINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFV 7964

Query: 1361 KLVSELTPLTVHEGDDATFRCEVS-PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLR 1419
            K   +L P+ V  GD A+ +C+++  P+  V+W +    + P    +M    +   L   
Sbjct: 7965 K---QLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFN 8021

Query: 1420 GCQLGDAGTVTLRA----GSTATSARLHVRETEL--LFLRRLQDVRAEEGQDVCLEVETG 1473
               + D+G    +A    G  + S  L V+E +L   F R+L+DV+   G  V  +    
Sbjct: 8022 QVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAIS 8081

Query: 1474 RVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARL 1533
                  +V W + G+PL     +  +   +   L I     +  G Y C + +    A  
Sbjct: 8082 GSEPI-SVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASS 8140

Query: 1534 SVRPRQLRVLRP------LEDVTISEGGSATFQLELS-QEGVTGEWARGGVQLYPGPKCH 1586
            S R        P      L  V    G SA F+  ++  + +   WA+   ++  G K  
Sbjct: 8141 SARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQ 8200

Query: 1587 IHSDGHRHRLVLNGLGLADSGCVSFTA------DSLRCAARLIVRE---VPVTIVRGPHD 1637
            I    +   L +  +   DSG  +  A      DS  C A+L ++E    P    R    
Sbjct: 8201 ISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDS--CTAQLNIKERLIPPSFTKRLSET 8258

Query: 1638 LEVTEGDTATFECEL--SQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDA 1695
            +E TEG++   E  +  SQ +  V W K+   + P+    +       +LQ+R+ G +DA
Sbjct: 8259 VEETEGNSFKLEGRVAGSQPIT-VAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDA 8317

Query: 1696 GTYSCAVGTARAGPV---RLTVRE--RTVAVLSELRSVSAREGDGATFECTVSEVETTG- 1749
            G Y+C V       +    + ++E  +       L  V+  EG+     C V   E    
Sbjct: 8318 GLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRI 8377

Query: 1750 RWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQ----AGPAQSLALLEVEA 1805
            +W   GR ++P  R          +L L ++   D+G+   +    AG   + + + ++ 
Sbjct: 8378 QWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD 8437

Query: 1806 LPLQMCRHPPREKTVLVGR----------RAVLEVT---VSRSGG----HVCWLR-EGAE 1847
             P      P  +K  + GR          R V + T   +++ GG    +V W + +  +
Sbjct: 8438 KPAVA---PATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQ 8494

Query: 1848 LCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA 1882
            L  G +  +   G    L I D    D G Y C A
Sbjct: 8495 LNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVA 8529



 Score =  250 bits (638), Expect = 1e-65
 Identities = 427/1953 (21%), Positives = 726/1953 (37%), Gaps = 233/1953 (11%)

Query: 23   VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERL--SFPADGAEHGLLLTAALPTDAG 80
            V  G++A  +  V+G+P P   W K G ++  S+R+   +P D     L++      D+ 
Sbjct: 2089 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCE-LVIRDVTAEDSA 2147

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL 140
              + +A N AGE  + A + V                           +  T      V 
Sbjct: 2148 SIMVKAINIAGETSSHAFLLVQAKQL----------------------ITFTQELQDVVA 2185

Query: 141  RGAEVVLT--CRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILA 198
            +  + + T  C     P   + W KDGM   EV +   + +   R          L IL 
Sbjct: 2186 KEKDTMATFECETSE-PFVKVKWYKDGM---EVHEGDKYRMHSDRKVH------FLSILT 2235

Query: 199  ARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVN 258
                D+  Y C             L++      +     + A    V+ L    +   V 
Sbjct: 2236 IDTSDAEDYSC------------VLVEDENVKTTAKLIVEGAVVEFVKEL----QDIEVP 2279

Query: 259  EGKHAKFRCYVMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLY 317
            E    +  C V   PE  IE  W    + L    +     R G   L V     +D+G Y
Sbjct: 2280 ESYSGELECIV--SPE-NIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2336

Query: 318  VCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFRED 377
                        +  +L +K   +   + L D +  E  I  LE KV    +   W ++ 
Sbjct: 2337 SFVIDGKK----TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDG 2392

Query: 378  QRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYL-------CEMRGRVRTVANVTVKGPI 430
            Q + P  +   + +     L+I  +  +D G Y            GRV +V +V V  P+
Sbjct: 2393 QEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV-SVYSVDVITPL 2451

Query: 431  LKRLPRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPV---ICQSSSGHMHALVLPG 486
                 + ++V+EG  AVL  +     V   +W  + E++     +     G    LV+  
Sbjct: 2452 -----KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINR 2506

Query: 487  VTREDAGEVTFSLGNSRTTTLLRVKCVK--------HSPPGPPILAEMFKGHKN-TVLLT 537
                D G     +G   T   L V+ +K               ++ E+   H    VL  
Sbjct: 2507 THASDEGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWN 2566

Query: 538  WKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSG 597
            +K  E  P +   Y++E              I K   + +  D    EG Y F       
Sbjct: 2567 FKDKEIKPSSK--YKIEAHG----------KIYKLTVLNMMKD---DEGKYTF---YAGE 2608

Query: 598  HGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLST-IIQGTWFLNGEELKS 656
            +  S  +   G A   P       L D  V + ++AVF  +++    +G W  +G+ L  
Sbjct: 2609 NMTSGKLTVAGGAISKP-------LTDQTVAESQEAVFECEVANPDSKGEWLRDGKHL-- 2659

Query: 657  NEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVH 716
                    P     R E  G + RLI+ A K  D G    +     + SA L ++   + 
Sbjct: 2660 --------PLTNNIRSESDGHKRRLIIAATKLDDIGEYT-YKVATSKTSAKLKVEAVKI- 2709

Query: 717  ILSPQDRVSLTFTTSERVVLTCELSRVDFPAT-WYKDGQKVEESELLVVKMDGRKHRLIL 775
                +   +LT T ++  V T EL+  +     W K+G  +E +E   + + G  + L +
Sbjct: 2710 ---KKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRI 2766

Query: 776  PEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDRED 835
                + D   +  R   + A   + V+   + I  P++   V A+ +  V     V  + 
Sbjct: 2767 KNCAIVDESVYGFRLGRLGASARLHVETVKI-IKKPKD---VTALENATVAFEVSVSHDT 2822

Query: 836  APVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGD-ECA----YFTV 890
             PV+W+    E++ SD   L +E    +L+L    PSD GE+  V G  EC       T+
Sbjct: 2823 VPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETL 2882

Query: 891  TITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKED 950
             IT     I  P  K              CE+        W K+G E+  S    +  + 
Sbjct: 2883 HITKTMKNIEVPETKT---------ASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQG 2933

Query: 951  TVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLM 1010
             + +L++     EDS EY     ++  S T+TVT  P+ I     ++   A   + +   
Sbjct: 2934 KLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT--PIMITSMLKDIN--AEEKDTITFE 2989

Query: 1011 CELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFF 1070
              ++ E    +W K+G+E++ ++   +        L +      D  ++   AG  ++  
Sbjct: 2990 VTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTA 3049

Query: 1071 TVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLG 1130
            T+ V A   R +       D+      R    CEV+     V+W KD  E++ +D +++ 
Sbjct: 3050 TLYVEA---RHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQ 3106

Query: 1131 AEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEP 1190
             E     L +P  +  DAG+Y         T  + +    V+  +++     + V   + 
Sbjct: 3107 KEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIK---KEVQVIEKQR 3163

Query: 1191 VVLSCELSRAGAPVVWSHNGRPV--QEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSG 1248
             V+  E++       W  +G  +  Q  E  +   E     + I     + AG YT  +G
Sbjct: 3164 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3223

Query: 1249 AAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGE 1307
                  S++  V   EPP   V  E     V+S  G        +SG P   + WYK+ +
Sbjct: 3224 R--NRSSVTLYVNAPEPP--QVLQELQPVTVQS--GKPARFCAVISGRPQPKISWYKEEQ 3277

Query: 1308 RLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFL----VSVEEPLLVK-- 1361
             L++  + +    G    L +  A   DA  Y C+A  D  +      +SVE P +V   
Sbjct: 3278 LLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPD 3337

Query: 1362 ---------LVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGS 1412
                     +++ L      EG  A F+C VS  D  V+W      + P     M Q   
Sbjct: 3338 QEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFED 3397

Query: 1413 SRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELLFLRRL-QDVRAE------ 1461
            +  L +      D GT T  A    G  +++A L +   E +   R+ Q++  E      
Sbjct: 3398 TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPV 3457

Query: 1462 -EGQDVCLEVETG-------RVGAAGAVR--WVRGGQPLPHDSRLSMAQDGHIHRLFIHG 1511
             + +   LEV  G        + +A  VR  W + G+ +    + S+    +I  L I  
Sbjct: 3458 IKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILR 3517

Query: 1512 VILADQGTYGCESHHD-------RTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELS 1564
              + D G Y C++ ++        TL      P    + RP + +T   G +A F   ++
Sbjct: 3518 TQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTF-LSRP-KSLTTFVGKAAKFICTVT 3575

Query: 1565 QEGVTGE-WARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSL----RCA 1619
               V    W + G  L P P   I    ++H L L+ L + D G  S  A +      C 
Sbjct: 3576 GTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQ 3635

Query: 1620 ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQ-ALADVTWEKDGNALTPSPRLRLQA 1678
            A LI+ + P   ++    ++         EC++ +     VTW KDG  L P    ++  
Sbjct: 3636 AELIIIDKP-HFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICF 3694

Query: 1679 LGTRRLLQLRRCGPSDAGTYSCAVGT---ARAGPVRLTVRERTVAVLSELRSVSAREGDG 1735
                  L++      D+GTY C       + +    +TVRE    V     S     G+ 
Sbjct: 3695 EDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGES 3754

Query: 1736 ATFECTVS---EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA 1792
            A   C +     ++ T  W    + L     VR+     + IL +++++ ED+G    +A
Sbjct: 3755 ARLHCKLKGSPVIQVT--WFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEA 3812

Query: 1793 ----GPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGG-HVCWLREGAE 1847
                G       + ++  P  +    P +  ++ G  A+L+  VS +G   + W ++  +
Sbjct: 3813 VNDVGSDSCSTEIVIKEPPSFIKTLEPAD--IVRGTNALLQCEVSGTGPFEISWFKDKKQ 3870

Query: 1848 LCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC 1880
            +    KY + S      L I      D G Y C
Sbjct: 3871 IRSSKKYRLFSQKSLVCLEIFSFNSADVGEYEC 3903



 Score =  246 bits (628), Expect = 2e-64
 Identities = 447/2002 (22%), Positives = 729/2002 (36%), Gaps = 236/2002 (11%)

Query: 7    DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE 66
            D+  PP F R  +    V GA   L+C V G  P  V W     ++ +  +         
Sbjct: 5795 DRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNV 5854

Query: 67   HGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEG 126
              L L +   +D G Y C A N AG     A +TV EPP+   E +P E           
Sbjct: 5855 CTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLE----------- 5903

Query: 127  APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
                        VL G  V  T    G P   + W +    L +  D  +   +   AE 
Sbjct: 5904 ------------VLPGKNVTFTSVIRGTPPFKVNWFRGARELVK-GDRCNIYFEDTVAE- 5949

Query: 187  GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
                   L +    +  SG Y C   N  G A     L V +P        D +    VE
Sbjct: 5950 -------LELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHS----VE 5998

Query: 247  PLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKV 306
            P            GK         G     + W  +G  +    +  +    +   +L++
Sbjct: 5999 P------------GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIV-TTEKTCILEI 6045

Query: 307  LYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
            L    +D G Y C   N AG+ +    +   EP   F   L+ +E        L+C+V  
Sbjct: 6046 LNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPY-FVTELEPLEAAVGDSVSLQCQVAG 6104

Query: 367  S-RIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVT 425
            +  I  +W++ D +L P  +Y       V  L+ +++  +D G Y C+    + T ++ T
Sbjct: 6105 TPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKT 6164

Query: 426  VKGPILKRLPRKL--DVLEGENAVLLVETLEAGVEGR------WSRDGEEL---PVICQS 474
            V     ++LP      + + E  V L  TL   + G       W RDG  L     +  S
Sbjct: 6165 VFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTS 6224

Query: 475  SSGHMHALVLPGVTREDAGEVTFS----LGNSRTTTLLRVKCVKHSP--PGPPILAEMFK 528
               ++  L +       +G+ + S    LG + ++  L  +  K SP     P+  ++  
Sbjct: 6225 FVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIA 6284

Query: 529  GHKNTVLLTWKPPEPAPETPFIYRLERQEV--GSEDWIQC------FSIEKAGAVEVPGD 580
            G            +P   T   +  + +E+  G    I C        I K G  +    
Sbjct: 6285 GESADFECHVTGAQPMRIT---WSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQY 6341

Query: 581  CVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQV-YDGEDAVFSLDL 639
               +  D    +C+     + P              + V  LE  +V   GE    S+ L
Sbjct: 6342 TCQATNDVGKDMCSAQLSVKEP-------------PKFVKKLEASKVAKQGE----SIQL 6384

Query: 640  STIIQGT------WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGA 693
               I G+      WF N  EL            + +Y +        L ++    +DSG 
Sbjct: 6385 ECKISGSPEIKVSWFRNDSELHE----------SWKYNMSFINSVALLTINEASAEDSGD 6434

Query: 694  LVGFSCPGVQD---SAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRV-DFPATW 749
             +  +  GV D   S ALT++  PV    P    +L       V+L CE+S    F   W
Sbjct: 6435 YICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGAL---KGSDVILQCEISGTPPFEVVW 6491

Query: 750  YKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGV----SAFFGVTVQDPP 805
             KD ++V  S+   +        L +   +  D GE+ C+        +    V  ++PP
Sbjct: 6492 VKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPP 6551

Query: 806  VHIVDPREHVFVHAITSECVMLACEVDR-EDAPVRWYKD-GQEVEESDFVVLENEGPHRR 863
              +   ++      +  + V L   V+  +   V W KD G+ + ES+   +        
Sbjct: 6552 RFV---KKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIAT 6608

Query: 864  LVLPATQPSDGGEFQCV----AGDECAYFTVTITDVSSWIVYPSGKVYVAA--VRLERVV 917
            L L + + S+ G++ C     AG       +T+ + +  I  P            LE VV
Sbjct: 6609 LQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVV 6668

Query: 918  LTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESA 977
                   P    +W KDG E+       +   + V  L +P  ++ D G Y  E+ +   
Sbjct: 6669 TG----TPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVG 6724

Query: 978  SFTVTVT-EPPVRIIYP---RDEVTLIAVTLECVVLMCELSREDAP--VRWYKDGLEVEE 1031
                TV+     RI+ P   R    + A+    VVL C +S   AP  V W++DG E+  
Sbjct: 6725 KSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVS-GSAPISVGWFQDGNEIVS 6783

Query: 1032 SEALVLERDGPRCRLVLPAAQPEDGGEFVC----DAGDDSAFFTVTVTAPPERIVHPAAR 1087
                        C L L   +P D G + C     AG D     +TV  PP     P + 
Sbjct: 6784 GPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSV 6843

Query: 1088 SLDLHFGAPGRVELRCEVAPAGS---QVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQ 1144
             +      PG + L       G+   +V+W+K   E+   ++  +  E     L L   Q
Sbjct: 6844 EV-----LPG-MSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQ 6897

Query: 1145 PEDAGEYVCETRHEA----ITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA 1200
            P ++G+Y C   ++A     T ++ + EP      L    +   V  G P+VL  E +  
Sbjct: 6898 PLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRL----ADFSVETGSPIVL--EATYT 6951

Query: 1201 GAP---VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLS 1257
            G P   V W  +   + + E   +       +L I  +       Y+C      G     
Sbjct: 6952 GTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICE 7011

Query: 1258 FTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQ 1316
              V V EPP  +   E     V +  G    L   + G P   + WYK+  +L S    +
Sbjct: 7012 ALVSVLEPPYFIEPLE----HVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYK 7067

Query: 1317 LEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPL------T 1370
            ++       L +      D GEY C A  D+ +  V+    L++K   +L P        
Sbjct: 7068 MQFKNNVASLVINKVDHSDVGEYSCKA--DNSVGAVASSAVLVIK-ARKLPPFFARKLKD 7124

Query: 1371 VHE--GDDATFRCEVSPPD-ADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAG 1427
            VHE  G    F C ++  +   V+W ++G ++     ++ +   +   L +        G
Sbjct: 7125 VHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIG 7184

Query: 1428 TVTLRA----GSTATSARLHVRETELLFLRRLQDVR-----AEEGQDVCLEVETGRVGAA 1478
                 A    G+ ++SA+L + E E+     L+ V       E G   C    T  +   
Sbjct: 7185 QYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPI--- 7241

Query: 1479 GAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHH----DRTLARLS 1534
              + W +  + +       M    +   L +  V   D G Y C + +    D   A+L 
Sbjct: 7242 -KITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLG 7300

Query: 1535 VR--PRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGH 1592
            V+  PR ++ L P   V   E      ++  S E +   W +   ++    K  +     
Sbjct: 7301 VQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPE-IKVLWYKDETEIQESSKFRMSFVDS 7359

Query: 1593 RHRLVLNGLGLADSG---CVSF-TADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATF 1648
               L ++ L + DSG   C +   A S   +  L V+E P+   + PH +E  +G     
Sbjct: 7360 VAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPI-FRKKPHPIETLKGADVHL 7418

Query: 1649 ECELSQALA-DVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA----VG 1703
            ECEL       V+W KD   L    + ++ +      + +     +D G Y C     VG
Sbjct: 7419 ECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVG 7478

Query: 1704 T-ARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVE--TTGRWELGGRPLRP 1760
            +    G + L    R V  LS++ +V  +E      + T+   E  +   ++  G  +R 
Sbjct: 7479 SDTCVGSIALKAPPRFVKKLSDISTVVGKE---VQLQTTIEGAEPISVVWFKDKGEIVRE 7535

Query: 1761 GARVRIRQEGKKHILVLSELRAEDAG----EVRFQAGPAQSLALLEVEALPLQMCRHPPR 1816
               + I        L  S +   +AG    +++  AG  +  A L V  L        P 
Sbjct: 7536 SDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSV--LEPATIVEKPE 7593

Query: 1817 EKTVLVGRRAVLEVTVSRSGG-HVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQ 1875
               V  G    LE TV+ +      W ++G EL   +KY++        L I +V P D 
Sbjct: 7594 SIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDS 7653

Query: 1876 GTYCCQ----AGQDSTHTRLLV 1893
            G Y  +     G+DS    L V
Sbjct: 7654 GVYSFEVQNPVGKDSCTASLQV 7675



 Score =  223 bits (569), Expect = 1e-57
 Identities = 392/1776 (22%), Positives = 676/1776 (38%), Gaps = 221/1776 (12%)

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
            K   V E K A F C V  +P+  ++W  + + L    R  + +++   +V ++L    +
Sbjct: 3065 KDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEK---YVHRLLIPSTR 3120

Query: 313  --DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP 370
              D G Y   A    G  +S  +L V+   +R     ++V+  E   AV+E +V    + 
Sbjct: 3121 MSDAGKYTVVA----GGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVD 3176

Query: 371  TAWFRE--DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKG 428
              W+++  +       +++ + E  + R+ I   +  D G Y   + GR R+   + V  
Sbjct: 3177 AHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNA 3235

Query: 429  P----ILKRLPRKLDVLEGENAVLLV----------------ETLEAGVEGRWSRDGEEL 468
            P    +L+ L + + V  G+ A                    + L  G + ++  DG+E 
Sbjct: 3236 PEPPQVLQEL-QPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEY 3294

Query: 469  PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFK 528
             ++   +     A V     + D G  T S   S     + V   +  P  PP +    +
Sbjct: 3295 TLLLIEAFPE-DAAVYTCEAKNDYGVATTSASLSVEVPEV-VSPDQEMPVYPPAIITPLQ 3352

Query: 529  GHKNTVLLTWKPPE-----PAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVP 583
               +TV    +P          +    +  + +++    + +    E    +E+      
Sbjct: 3353 ---DTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPE 3409

Query: 584  SEGDYRFRICTVSGHGRS--------PHVVFHGSAHLVPTARLVAG------LEDVQVYD 629
             EG Y F      G   S        P  + H          + A       +E ++V  
Sbjct: 3410 DEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVAL 3469

Query: 630  GEDAVFSLDLSTI--IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVK 687
            G  A F+ ++ +   ++  WF  G E+  ++          +  I        L +   +
Sbjct: 3470 GHLAKFTCEIQSAPNVRFQWFKAGREIYESD----------KCSIRSSKYISSLEILRTQ 3519

Query: 688  HQDSGALVGFSCPG------VQDSAALTIQES--PVHILSPQDRVSLTFTTSERVVLTCE 739
              D G    ++C        V  +A LT+ E+  P  +  P+   SLT    +     C 
Sbjct: 3520 VVDCGE---YTCKASNEYGSVSCTATLTVTEAYPPTFLSRPK---SLTTFVGKAAKFICT 3573

Query: 740  LSRVDFPAT-WYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFG 798
            ++      T W KDG  +  S    +     KH L L    +QD G + C+    S  FG
Sbjct: 3574 VTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKA---SNKFG 3630

Query: 799  VTVQDPPVHIVDP----REHVFVHAITSECVMLACEVDRE-DAPVRWYKDGQEVEESDFV 853
              +    + I+D     +E   V +  ++ V L C+VD +    V W KDGQ++      
Sbjct: 3631 ADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDY 3690

Query: 854  VLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYF----TVTITDVSSWIVYPSGKVYVA 909
             +  E     L +P  +  D G + C A +E        TVT+ +  S++     KV  +
Sbjct: 3691 KICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVK----KVDPS 3746

Query: 910  AVRL--ERVVLTCELC-RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSG 966
             + L  E   L C+L   P  +V W K+ +E+ ES  + +   ++   L +  V++EDSG
Sbjct: 3747 YLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSG 3806

Query: 967  EYLCE----IDDESASFTVTVTEPP--VRIIYPRDEVTLIAVTLECVVLMCELSREDAPV 1020
             Y CE    +  +S S  + + EPP  ++ + P D V      L+C V           +
Sbjct: 3807 SYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVS----GTGPFEI 3862

Query: 1021 RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC----DAGDDSAFFTVTVTA 1076
             W+KD  ++  S+   L        L + +    D GE+ C    + G      T  +  
Sbjct: 3863 SWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKE 3922

Query: 1077 PPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQ---VRWYKDGLEVEASDALQLGAEG 1133
            PP  +     + +D      G+  +  + A  GS+   V W K    +     +++    
Sbjct: 3923 PPTFV-----KKVDDLIALGGQT-VTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSN 3976

Query: 1134 PTRTLTLPHAQPEDAGEYVCETRHEA---ITFNVILAEPPVQFLALETTPSPLCVAPGEP 1190
                L +P  Q    G+Y C   +EA    +   ++ + P + +        + V  G+P
Sbjct: 3977 GVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAEL---IQVTAGDP 4033

Query: 1191 VVLSCELSRAGAPVV---WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQS 1247
              L  E + AG P +   W  +GRP+   +   +  +     L   +A    +G YT + 
Sbjct: 4034 ATL--EYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEI 4091

Query: 1248 GAAPGAPSLSFTVQVAEPPVRVVAPEAAQT--RVRSTPGGDLELVVHLSGPGGPVR--WY 1303
                G+ S   T  V +   R +AP   +    V S   G   L   ++G   P+R  W+
Sbjct: 4092 SNEVGSSSCETTFTVLD---RDIAPFFTKPLRNVDSVVNGTCRLDCKIAG-SLPMRVSWF 4147

Query: 1304 KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAP-----QDSRIFLVSVEEPL 1358
            KDG+ +A+  R ++        L +      DAG + C A      +DS   L+  E P 
Sbjct: 4148 KDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPP- 4206

Query: 1359 LVKLVSELTPLTVHEGDDATFRC--EVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRIL 1416
                V++     V  G     +   + S P   + W +    +  G    + +      L
Sbjct: 4207 --SFVTKPGSKDVLPGSAVCLKSTFQGSTP-LTIRWFKGNKELVSGGSCYITKEALESSL 4263

Query: 1417 TLRGCQLGDAGTVTLR----AGSTATSARLHVRETELLFLRRLQDV----RAEEGQDVCL 1468
             L   +  D+GT T +    AG    SA L V+E    F+ +L+      + +  Q  C 
Sbjct: 4264 ELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPAT-FVEKLEPSQLLKKGDATQLACK 4322

Query: 1469 EVETGRVGAAGAVRWVRGGQPLPHDS--RLSMAQDGHIHRLFIHGVILADQGTYGCE--- 1523
               T  +     + W    + +   S  R+S  +   + RL   G+   D G Y CE   
Sbjct: 4323 VTGTPPI----KITWFANDREIKESSKHRMSFVESTAVLRLTDVGI--EDSGEYMCEAQN 4376

Query: 1524 ---SHHDRTLARLSVRPRQLRVLRPLE-----DVTISEGGSATFQLELSQEGVTGEWARG 1575
               S H  ++  +   P   +  +P+E     DV +    + T   E++       W + 
Sbjct: 4377 EAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEIT-------WFKD 4429

Query: 1576 GVQLYPGPKCHIHSDGHRHRLVLNGLGLADSG---C-VSFTADSLRCAARLIVREVPVTI 1631
               L  G K       H   L +     AD+G   C V+    S  C+AR+ +RE P + 
Sbjct: 4430 NTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPP-SF 4488

Query: 1632 VRGPHDLEVTEGDTATFECELSQALA-DVTWEKDGNALTPSPRLRLQALGTRRLLQLRRC 1690
            ++         G TA F+  L  +L   VTW KD + +T    +R+        L L   
Sbjct: 4489 IKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGI 4548

Query: 1691 GPSDAGTYSCAV----GTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEV- 1745
                 G Y C      G  R   + L+V+E    +  E  S+   +GD AT +   S   
Sbjct: 4549 EVKHDGKYVCQAKNDAGIQRCSAL-LSVKE-PATITEEAVSIDVTQGDPATLQVKFSGTK 4606

Query: 1746 ETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRF--QAGPAQSLALLEV 1803
            E T +W   G+ L  G++ +I       IL +     +D+GE  F  Q    +S     +
Sbjct: 4607 EITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARI 4666

Query: 1804 EALPLQMCRHPP------REKTVLVGRRAVLEVTVSRSGGH---VCWLREGAELCPGDKY 1854
              L L +   PP      ++   + G    LE  V+  G H   + W ++  E+   +KY
Sbjct: 4667 NVLDLII---PPSFTKKLKKMDSIKGSFIDLECIVA--GSHPISIQWFKDDQEISASEKY 4721

Query: 1855 EMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTR 1890
            +   H  T  L I  +   D GTY C A   + H +
Sbjct: 4722 KFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQ 4757



 Score =  212 bits (539), Expect = 3e-54
 Identities = 217/957 (22%), Positives = 410/957 (42%), Gaps = 63/957 (6%)

Query: 253   KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
             K   V  G+ A F C +  +  P +EW+ +G+ L P  + ++ R       L +   + +
Sbjct: 12203 KDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDK-VVPRSEGKVHTLTLRDVKLE 12260

Query: 313   DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA 372
             D G     A++      +   L VKEP + FT+PL+D    E   AVLEC+V        
Sbjct: 12261 DAGEVQLTAKDFK----THANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVK 12316

Query: 373   WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILK 432
             WF+    +L  +KYE + +G VR+L+IH    +D   Y C+ +   +T  N+ V  P ++
Sbjct: 12317 WFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD-FKTSCNLNVVPPHVE 12375

Query: 433   --RLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SSSGHMHALVLPGV 487
               R    L V E E A    E      + +W +DG E+    +    S G +  LV+   
Sbjct: 12376 FLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKC 12435

Query: 488   TREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPET 547
               +D  E +  +  +RT+ +L V  ++        LA +     +T+ L  +  +P  E 
Sbjct: 12436 LLDDEAEYSCEVRTARTSGMLTV--LEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEV 12493

Query: 548   PFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFH 607
               I+    +E+      +  +  +   + +    +   G+Y  R+ +    G+   V  H
Sbjct: 12494 --IWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGK---VKVH 12548

Query: 608   GSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLS-TIIQGTWFLNGEELKSNEPEGQVEPG 666
               A     A  ++  +++++ +GE A F   +S       W  + + L+S +        
Sbjct: 12549 ELA-----AEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGD-------- 12595

Query: 667   ALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSL 726
               +Y +   G +  L++     QD G  V       + +A LT+ E    ++  +D    
Sbjct: 12596 --KYDVIADGKKRVLVVKDATLQDMGTYV-VMVGAARAAAHLTVIEKLRIVVPLKD---T 12649

Query: 727   TFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEF 786
                  + VV  CE++     A W+++ + + +S   ++      + L + +A + D   +
Sbjct: 12650 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 12709

Query: 787   EC-----RTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWY 841
                    R E V +   + V++  + IV+P +   +  +  + V   C+V+R +  ++W 
Sbjct: 12710 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKD--IETMEKKSVTFWCKVNRLNVTLKWT 12767

Query: 842   KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
             K+G+EV   + V    +     L +      D GE+   AG + +   + I +  +  V 
Sbjct: 12768 KNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 12827

Query: 902   PSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQ 961
                   V     +  V +C+L R  A V+W ++G E+ E      +K+ ++ RL++   +
Sbjct: 12828 HLEDQTV--TEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCR 12885

Query: 962   LEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVR 1021
             L+D  EY C ++D  +   + V E PV II P  ++  +      VV + EL+++   V+
Sbjct: 12886 LDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDI--LEAPGADVVFLAELNKDKVEVQ 12943

Query: 1022  WYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERI 1081
             W ++ + V + +   +  +G   RL +   +P D GE+   A D  A   + + A P+  
Sbjct: 12944 WLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPK-- 13001

Query: 1082  VHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLP 1141
             +  A + L +  G P  + +  +  P  ++  W+K   E E      +       +  + 
Sbjct: 13002 IKTADQDLVVDVGKPLTMVVPYDAYPK-AEAEWFK---ENEPLSTKTIDTTAEQTSFRIL 13057

Query: 1142  HAQPEDAGEY--VCETRHEA----ITFNVILAEPPVQFLAL-ETTPSPLCVAPGEPV 1191
              A+  D G Y  V + +H      I   VI    PV+ L + ET    + +A  EP+
Sbjct: 13058 EAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPL 13114



 Score =  202 bits (514), Expect = 3e-51
 Identities = 155/558 (27%), Positives = 257/558 (46%), Gaps = 27/558 (4%)

Query: 1353 SVEEPLLVKLVSELTPLTVHEGDDATFRCEV-SPPDADVTWLRNGAVVTPGPQVEMAQNG 1411
            S+E P   K+   +   TV +G DA FR  V   PD +  W +NG  +    ++      
Sbjct: 2074 SMEAP---KIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPE 2130

Query: 1412 SSRI-LTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELL-FLRRLQDVRAEEGQD 1465
             +   L +R     D+ ++ ++A    G T++ A L V+  +L+ F + LQDV A+E   
Sbjct: 2131 DNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2190

Query: 1466 VC-LEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGC-- 1522
            +   E ET        V+W + G  +    +  M  D  +H L I  +  +D   Y C  
Sbjct: 2191 MATFECETSEPFVK--VKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL 2248

Query: 1523 -ESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYP 1581
             E  + +T A+L V    +  ++ L+D+ + E  S   +  +S E + G+W    V+L  
Sbjct: 2249 VEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKS 2308

Query: 1582 GPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVT 1641
              K  I S   R  L +  +   D G  SF  D  +   +L ++  P+ I++G  D +V 
Sbjct: 2309 NGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVC 2368

Query: 1642 EGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC- 1700
            EGD    E ++S    +  W KDG  + PS R+ +       +L +      DAG YS  
Sbjct: 2369 EGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFT 2428

Query: 1701 --AVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RWELGGRP 1757
              A+G + +G V +     +V V++ L+ V+  EG  A  EC VS  + T  +W L    
Sbjct: 2429 IPALGLSTSGRVSV----YSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQ 2484

Query: 1758 LRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPRE 1817
            ++P  RV+   +G K  LV++   A D G  +   G  ++   L VE + +       R+
Sbjct: 2485 IKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKI---IRGLRD 2541

Query: 1818 KTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGT 1877
             T    +  V EV +S SG  V W  +  E+ P  KY++ +HG  + L + ++  +D+G 
Sbjct: 2542 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2601

Query: 1878 YCCQAGQDSTHTRLLVEG 1895
            Y   AG++ T  +L V G
Sbjct: 2602 YTFYAGENMTSGKLTVAG 2619



 Score =  189 bits (480), Expect = 2e-47
 Identities = 271/1226 (22%), Positives = 469/1226 (38%), Gaps = 182/1226 (14%)

Query: 15    LRFPRPVRVVSGAEAE--LKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLT 72
             L+F  P++ V+  E E  +  V L      V W K  Q+L  +  +S   +G  H +   
Sbjct: 11929 LKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFK 11988

Query: 73    AALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLT 132
                  D       A   + EA     +TVLE                      G P F  
Sbjct: 11989 DLSIDDTSQIRVEAMGMSSEA----KLTVLE----------------------GDPYFTG 12022

Query: 133   GPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASL 192
               +    +   EV+L C       P + W KDG    E+  S +  ++     DG    L
Sbjct: 12023 KLQDYTGVEKDEVILQCEISKADAP-VKWFKDGK---EIKPSKNAVIKA----DGKKRML 12074

Query: 193   ALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAP 252
              L+   A   D G Y C                      S   D ++    +V PL    
Sbjct: 12075 ILK--KALKSDIGQYTCDCGT---------------DKTSGKLDIEDREIKLVRPLHSVE 12117

Query: 253   KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
                 V E + A+F   +    E +I  +W+ +               G  +L+   C+ K
Sbjct: 12118 ----VMETETARFETEIS---EDDIHANWKLK---------------GEALLQTPDCEIK 12155

Query: 313   DRG------LYVCAARNSAG------QTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL 360
             + G      L+ C    + G         S+  L VK   +   RPL+DV       A  
Sbjct: 12156 EEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATF 12215

Query: 361   ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT 420
             +C++    IP  W+ + ++L P  K     EG V  L +  +K +D G      +   +T
Sbjct: 12216 DCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD-FKT 12274

Query: 421   VANVTVKGPILKRLPRKLD--VLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SS 475
              AN+ VK P ++      D  V EG  AVL  E      + +W ++G E+    +    +
Sbjct: 12275 HANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVA 12334

Query: 476   SGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVL 535
              G +  LV+   T ED    T    + +T+  L V      PP    L  +         
Sbjct: 12335 DGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNV-----VPPHVEFLRPLTD------- 12382

Query: 536   LTWKPPEPAPETPFIYRLERQEVGSEDWIQC-----FSIEKAGAVE--VPGDC-VPSEGD 587
             L  +  E A     + R   +    +D  +      + I   GAV   V   C +  E +
Sbjct: 12383 LQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAE 12442

Query: 588   YRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGT 646
             Y   + T    G            L   A     L +++V + +      ++S    +  
Sbjct: 12443 YSCEVRTARTSGM--------LTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVI 12494

Query: 647   WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSC--PGVQD 704
             W+   EE+        +E G  RY I  +G +  L++     +D+G    ++C  P  + 
Sbjct: 12495 WYKGDEEI--------IETG--RYEILTEGRKRILVIQNAHLEDAG---NYNCRLPSSRT 12541

Query: 705   SAALTIQESPVHILS-PQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLV 763
                + + E     +S PQ   +L     E+    C +S+  FP  W +D + +E  +   
Sbjct: 12542 DGKVKVHELAAEFISKPQ---NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYD 12598

Query: 764   VKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSE 823
             V  DG+K  L++ +A +QD G +        A   +TV +  + IV P +   V     +
Sbjct: 12599 VIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVK--EQQ 12655

Query: 824   CVMLACEVDREDAPVRWYKDGQEV-EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAG 882
              V+  CEV+ E A  +W+++ + + + S +++L+ +  +   +  A              
Sbjct: 12656 EVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHL------------ 12703

Query: 883   DECAYFTVTITDVSSWIVYPSGKVYV--------------AAVRLERVVLTCELCRPWAE 928
             D+ A + V++T+     V  +  + V                +  + V   C++ R    
Sbjct: 12704 DDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVT 12763

Query: 929   VRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPV 988
             ++WTK+GEEV     +  + +     L +      D GEY+     + +   + + E P 
Sbjct: 12764 LKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPT 12823

Query: 989   RIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVL 1048
               +   ++ T+     +  V  C+LSRE A V+WY++G E++E +    E+DG   RL++
Sbjct: 12824 EFVEHLEDQTV--TEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLII 12881

Query: 1049  PAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGR-VELRCEVAP 1107
                + +D  E+ C   D  +   + V   P  I+ P    L+    APG  V    E+  
Sbjct: 12882 KDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILE----APGADVVFLAELNK 12937

Query: 1108  AGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILA 1167
                +V+W ++ + V   D  Q+ +EG    L +   +P D GEY    + +     + LA
Sbjct: 12938 DKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA 12997

Query: 1168  EPPVQFLALETTPSPLCVAPGEPVVL 1193
               P     ++T    L V  G+P+ +
Sbjct: 12998 AAP----KIKTADQDLVVDVGKPLTM 13019



 Score =  161 bits (408), Expect = 5e-39
 Identities = 261/1322 (19%), Positives = 490/1322 (37%), Gaps = 178/1322 (13%)

Query: 7    DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE 66
            D+  PP F R  +    +SG+   ++C V G PP  V W   G ++++  +         
Sbjct: 7677 DRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNT 7736

Query: 67   HGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEG 126
              L +     +D+G Y C A N AG    +A +TV EPP+                    
Sbjct: 7737 CALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPS-------------------- 7776

Query: 127  APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
               F+  P    VL G  V  T    G P  ++ W K    L    D  + +L+   AE 
Sbjct: 7777 ---FVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSEL-VPGDRCNVSLEDSVAE- 7831

Query: 187  GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
                   L +       SG Y C   N  G A     L +            +APA  V+
Sbjct: 7832 -------LELFDVDTSQSGEYTCIVSNEAGKASCTTHLYI------------KAPAKFVK 7872

Query: 247  PLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKV 306
             L      + + +GK         G P   + W   G  + P  +R      +   +L++
Sbjct: 7873 RL----NDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPS-QRCNITTTEKSAILEI 7927

Query: 307  LYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
                 +D G Y C   N++G+   + Q+ + EP   F + L+ V+      A L+C++  
Sbjct: 7928 PSSTVEDAGQYNCYIENASGKDSCSAQILILEPPY-FVKQLEPVKVSVGDSASLQCQLAG 7986

Query: 367  S-RIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVT 425
            +  I  +W++ D +L P   Y+      V  L+ +++  +D G Y+C+    V  V+  T
Sbjct: 7987 TPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSAST 8046

Query: 426  VKGPILKRLP----RKL-DVLEGENAVLLVETLEAGVEG---RWSRDGEEL---PVICQS 474
                  ++LP    R+L DV E     ++ +   +G E     W +DG+ L   P +  S
Sbjct: 8047 FLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTS 8106

Query: 475  SSGHMHALVLPGVTREDAGE----VTFSLGNSRTTTLLRVKCVKHSP-------PGPPIL 523
               +   L +    R  AG+     T  +G++ ++  L +   K+ P       P   ++
Sbjct: 8107 FLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVV 8166

Query: 524  AEM--FKGH---KNTVLLTWKPPEPAPETPFIYRLE-----------RQEVGSEDWIQCF 567
             E   F+ H      + ++W        +   Y++            + + G      C+
Sbjct: 8167 GESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCY 8226

Query: 568  SIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQV 627
            ++ + G      D   ++ + + R+   S   R    V     +       VAG + + V
Sbjct: 8227 AVNEVGK-----DSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITV 8281

Query: 628  YDGEDAVFSLDLSTIIQGTWFLNGEELK-SNEPEGQVEPGALRYRIEQKGLQHRLILHAV 686
                               W+ N  E++ ++  E   +   L  ++ + G+    +    
Sbjct: 8282 ------------------AWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCK 8323

Query: 687  KHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD-F 745
               D+G+ +   C     ++++ I+E     +  Q    +T +  E V L+C +   +  
Sbjct: 8324 VSNDAGSAL---C-----TSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPI 8375

Query: 746  PATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF----FGVTV 801
               W K G++++ S+            L L +    DSG++ C+   V+        VT+
Sbjct: 8376 RIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTI 8435

Query: 802  QDPPV-------HIVDPR-----EHVFVHAITSECVMLACEVDREDAP-VRWYK-DGQEV 847
            +D P          VD R     E   +  +         +V  +  P V+W K   +++
Sbjct: 8436 KDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQL 8495

Query: 848  EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTIT------------DV 895
             +   V +  +G   +L +  T  +D G ++CVA +E       +             + 
Sbjct: 8496 NQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEG 8555

Query: 896  SSWIVYPSGKVYVAAVRLERVVLTCELCR--------PWAEVRWTKDGEEVVESPALLLQ 947
                +     +       E  +   EL +         +A +    D   ++++  LL Q
Sbjct: 8556 DLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQ 8615

Query: 948  -KEDTVRRLVLPAVQLEDSGEYLCEIDDESASF---TVTVTEPPVRIIYPRDEVTLIAVT 1003
             +E+   RL +  ++  +  E   E   E  SF    ++ TE PV +I   +  T++   
Sbjct: 8616 SQEEETHRLEIEEIERSERDEKEFE---ELVSFIQQRLSQTE-PVTLIKDIENQTVLKDN 8671

Query: 1004 LECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDA 1063
                 +  +++  +  + WYK   ++E S+   +  DG R  L +   Q +D G +    
Sbjct: 8672 DAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVC 8731

Query: 1064 GDDSAFFTVTVTAPP-ERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVE 1122
            G   A   +TV  P  ER +       D+         + C+ +    +  W+++G  ++
Sbjct: 8732 GPHIASAKLTVIEPAWERHLQ------DVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILK 8785

Query: 1123 ASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSP 1182
                 +   E     LT+   + ED G+Y C+      +  + +   P+QF         
Sbjct: 8786 PQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQF---TKRIQN 8842

Query: 1183 LCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGL 1242
            + V+  +     CE+S   A V W      + E +      +G    + I    P   G+
Sbjct: 8843 IVVSEHQSATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGV 8902

Query: 1243 YT 1244
            Y+
Sbjct: 8903 YS 8904



 Score =  116 bits (290), Expect = 2e-25
 Identities = 219/1074 (20%), Positives = 389/1074 (36%), Gaps = 173/1074 (16%)

Query: 840  WYKDGQEV--EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSS 897
            W+ DGQ++  + +  VV++ +G    +++PAT PSD GE+  VA +     ++++     
Sbjct: 1490 WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPAT-PSDSGEWTVVAQNRAGRSSISVILTVE 1548

Query: 898  WIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVL 957
             + +    ++V  ++   +    E  R   +VR T +    +    + L+  D +     
Sbjct: 1549 AVEHQVKPMFVEKLKNVNIK---EGSRLEMKVRATGNPNPDI----VWLKNSDIIVPHKY 1601

Query: 958  PAVQLEDS-GEYLCEID----DESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCE 1012
            P +++E + GE   +ID     +SA +T T      R      + T   V +E       
Sbjct: 1602 PKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR------DTTRCKVNVEV------ 1649

Query: 1013 LSREDAPVRWYKDGLEVEESEALVLERDGPRCR-LVLPAAQP---------EDGGEFVCD 1062
                        +  E E    L++ R   R + +  P  +P          + G+    
Sbjct: 1650 ------------EFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDK 1697

Query: 1063 AGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQ---VRWYKDGL 1119
                  FF   +T+   +   PA      HF         C + P G     V W  DG 
Sbjct: 1698 EKQQKPFFKKKLTSLRLKRFGPA------HF--------ECRLTPIGDPTMVVEWLHDGK 1743

Query: 1120 EVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETT 1179
             +EA++ L++  E    +L    A   D+G   C   ++  T               + T
Sbjct: 1744 PLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGT---------------DHT 1788

Query: 1180 PSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAH 1239
             + L V   + +V   +L            GR     +GL+   E  R          AH
Sbjct: 1789 SATLIVKDEKSLVEESQLP----------EGR-----KGLQRIEELERM---------AH 1824

Query: 1240 AGLYTCQSGAAPGAPSLSFTVQVAEP-PVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGG 1298
             G  T   G             V  P PVRV+  E A+ R R T             P  
Sbjct: 1825 EGALT---GVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVT-----------GYPQP 1870

Query: 1299 PVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPL 1358
             V WY +G+ +    R ++   G    L +   +S D GE             V+ E P 
Sbjct: 1871 KVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGE-----------VKVTAENP- 1917

Query: 1359 LVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTL 1418
               ++     L + + +D       +P               P P+  + + G  +    
Sbjct: 1918 -EGVIEHKVKLEIQQREDFRSVLRRAP--------------EPRPEFHVHEPGKLQF--- 1959

Query: 1419 RGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAA 1478
                  +   V     +T T   + ++  E +   ++ +   E         E G   A 
Sbjct: 1960 ------EVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAI 2013

Query: 1479 GAVRWVRGGQPLPHDSRLSMAQDGHIH----RLFIHGVILADQGTYGCESHHDRTLARLS 1534
             AV      +   ++  L   +D  +H            LA++G     +     +  LS
Sbjct: 2014 TAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKI-ELS 2072

Query: 1535 VRPRQLRVLRPLEDVTISEGGSATFQLE-LSQEGVTGEWARGGVQLYPGPKCHIH-SDGH 1592
                  ++   ++  T+ +G  A F++  + +     EW + GV++    + + +  + +
Sbjct: 2073 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2132

Query: 1593 RHRLVLNGLGLADSG-----CVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDT-A 1646
               LV+  +   DS       ++   ++   A  L+  +  +T  +   D+   E DT A
Sbjct: 2133 VCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA 2192

Query: 1647 TFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTAR 1706
            TFECE S+    V W KDG  +    + R+ +      L +     SDA  YSC +    
Sbjct: 2193 TFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE 2252

Query: 1707 --AGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARV 1764
                  +L V    V  + EL+ +   E      EC VS     G+W      L+   + 
Sbjct: 2253 NVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKY 2312

Query: 1765 RIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGR 1824
             I     +  L + ++  ED GE  F     ++   L+++  P+ + +    +K V  G 
Sbjct: 2313 TITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQK-VCEGD 2371

Query: 1825 RAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTY 1878
               LEV VS       W+++G E+ P D+  +     +H L+I D+  ED G Y
Sbjct: 2372 IVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2425



 Score =  100 bits (249), Expect = 1e-20
 Identities = 121/498 (24%), Positives = 198/498 (39%), Gaps = 82/498 (16%)

Query: 14    FLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTA 73
             F+  P+ + ++ G +AE  C +  E  PV  W++  + L + ++    ADG +  L++  
Sbjct: 12554 FISKPQNLEILEGEKAEFVCSISKESFPVQ-WKRDDKTLESGDKYDVIADGKKRVLVVKD 12612

Query: 74    ALPTDAGVYVCRARNAAGEAYAAAAVTVLEP-----PASDPELQPAERPLPSPGSGEGAP 128
             A   D G YV       G A AAA +TV+E      P  D  ++  +             
Sbjct: 12613 ATLQDMGTYVV----MVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQ------------- 12655

Query: 129   VFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP 188
                            EVV  C          ++  +    + ++DSS + +         
Sbjct: 12656 ---------------EVVFNCEVNTEGAKAKWFRNE----EAIFDSSKYIILQ------K 12690

Query: 189   GASLALRILAARLPDSGVYVCHARNAHG-HAQAGALLQVHQPPESPPADPDEAPAPVVEP 247
                  LRI  A L D   Y     N  G + ++ A L V           +E    +VEP
Sbjct: 12691 DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV-----------EEEDLRIVEP 12739

Query: 248   LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVL 307
             L    K     E K   F C V  +    ++W   G   +P   R+ YR      +L + 
Sbjct: 12740 L----KDIETMEKKSVTFWCKV-NRLNVTLKWTKNGEE-VPFDNRVSYRVDKYKHMLTIK 12793

Query: 308   YCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNS 367
              C   D G Y+     +AGQ  S  +L + E    F   L+D    E   AV  C++   
Sbjct: 12794 DCGFPDEGEYIV----TAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSRE 12849

Query: 368   RIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVK 427
             +    W+R  + +   +KY+  ++G++ RLII   + DD+  Y C +  R ++ A + V+
Sbjct: 12850 KANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDR-KSRARLFVE 12908

Query: 428   GPILKRLPRKLDVLE--GENAVLLVETLEAGVEGRWSRDGEELPVICQS------SSGHM 479
                ++ +    D+LE  G + V L E  +  VE +W R+     V+ Q       S G +
Sbjct: 12909 EIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNN---MVVVQGDKHQMMSEGKI 12965

Query: 480   HALVLPGVTREDAGEVTF 497
             H L +  +   D GE  F
Sbjct: 12966 HRLQICDIKPRDQGEYRF 12983



 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 191/1020 (18%), Positives = 346/1020 (33%), Gaps = 168/1020 (16%)

Query: 836   APVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVA----GDECAYFTVT 891
             A V+WY +G E++ES  +   N      L +      D G ++ V     G+   Y T+ 
Sbjct: 32403 AEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLD 32462

Query: 892   ITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDT 951
             +T    +  Y S +      R     LT      +A   + K  E    S    ++ + T
Sbjct: 32463 VTG-GDYTTYASQRRDEEVPRSVFPELT--RTEAYAVSSFKKTSEMEASSSVREVKSQMT 32519

Query: 952   VRRLVLPAVQLEDSGEYLC------EIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLE 1005
               R  L + +   S E          ++++S +  +  T     +  PR   ++     E
Sbjct: 32520 ETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPR---SMTVYEGE 32576

Query: 1006  CVVLMCELSREDAP-VRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC--- 1061
                  C+   E  P V W + G  +  S    +     +    + + Q  D G +     
Sbjct: 32577 SARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVE 32636

Query: 1062  -DAGDDSAFFTVT----------VTAPPE------RIVHPAA------------------ 1086
                G   A FT+T          VT+PP       R+  P A                  
Sbjct: 32637 NSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAV 32696

Query: 1087  -----------RSLDLHFGAPGRV-------------ELRCEVAPA---GSQVRWYKDGL 1119
                        +   L   AP ++             +L C V  +     +V WYKDG 
Sbjct: 32697 SPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGK 32756

Query: 1120  EVEASDALQL--GAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLAL- 1176
             +++ +   Q    A+G T  L + +    D GEYVCE   E  T    L      F ++ 
Sbjct: 32757 KLKENGHFQFHYSADG-TYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIH 32815

Query: 1177  -----------------ETT---------PSPLCVAP-----------GEPVVLSCELSR 1199
                              E+T         P P+   P               V    +  
Sbjct: 32816 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKA 32875

Query: 1200  AGAP---VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSL 1256
              G P    +W+ +G+ + +G   +L  +     L I     + +GLYTC    + G+ S 
Sbjct: 32876 TGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSS 32935

Query: 1257  SFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQ 1316
             S  + +           + Q     TP     +   +S         K  E   SQ ++ 
Sbjct: 32936 SCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEA-KSQEKLA 32994

Query: 1317  LEQAGARQVLRVQGARSGDAG-EYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGD 1375
             L++  ++ ++  +  +S     E      + ++    S E     ++ +  T ++++EG 
Sbjct: 32995 LKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQ 33054

Query: 1376  DATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGS 1435
                 +  ++    DV W+ NG  +T   +     +GS + LT++     D G +T     
Sbjct: 33055 RLVLKANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTC---I 33110

Query: 1436  TATSARLHVRETELLFLRRLQDVRA----------EEGQDVCLEVETGRVGAAGAVRWVR 1485
             + T   +   + +L   + L D  A           EGQ+V    E      +  + W +
Sbjct: 33111 SKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISG-EPSPEIEWFK 33169

Query: 1486  GGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDR----TLARLSVRPRQLR 1541
                P+   S +S+++  +++ L I    ++D G Y  ++ + R      A L V P    
Sbjct: 33170 NNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLP---L 33226

Query: 1542  VLRPLEDVTISEGGSATFQLELSQEGV--TGEWARGGVQLYPGPKCHIHSDGHRHRLVLN 1599
             V  P  +V +   G  + Q   S + V  +          +        ++     +   
Sbjct: 33227 VEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQ 33286

Query: 1600  GLGLADSGCVSFTADSLRCAARLI-------------VREVPVTIVRGPHDLEVTEGDTA 1646
              +       V  ++ S    + +              +R +P  I   P D+ + EG   
Sbjct: 33287 SMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVL 33346

Query: 1647  TFECELS-QALADVTWEKDGNALTPSPRLRLQALGTRRL--LQLRRCGPSDAGTYSCAVG 1703
             T  C  + +   +VTW   G  +    + R     T  L  L +      D G Y+ ++G
Sbjct: 33347 TVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLG 33406



 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 113/494 (22%), Positives = 184/494 (37%), Gaps = 82/494 (16%)

Query: 15    LRFPRPVRVVSGAEAELKCVV--LGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLT 72
             L+F  P+   +  E E    V  L      VVW K   +L  S  +   ++G  H L + 
Sbjct: 11574 LKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMK 11633

Query: 73    AALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLT 132
                  D    + + +    E  + A + VLE                        P F  
Sbjct: 11634 EVTLDD----ISQIKAQVKELSSTAQLKVLEAD----------------------PYFTV 11667

Query: 133   GPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASL 192
                 +  +   E+ L C      +  + W KDG   +E+  S  ++++        G   
Sbjct: 11668 KLHDKTAVEKDEITLKCEVS--KDVPVKWFKDG---EEIVPSPKYSIK------ADGLRR 11716

Query: 193   ALRILAARLPDSGVYVCHARNAHGHAQA---GALLQVHQPPESPPADPDEAPAPVVEPLK 249
              L+I  A L D G YVC        A       L++V            E P   VE   
Sbjct: 11717 ILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKV------------EKPLYGVE--- 11761

Query: 250   CAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLL--PDRRRLMYRDRDGGFVLKVL 307
                   +V E  H +     + +P+   +W  +G+PL   PD   +     DG   + +L
Sbjct: 11762 -----VFVGETAHFEIE---LSEPDVHGQWKLKGQPLTASPDCEII----EDGKKHILIL 11809

Query: 308   Y-CQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
             + CQ    G     A N+     SA  L VKE  L F  PL DV+  E   A  EC+V  
Sbjct: 11810 HNCQLGMTGEVSFQAANAK----SAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR 11865

Query: 367   SRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTV 426
                   W +  Q +    ++E I++GT   ++I     +D+  Y+ E   +  T   + +
Sbjct: 11866 EPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDK-HTSGKLII 11924

Query: 427   KGPILKRLPRKLDVL--EGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHA 481
             +G  LK L    DV   E E+AV  VE     +  +W ++ + L     +     G  H+
Sbjct: 11925 EGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHS 11984

Query: 482   LVLPGVTREDAGEV 495
             +    ++ +D  ++
Sbjct: 11985 ITFKDLSIDDTSQI 11998



 Score = 77.8 bits (190), Expect = 9e-14
 Identities = 63/239 (26%), Positives = 93/239 (38%), Gaps = 32/239 (13%)

Query: 10   SPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
            +PP  +   + V V+ G    L+C + G P P V W +   Q+ +S             L
Sbjct: 941  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 1000

Query: 70   LLTAALPTDAGVYVCRARNAAG-------------EAYAAAAVTVLEPPASDPELQPAER 116
            ++  A   D+G + C A N AG             E +      V E   ++ +     R
Sbjct: 1001 MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1060

Query: 117  PL---------PSPGSGE-GAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGM 166
             +            G GE  AP F+T P  Q ++ G  VV  C+ GG P+P +YW+K G+
Sbjct: 1061 DVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1120

Query: 167  ALDEVWD-SSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALL 224
             L   +     +  Q G  +        L I      D+G Y    RN HG   A A L
Sbjct: 1121 PLTTGYRYKVSYNKQTGECK--------LVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 77.8 bits (190), Expect = 9e-14
 Identities = 92/387 (23%), Positives = 137/387 (35%), Gaps = 78/387 (20%)

Query: 18    PRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPT 77
             PR + V  G  A   C   GEP P V W + GQ L+ S R        +    +++   +
Sbjct: 32567 PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQAS 32626

Query: 78    DAGVYVCRARNAAGEAYAAAAVTVL------------------EPPASDPELQPAERPLP 119
             D G Y     N+ G+  A   +T+                   EP    PE   + + + 
Sbjct: 32627 DEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVK 32686

Query: 120   SPGSG------------------EGAPVFLTGPRSQWVLRGAE---VVLTC--RAGGLPE 156
             SP                     +  PV      +Q++   A      LTC   +  L  
Sbjct: 32687 SPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRA 32746

Query: 157   PTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHG 216
               + W KDG  L E   + HF      + DG   +  L+I      D G YVC      G
Sbjct: 32747 KEVTWYKDGKKLKE---NGHFQFH--YSADG---TYELKINNLTESDQGEYVCEISGEGG 32798

Query: 217   HAQAG------ALLQVHQP--------------PESPPADPDEAPAPVVEPLKCAP---- 252
              ++        A   +H+                ES      E  AP  EP+   P    
Sbjct: 32799 TSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAP--EPISSKPVIVT 32856

Query: 253   --KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQ 310
               +   V+    AKF     G+P P   W  +G+ +    +  +  D+ GGF L++    
Sbjct: 32857 GLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDK-GGFFLEIHKTD 32915

Query: 311   AKDRGLYVCAARNSAGQTLSAVQLHVK 337
               D GLY C  +NSAG   S+ +L +K
Sbjct: 32916 TSDSGLYTCTVKNSAGSVSSSCKLTIK 32942



 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 95/398 (23%), Positives = 144/398 (36%), Gaps = 78/398 (19%)

Query: 22   RVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASER--LSFPADGAEHGLLLTAALPTDA 79
            R++ G      C + G P P + W K G+++   ER  + F  DG    L +   LP D 
Sbjct: 1301 RILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG-RASLRIPVVLPEDE 1359

Query: 80   GVYVCRARNAAGEAYAAAAVTV-----LEPPASDPELQPAER------------PL---- 118
            G+Y   A N  G A  +  + V     L  P   P L+P  R            P+    
Sbjct: 1360 GIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSP 1419

Query: 119  -----------------PSPG-----SGEG------APVFLTGPRSQWVLRGAEVVLTCR 150
                              SPG     + E        PVF+  P S   L G       +
Sbjct: 1420 ARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLK 1479

Query: 151  AGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCH 210
              G P P  +W  DG  +  V D +H  +     EDG   + +L I+ A   DSG +   
Sbjct: 1480 VVGRPMPETFWFHDGQQI--VNDYTHKVV---IKEDG---TQSLIIVPATPSDSGEWTVV 1531

Query: 211  ARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVM 270
            A+N  G +    +L V        A   +     VE L    K   + EG   + +    
Sbjct: 1532 AQNRAGRSSISVILTVE-------AVEHQVKPMFVEKL----KNVNIKEGSRLEMKVRAT 1580

Query: 271  GKPEPEIEWHWEGRPLLPDR-RRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTL 329
            G P P+I W      ++P +  ++      G   LK+    ++D   Y   A N AG+  
Sbjct: 1581 GNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDT 1640

Query: 330  SAVQLHVK------EPRLRFTRPLQDVEGREHGIAVLE 361
            +  +++V+      EP  +   P      +E     LE
Sbjct: 1641 TRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELE 1678



 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 123/502 (24%), Positives = 190/502 (37%), Gaps = 74/502 (14%)

Query: 26    GAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCR 85
             G+ A  +C+V      +  W K G  +  S +  F ADG +  L +     +DAG Y C 
Sbjct: 11133 GSSAIFECLV-SPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCV 11191

Query: 86    ARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEV 145
              R    E  + A + V E P                          T      V++G  +
Sbjct: 11192 LRLGNKEKTSTAKLVVEELPVR---------------------FVKTLEEEVTVVKGQPL 11230

Query: 146   VLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP-GASLALRILAARLPDS 204
              L+C      E  + W KDG  + E         +PGR   G  G   AL I  A   D+
Sbjct: 11231 YLSCELN--KERDVVWRKDGKIVVE---------KPGRIVPGVIGLMRALTINDADDTDA 11279

Query: 205   GVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAK 264
             G Y     NA+ + +  + ++V +               +V+P+    +   V     A 
Sbjct: 11280 GTYTVTVENAN-NLECSSCVKVVEVIRD----------WLVKPI----RDQHVKPKGTAI 11324

Query: 265   FRCYVMGKPEPEIEWH--WEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAAR 322
             F C +  K  P I+W   ++  P  P+ +  + RD      LK+     +D   Y   A 
Sbjct: 11325 FACDI-AKDTPNIKWFKGYDEIPAEPNDKTEILRD-GNHLYLKIKNAMPEDIAEY---AV 11379

Query: 323   NSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLP 382
                G+   A +L + E  +   +P++DV   E   A  + ++  + IP  W  + + L P
Sbjct: 11380 EIEGKRYPA-KLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRP 11438

Query: 383   CRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRKLDVLE 442
                 E   EG  R L +H++K D  G  L +    + T A +TVK   L       DV  
Sbjct: 11439 SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAI-TTAILTVKEIELDFAVPLKDVTV 11497

Query: 443   GENAVLLVE---TLEAGVEGRWSRDGEELPVICQSS-------SGHMHALVLPGVTREDA 492
              E      E   T EA V   WS+     P I +SS        G  H LV+     +D 
Sbjct: 11498 PERRQARFECVLTREANV--IWSKG----PDIIKSSDKFDIIADGKKHILVINDSQFDDE 11551

Query: 493   GEVTFSLGNSRTTTLLRVKCVK 514
             G  T  +   +T+  L V  ++
Sbjct: 11552 GVYTAEVEGKKTSARLFVTGIR 11573



 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 118/552 (21%), Positives = 194/552 (35%), Gaps = 105/552 (19%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASER--LSFPADGAEHGL 69
            P F+  P   ++V G      C V G P P V W+K G  L    R  +S+     E  L
Sbjct: 1082 PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKL 1141

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPL---------PS 120
            +++     DAG Y    RN  GE   +A+ ++LE    +  ++  +  L           
Sbjct: 1142 VISMTFADDAGEYTIVVRNKHGET--SASASLLEEADYELLMKSQQEMLYQTQVTAFVQE 1199

Query: 121  PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQ 180
            P  GE AP F+     +   +   ++    A        Y E      D+ +  S F   
Sbjct: 1200 PKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVE------DQEFHISSF--- 1250

Query: 181  PGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEA 240
                E+     +  RI+   L +                    L      E    D  E+
Sbjct: 1251 ----EERLIKEIEYRIIKTTLEE--------------------LLEEDGEEKMAVDISES 1286

Query: 241  PAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG 300
             A V        K + + EG    F C + G P P+I W+ +G+ +    R  M   +DG
Sbjct: 1287 EA-VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG 1345

Query: 301  GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK--------------EPRLRFTRP 346
               L++     +D G+Y   A N  G  + + +L+V+              EP  R  R 
Sbjct: 1346 RASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRI-RS 1404

Query: 347  LQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADD 406
            L         I +   ++  +R+  A      R+ P R+ E+ +E  + RL         
Sbjct: 1405 LSPRSVSRSPIRMSPARMSPARMSPARM-SPARMSPGRRLEETDESQLERLY-------- 1455

Query: 407  DGIYLCEMRGRVRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGV-EGRWSRDG 465
                                  P+    P     LEG+ A   ++ +   + E  W  DG
Sbjct: 1456 ---------------------KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDG 1494

Query: 466  EEL-----PVICQSSSGHMHALVLPGVTREDAGEVTF----SLGNSRTTTLLRVKCVKHS 516
            +++       +     G    +++P  T  D+GE T       G S  + +L V+ V+H 
Sbjct: 1495 QQIVNDYTHKVVIKEDGTQSLIIVP-ATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQ 1553

Query: 517  PPGPPILAEMFK 528
                P+  E  K
Sbjct: 1554 V--KPMFVEKLK 1563



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 91/395 (23%), Positives = 142/395 (35%), Gaps = 87/395 (22%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGA--EHGL 69
            P F+   + V +  G+  E+K    G P P +VW K    +   +      +G   E  L
Sbjct: 1556 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAAL 1615

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSP-------- 121
             + + +  D+  Y   A N AG       V V E   ++PE    ER L  P        
Sbjct: 1616 KIDSTVSQDSAWYTATAINKAGRDTTRCKVNV-EVEFAEPE---PERKLIIPRGTYRAKE 1671

Query: 122  -GSGEGAPVFLTGPRSQW------------------------VLRGAEVVLTCRAGGLPE 156
              + E  P+ L   + QW                        + R       CR   + +
Sbjct: 1672 IAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGD 1731

Query: 157  PTLY--WEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNA 214
            PT+   W  DG  L+        A +     +    SL   +  +R  DSG+  C A N 
Sbjct: 1732 PTMVVEWLHDGKPLEA-------ANRLRMINEFGYCSLDYGVAYSR--DSGIITCRATNK 1782

Query: 215  HGHAQAGA---------LLQVHQPPESPPA---------------------DPDEAPAPV 244
            +G     A         L++  Q PE                         D  E   P 
Sbjct: 1783 YGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKP- 1841

Query: 245  VEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRR-RLMYRDRDGGFV 303
               +   P+   V EG+ A+FRC V G P+P++ W+  G+ +   +R R+ Y   DG   
Sbjct: 1842 --DIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY---DGIHY 1896

Query: 304  LKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKE 338
            L ++ C++ D G     A N  G     V+L +++
Sbjct: 1897 LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQ 1931



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 113/549 (20%), Positives = 201/549 (36%), Gaps = 46/549 (8%)

Query: 931   WTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFT---------V 981
             WTKDG+ + +     L ++     L +      DSG Y C + + + S +         +
Sbjct: 32885 WTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAI 32944

Query: 982   TVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDG 1041
               TE          E+T      +  V+  E+S++       K   E +  E L L+ + 
Sbjct: 32945 KDTEAQKVSTQKTSEIT----PQKKAVVQEEISQKALRSEEIKMS-EAKSQEKLALKEEA 32999

Query: 1042  PRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAAR--SLDLHFGAPGRV 1099
              +   VL + + +       +        T T  A  E   H   +  S  +      R+
Sbjct: 33000 SK---VLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRL 33056

Query: 1100  ELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETR-HE 1158
              L+  +A A + V+W  +G+E+  S+  + G  G  +TLT+  A   D G   C ++  E
Sbjct: 33057 VLKANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 33115

Query: 1159  AIT---FNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP-VVWSHNGRPVQ 1214
              I    +++ L++      A  + P    +  G+ V+ +CE+S   +P + W  N  P+ 
Sbjct: 33116 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 33175

Query: 1215  EGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQS----GAAPGAPSLSFTVQVAEPPVRVV 1270
                 + +        L I+ A  + +G YT ++    G      SL     V EP   VV
Sbjct: 33176 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVV 33235

Query: 1271  APEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQ------GRVQLEQAGARQ 1324
                +  T   S  G      V +S       +       AS         +  +   + Q
Sbjct: 33236 LRTSGDT---SLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQ 33292

Query: 1325  VLRVQGARSGDAG-EYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCE- 1382
                V+ + S   G   +      +   L +    +  K+ +  + +++ EG   T  C  
Sbjct: 33293 ESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAF 33352

Query: 1383  VSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTL--RGCQLGDAGTVTL----RAGST 1436
                P  +VTW   G  +    Q       +  + TL     Q  D G  TL      GS 
Sbjct: 33353 TGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSD 33412

Query: 1437  ATSARLHVR 1445
             + +  +H+R
Sbjct: 33413 SATVNIHIR 33421



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 60/208 (28%), Positives = 78/208 (37%), Gaps = 29/208 (13%)

Query: 26    GAEAELKCVVLGEPPPVVVWEKGGQQLAASE---RLSFPADGAEHGLLLTAALPTDAGVY 82
             G        +   P P V W K GQ++   +   + +F +D   + L + +    D   Y
Sbjct: 31704 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEY 31763

Query: 83    VCRARNAAGEAYAAAAVTV-LEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLR 141
                ARN  GE    A +TV L PP +D  L+P  + L            L     Q    
Sbjct: 31764 TVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRL------------LANAECQ---E 31808

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGAS-LALRILAAR 200
             G  V    R  G+P PTL WEKDG  L         +L P       G    AL I    
Sbjct: 31809 GQSVCFEIRVSGIPPPTLKWEKDGQPL---------SLGPNIEIIHEGLDYYALHIRDTL 31859

Query: 201   LPDSGVYVCHARNAHGHAQAGALLQVHQ 228
               D+G Y   A N  G     A LQV +
Sbjct: 31860 PEDTGYYRVTATNTAGSTSCQAHLQVER 31887



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 57/217 (26%), Positives = 83/217 (38%), Gaps = 30/217 (13%)

Query: 17    FPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALP 76
             F   + +  G    LK  + G     V W   G +L  SE   +   G++  L +  A  
Sbjct: 33044 FSTQMSINEGQRLVLKANIAGATD--VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASH 33101

Query: 77    TDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRS 136
              D G+  C ++   G       +T L    SD                  AP F++ PRS
Sbjct: 33102 RDEGILTCISKTKEGIVKCQYDLT-LSKELSD------------------APAFISQPRS 33142

Query: 137   QWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRI 196
             Q +  G  V+ TC   G P P + W K+ + +     SS+ ++   R         +L I
Sbjct: 33143 QNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS---ISSNVSISRSR------NVYSLEI 33193

Query: 197   LAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESP 233
               A + DSG Y   A+N  G   A A L V    E P
Sbjct: 33194 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEP 33230



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 81/369 (21%), Positives = 132/369 (35%), Gaps = 67/369 (18%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLA--ASERLSFPADGAEHGL 69
            P F+  P   + + G  A     V+G P P   W   GQQ+    + ++    DG +  L
Sbjct: 1457 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ-SL 1515

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPV 129
            ++  A P+D+G +   A+N AG +  +  +TV          +  E  +         P+
Sbjct: 1516 IIVPATPSDSGEWTVVAQNRAGRSSISVILTV----------EAVEHQV--------KPM 1557

Query: 130  FLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPG 189
            F+   ++  +  G+ + +  RA G P P + W K+    D +    +    P    +G  
Sbjct: 1558 FVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNS---DIIVPHKY----PKIRIEGTK 1610

Query: 190  ASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPAD-----------PD 238
               AL+I +    DS  Y   A N  G       + V      P  +             
Sbjct: 1611 GEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAK 1670

Query: 239  EAPAPVVEPLKCAPKTFWVNEG---------------------------KHAKFRCYVMG 271
            E  AP +EPL          EG                            H + R   +G
Sbjct: 1671 EIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIG 1730

Query: 272  KPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSA 331
             P   +EW  +G+P L    RL   +  G   L      ++D G+  C A N  G   ++
Sbjct: 1731 DPTMVVEWLHDGKP-LEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTS 1789

Query: 332  VQLHVKEPR 340
              L VK+ +
Sbjct: 1790 ATLIVKDEK 1798



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 193/1091 (17%), Positives = 363/1091 (33%), Gaps = 146/1091 (13%)

Query: 260   GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
             G++ +F   V  KP  E++W+  G   L +  ++ Y +  G   L++L C   D G Y  
Sbjct: 32388 GQNTRFILNVQSKPTAEVKWYHNGVE-LQESSKIHYTNTSGVLTLEILDCHTDDSGTYRA 32446

Query: 320   AARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECK---VPNSRIPTAWFRE 376
                N  G+      L              DV G ++     + +   VP S  P     E
Sbjct: 32447 VCTNYKGEASDYATL--------------DVTGGDYTTYASQRRDEEVPRSVFPELTRTE 32492

Query: 377   DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGI--YLCEMRGRVRTVA------------ 422
                +   +K  ++E  +  R +  ++    + +  Y       +++ A            
Sbjct: 32493 AYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTT 32552

Query: 423   ---NVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQ---SS 475
                  T+   IL + PR + V EGE+A    +T    V    W R G+ L    +   ++
Sbjct: 32553 RKIKTTLAARILTK-PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTT 32611

Query: 476   SGHMHALVLPGVTREDAGEVTFSLGNSR-------TTTLLRVKCVKHSPPGPPIL----- 523
             + +     +  V   D G  +  + NS        T T+ + +  + +   PP +     
Sbjct: 32612 TKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEP 32671

Query: 524   ----AEMFKGHKNTVLLTWKPPEPA----------PETPFIYRLERQEVGSEDWIQCFSI 569
                  E  K  K       K PEP+            TP   +++   V +   I  F  
Sbjct: 32672 RVKSPEAVKSPKRV-----KSPEPSHPKAVSPTETKPTP-TEKVQHLPVSAPPKITQFLK 32725

Query: 570   EKAGAVEVPGDCVPSEGDYRFRICTVSGHGR----SPHVVFHGSAHLVPTARLVAGLEDV 625
              +A        CV      R +  T    G+    + H  FH SA               
Sbjct: 32726 AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSA--------------- 32770

Query: 626   QVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLI--L 683
                   D  + L ++ + +      GE +     EG      L++  +     H  +  +
Sbjct: 32771 ------DGTYELKINNLTESD---QGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKI 32821

Query: 684   HAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRV 743
                K  D            +  A   I   PV +   QD    + + ++  V      R 
Sbjct: 32822 SETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRP 32881

Query: 744   DFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQD 803
                A W KDG+ + +     +  D     L + +    DSG + C  +  +     + + 
Sbjct: 32882 --TAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKL 32939

Query: 804   PPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQ----EVEESDFVVLENEG 859
                 I D          TSE       V +E+   +  +  +    E +  + + L+ E 
Sbjct: 32940 TIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEA 32999

Query: 860   PHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLT 919
                 +     + +     + +  +E    +    +V +     +    ++    +R+VL 
Sbjct: 33000 SKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLK 33059

Query: 920   CELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESA-- 977
               +     +V+W  +G E+  S         + + L +      D G   C    +    
Sbjct: 33060 ANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIV 33118

Query: 978   ------SFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDGLEVE 1030
                   + +  +++ P  I  PR +        + V+  CE+S E +P + W+K+ L + 
Sbjct: 33119 KCQYDLTLSKELSDAPAFISQPRSQNINEG---QNVLFTCEISGEPSPEIEWFKNNLPIS 33175

Query: 1031  ESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLD 1090
              S  + + R      L +  A   D G++   A +     + T +     +V   +R + 
Sbjct: 33176 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVV 33235

Query: 1091  LHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGE 1150
             L     G   L+   +    Q+   K      +  +    +    +  ++         E
Sbjct: 33236 LR--TSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQE 33293

Query: 1151  YVCE------------TRHEAITFNVILAE----PPVQFLALETTPSPLCVAPGEPVVLS 1194
                E            T+ E+ T  ++ A     PP     +E  PS + +  G+ + ++
Sbjct: 33294 SFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPP----KIEALPSDISIDEGKVLTVA 33349

Query: 1195  CELSRAGAP-VVWSHNGRPVQEGEGLELHAEG--PRRVLCIQAAGPAHAGLYTCQSGAAP 1251
             C  +    P V WS  GR +   E    H E       L I        GLYT   G   
Sbjct: 33350 CAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEF 33409

Query: 1252  GAPSLSFTVQV 1262
             G+ S +  + +
Sbjct: 33410 GSDSATVNIHI 33420



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 60/241 (24%), Positives = 80/241 (33%), Gaps = 46/241 (19%)

Query: 128  PVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDG 187
            P  ++G ++  V+ G  V L C   G P PT+ W ++   ++   D      Q G A   
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQ-ITFQSGIAR-- 999

Query: 188  PGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPE---------------- 231
                  L I  A   DSG + C A N  G       L V    E                
Sbjct: 1000 ------LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEE 1053

Query: 232  -----------------SPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPE 274
                                A P E  AP         K     EG    F C V G P+
Sbjct: 1054 KRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLV---EGGSVVFGCQVGGNPK 1110

Query: 275  PEIEWHWEGRPLLPD-RRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQ 333
            P + W   G PL    R ++ Y  + G   L +    A D G Y    RN  G+T ++  
Sbjct: 1111 PHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASAS 1170

Query: 334  L 334
            L
Sbjct: 1171 L 1171



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 69/279 (24%), Positives = 113/279 (40%), Gaps = 54/279 (19%)

Query: 12  PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASE----RLSFPADGAEH 67
           P F +  + V V+ G+ A  +  + G P P V W + GQ ++ S     ++SF    A+ 
Sbjct: 6   PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK- 64

Query: 68  GLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGA 127
            L + A    ++G Y  +A N +G+A + A + V    A                     
Sbjct: 65  -LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA--------------------P 103

Query: 128 PVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDG 187
           P F+   +S  V +G++V L  R  G+P P + + +DG    E+  S  F +        
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGA---EIQSSLDFQISQ------ 154

Query: 188 PGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEP 247
            G   +L I  A   DSG Y  +A N+ G A + A L V    E P            + 
Sbjct: 155 EGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVP-----------AKK 203

Query: 248 LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL 286
            K    T  ++E +  +         E +IE H++ R +
Sbjct: 204 TKTIVSTAQISESRQTRI--------EKKIEAHFDARSI 234



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 63/225 (28%), Positives = 91/225 (40%), Gaps = 30/225 (13%)

Query: 12    PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPAD---GAEHG 68
             P F    R + V   + A L C V G P P+V W + G+++ A + L +      G  H 
Sbjct: 30928 PHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGYHQ 30986

Query: 69    LLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAP 128
             L++ +    DA VY  RA N  G     A++ V           PA+  LP    G GA 
Sbjct: 30987 LIIASVTDDDATVYQVRATNQGGSVSGTASLEV---------EVPAKIHLPKTLEGMGA- 31036

Query: 129   VFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP 188
                        LRG  V +     G P+P + W+K    +D   ++ H+ +   R+    
Sbjct: 31037 --------VHALRGEVVSIKIPFSGKPDPVITWQKGQDLID---NNGHYQVIVTRS---- 31081

Query: 189   GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESP 233
               SL       R  D+G YV  A+N  G  Q    L V   P+ P
Sbjct: 31082 FTSLVFPNGVER-KDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 31125



 Score = 58.9 bits (141), Expect = 5e-08
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 5/178 (2%)

Query: 1719 VAVLSELRSVSAREGDGATFECTV--SEVETTGRWELGGRPLRPGARVRIRQEGKKHILV 1776
            V ++ ++ + +  + + A FE  +  +  E    W  G   L P  +  I  +G +H L 
Sbjct: 8656 VTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLR 8715

Query: 1777 LSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSG 1836
            +   + +D G  R   GP  + A L V     +  RH  ++ T+  G+   +    S   
Sbjct: 8716 VKNCQLKDQGNYRLVCGPHIASAKLTVIEPAWE--RHL-QDVTLKEGQTCTMTCQFSVPN 8772

Query: 1837 GHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVE 1894
                W R G  L P  +++       H L I DVR EDQG Y C+     T   L +E
Sbjct: 8773 VKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIE 8830



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 120/558 (21%), Positives = 202/558 (36%), Gaps = 73/558 (13%)

Query: 492   AGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI- 550
             A E    +G     ++    C    PPGPP   ++    +++V L W  P      P   
Sbjct: 24977 AAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKG 25036

Query: 551   YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSA 610
             Y +E +E  +++W  C         +     +    +Y FRIC ++  G        GS 
Sbjct: 25037 YVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSV 25096

Query: 611   HLV-----PTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEP 665
                     P   L A L  V V     A  +L L   I+G       E+K  + EG +  
Sbjct: 25097 VAQERIEPPEIELDADLRKVVVLR---ASATLRLFVTIKGR---PEPEVKWEKAEGILTD 25150

Query: 666   GALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVS 725
                R +IE       L++  V   DSG    ++     +S + T   +   + SP   V+
Sbjct: 25151 ---RAQIEVTSSFTMLVIDNVTRFDSGR---YNLTLENNSGSKTAFVNVRVLDSPSAPVN 25204

Query: 726   LTF--TTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDG-RKHRLILPEAKVQD 782
             LT      + V L+ E   +D        G K+  +  +V K +  RK    +     + 
Sbjct: 25205 LTIREVKKDSVTLSWEPPLID-------GGAKI--TNYIVEKRETTRKAYATITNNCTKT 25255

Query: 783   SGEFECRTEGVSAFFGVTVQDP-----PVHIVDPREHVFVHAITSECVMLACEVDREDAP 837
             +   E   EG S +F V   +      P    +P + V    +    V L  +V R  A 
Sbjct: 25256 TFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVK-VSEPPLPPGRVTLV-DVTRNTAT 25313

Query: 838   VRWYK---DGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITD 894
             ++W K   DG        V ++ +G  +       +  +       AG+E  +    + +
Sbjct: 25314 IKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNE 25373

Query: 895   -------------------VSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDG 935
                                +   +  P     V A    ++ +  +  RP A V W KDG
Sbjct: 25374 KGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFK-GRPQATVNWRKDG 25432

Query: 936   EEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVT---------EP 986
             + + E+  + +    TV  L +     ED G Y   + + + S TV +T           
Sbjct: 25433 QTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPG 25492

Query: 987   PVRIIYPRDEVTLIAVTL 1004
             P+RI    DEV+  ++T+
Sbjct: 25493 PIRI----DEVSCDSITI 25506



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 75/318 (23%), Positives = 117/318 (36%), Gaps = 24/318 (7%)

Query: 43    VVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTV- 101
             V W  G +QL  SE+     +     L +      D G Y C+  N  GE  + A + V 
Sbjct: 31600 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVK 31659

Query: 102   ----LEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEP 157
                 +        ++  +R   +    E  P F     ++    G  V         PEP
Sbjct: 31660 GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEP 31719

Query: 158   TLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGH 217
              + W K G  +    +   +  +  +          L I +    D   Y   ARN +G 
Sbjct: 31720 HVTWYKSGQKIKPGDNDKKYTFESDKG------LYQLTINSVTTDDDAEYTVVARNKYGE 31773

Query: 218   AQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEI 277
                 A L V   P  PP D    P       K         EG+   F   V G P P +
Sbjct: 31774 DSCKAKLTVTLHP--PPTDSTLRPM-----FKRLLANAECQEGQSVCFEIRVSGIPPPTL 31826

Query: 278   EWHWEGRPL-LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
             +W  +G+PL L     +++   D  + L +     +D G Y   A N+AG T  + Q H+
Sbjct: 31827 KWEKDGQPLSLGPNIEIIHEGLD-YYALHIRDTLPEDTGYYRVTATNTAGST--SCQAHL 31883

Query: 337   KEPRLRFTRPLQDVEGRE 354
             +  RLR+ +  Q+ + +E
Sbjct: 31884 QVERLRYKK--QEFKSKE 31899



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 144/696 (20%), Positives = 245/696 (35%), Gaps = 128/696 (18%)

Query: 252   PKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQA 311
             P++  V EG+ A+F C   G+P P + W  +G+ L    R  +   +      ++   QA
Sbjct: 32567 PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKS-TFEISSVQA 32625

Query: 312   KDRGLYVCAARNSAGQTLSAVQLHVKEPRL---------RFTRPLQDVEGREHGIAVLEC 362
              D G Y     NS G+  +   L +++ R+         R   P   V+  E   +    
Sbjct: 32626 SDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRV 32685

Query: 363   KVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVA 422
             K P    P A    + +  P  K + +      + I   LKA+             + +A
Sbjct: 32686 KSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPK-ITQFLKAEAS-----------KEIA 32733

Query: 423   NVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHM--- 479
              +T                  E++VL  +      E  W +DG++L       +GH    
Sbjct: 32734 KLT---------------CVVESSVLRAK------EVTWYKDGKKL-----KENGHFQFH 32767

Query: 480   ------HALVLPGVTREDAGEVTFSL----GNSRTTTLLRVKCVKHSPPGPPILAEMFKG 529
                   + L +  +T  D GE    +    G S+T      +  K        ++E  K 
Sbjct: 32768 YSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKS 32827

Query: 530   HKNTVLLTW------KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVE------V 577
              + T   T       K PEP    P I    +    S D +  F+++  G          
Sbjct: 32828 DQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTK 32887

Query: 578   PGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSL 637
              G  +   G Y+                F    H   T+   +GL    V +   +V S 
Sbjct: 32888 DGKAITQGGKYKL---------SEDKGGFFLEIHKTDTSD--SGLYTCTVKNSAGSVSSS 32936

Query: 638   DLSTI--IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILH---------AV 686
                TI  I+ T        K++E   Q +   ++  I QK L+   I           A+
Sbjct: 32937 CKLTIKAIKDTEAQKVSTQKTSEITPQ-KKAVVQEEISQKALRSEEIKMSEAKSQEKLAL 32995

Query: 687   KHQDSGALVGFSCPGVQDSAALTIQESPVH-------ILSPQDR---------VSLTFTT 730
             K + S  L+      V+ SAA ++++S VH         S + R           ++   
Sbjct: 32996 KEEASKVLIS---EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINE 33052

Query: 731   SERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFEC-- 788
              +R+VL   ++       W  +G ++  SE     + G    L + +A  +D G   C  
Sbjct: 33053 GQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCIS 33111

Query: 789   -RTEG-VSAFFGVT----VQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAP-VRWY 841
                EG V   + +T    + D P  I  PR     +    + V+  CE+  E +P + W+
Sbjct: 33112 KTKEGIVKCQYDLTLSKELSDAPAFISQPRSQ---NINEGQNVLFTCEISGEPSPEIEWF 33168

Query: 842   KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEF 877
             K+   +  S  V +        L +     SD G++
Sbjct: 33169 KNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 33204



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 32/115 (27%), Positives = 50/115 (43%)

Query: 9     GSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHG 68
             G  P   +  + V    G  A+L C ++G P P + W + G++L  S +    +DG  H 
Sbjct: 30530 GEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT 30589

Query: 69    LLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGS 123
             L +      D GVY C A N  GE   ++ + +   P   P     E+   + GS
Sbjct: 30590 LTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGS 30644



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 81/379 (21%), Positives = 133/379 (35%), Gaps = 82/379 (21%)

Query: 131   LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALD--------------------- 169
             LT PRS  V  G     +C   G P PT+ W + G  L                      
Sbjct: 32564 LTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSV 32623

Query: 170   EVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGV-YVCHARNAHGHAQAGALLQVHQ 228
             +  D  ++++    +E    A   L I  AR+ +  V      ++     ++   ++  +
Sbjct: 32624 QASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPK 32683

Query: 229   PPESP-PADP------DEAPAPVVE----PLKCAPK--TFWVNEGKH--AKFRCYVMGK- 272
               +SP P+ P      +  P P  +    P+   PK   F   E     AK  C V    
Sbjct: 32684 RVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSV 32743

Query: 273   -PEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSA 331
                 E+ W+ +G+ L  +     +   DG + LK+      D+G YVC      G + + 
Sbjct: 32744 LRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTN 32803

Query: 332   VQ--------LHVKEPRL----------------RFTRP---------------LQDVEG 352
             +Q        +H K  ++                R T P               LQD   
Sbjct: 32804 LQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTV 32863

Query: 353   REHGIAVLECKVPNSRIPTA-WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYL 411
                 +A    K      PTA W ++ + +    KY+  E+     L IH+    D G+Y 
Sbjct: 32864 SSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYT 32923

Query: 412   CEMR---GRVRTVANVTVK 427
             C ++   G V +   +T+K
Sbjct: 32924 CTVKNSAGSVSSSCKLTIK 32942



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 10/164 (6%)

Query: 1366 LTPLTVHEGDDATFRCEVSP-PDADVTWLRNGAVVTPG--PQVEMAQNGSSRILTLRGCQ 1422
            L  + V EG  ATF   +S  P  +V+W R+G V++    P V+++ +     LT+    
Sbjct: 12   LQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVT 71

Query: 1423 LGDAGTVTLRA----GSTATSARLHVRETELL--FLRRLQDVRAEEGQDVCLEVETGRVG 1476
              ++G  +L+A    G   ++A L V+       F++RLQ +   +G  V L+V    + 
Sbjct: 72   KANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIP 131

Query: 1477 AAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTY 1520
                V++ R G  +       ++Q+G ++ L I      D GTY
Sbjct: 132  TP-VVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 12/141 (8%)

Query: 1020 VRWYKDGLEVEESE--ALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTV--- 1074
            V W++DG  +  S    + +     R +L +PA    + G +   A + S   T T    
Sbjct: 37   VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELL 96

Query: 1075 ----TAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLG 1130
                TAPP  +     +S+ +  G+  R+++R    P    V++Y+DG E+++S   Q+ 
Sbjct: 97   VKAETAPPNFVQR--LQSMTVRQGSQVRLQVRVTGIPT-PVVKFYRDGAEIQSSLDFQIS 153

Query: 1131 AEGPTRTLTLPHAQPEDAGEY 1151
             EG   +L +  A PED+G Y
Sbjct: 154  QEGDLYSLLIAEAYPEDSGTY 174



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 71/338 (21%), Positives = 130/338 (38%), Gaps = 44/338 (13%)

Query: 189   GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
             G+   L I  A   D G+  C ++   G  +    L + +       +  +APA + +P 
Sbjct: 33089 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSK-------ELSDAPAFISQP- 33140

Query: 249   KCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLY 308
                 ++  +NEG++  F C + G+P PEIEW     P+       + R R+  + L++  
Sbjct: 33141 ----RSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRN-VYSLEIRN 33195

Query: 309   CQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSR 368
                 D G Y   A+N  GQ  +   L V         P ++V  R  G   L+    +  
Sbjct: 33196 ASVSDSGKYTIKAKNFRGQCSATASLMVLP---LVEEPSREVVLRTSGDTSLQGSFSSQS 33252

Query: 369   IPTAWFREDQRL----------LPCRKYEQIEE---GTVRRLIIHRLKADDDGI-YLCEM 414
             +  +  +++             +   K+  +      +++   +    +   GI  + ++
Sbjct: 33253 VQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQL 33312

Query: 415   RGRVRTVANVTVKG--PILKRLPRKLDVLEGE-NAVLLVETLEAGVEGRWSRDGEELPVI 471
                   +    ++G  P ++ LP  + + EG+   V    T E   E  WS  G +   I
Sbjct: 33313 ESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRK---I 33369

Query: 472   CQSSSGHMH--------ALVLPGVTREDAGEVTFSLGN 501
                  G  H         L++  V ++D G  T SLGN
Sbjct: 33370 HSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGN 33407



 Score = 55.1 bits (131), Expect = 7e-07
 Identities = 97/418 (23%), Positives = 155/418 (37%), Gaps = 52/418 (12%)

Query: 373   WFREDQRLLPCRKYEQIEEGTVR-RLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPIL 431
             W R + R +   K++ +EEG V  +  + R++A    +    +        NV  K P  
Sbjct: 14331 WMRVNSRPIKDLKFK-VEEGVVPDKEYVLRVRA----VNAIGVSEPSEISENVVAKDPDC 14385

Query: 432   KRL----PRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQSSSGHMHA---LV 483
             K         + V+EGE   + V      V    W +DG+E+    + +  + H    L 
Sbjct: 14386 KPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLE 14445

Query: 484   LPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEP 543
             +P   R DAG  T +L N   +    +       PGP    +     K++  LTW+PPE 
Sbjct: 14446 VPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 14505

Query: 544   APETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSP 602
                TP + Y LER+E G   +I   S E   +  V  D +P+ G+Y FR+  V+  G   
Sbjct: 14506 DGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVK-DLIPN-GEYFFRVKAVNKVGGGE 14563

Query: 603   HVVFHGSAHLV----------------PTARLVAGLEDVQVYDGEDAVFSLDLSTIIQG- 645
             ++                         PTA  +       +YDG   +    +  I +G 
Sbjct: 14564 YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGE 14623

Query: 646   -TWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD 704
               W    E L             L Y    KGL+           ++ A +         
Sbjct: 14624 ERWKRCNEHLVP----------ILTY--TAKGLEEGKEYQFRVRAENAAGISEPSRATPP 14671

Query: 705   SAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPA-TWYKDGQKVEESEL 761
             + A+   ++P  IL    R SL     + + L   +S   +P  TW KD   +   E+
Sbjct: 14672 TKAVDPIDAPKVIL----RTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEI 14725



 Score = 55.1 bits (131), Expect = 7e-07
 Identities = 48/209 (22%), Positives = 92/209 (44%), Gaps = 24/209 (11%)

Query: 413   EMRGRVRTVANVTVKGP-------ILKRLPRKLDVLEGENAVLLVET-----LEAGVEGR 460
             + R   RT  N++           + + +P ++D+     ++L V+      L+A V G+
Sbjct: 19263 QFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGK 19322

Query: 461   ------WSRDGEELPV---ICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVK 511
                   W +DG  L     I  +   ++  L L  V R+D+G+ T +  NS  +    +K
Sbjct: 19323 PMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIK 19382

Query: 512   CVKHSPPGPPILAEMFKGHKNTVLLTWKPP-EPAPETPFIYRLERQEVGSEDWIQCFSIE 570
                   PGPP   ++ K + +  +L+W+PP E        Y ++++E    +W Q  +  
Sbjct: 19383 LKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATV 19442

Query: 571   KAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
                +  V  + +    +Y+FRIC  + +G
Sbjct: 19443 PITSCSV--EKLIEGHEYQFRICAENKYG 19469



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 100/471 (21%), Positives = 191/471 (40%), Gaps = 59/471 (12%)

Query: 260   GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
             G+ A+  C ++G+P P+I+W+  G+ L+  R+  M  D      L V+  + +D G+Y C
Sbjct: 30547 GEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSD-GRTHTLTVMTEEQEDEGVYTC 30605

Query: 320   AARNSAGQTLSAVQLHVK-EPRLRFTRPLQD-VEGREHGIAVLECKVPNSRIPTAWFRED 377
              A N  G+  ++ +L ++  P+     PL++   G       L        +P   +   
Sbjct: 30606 IATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHG 30665

Query: 378   QRLLPCRKYEQIEE-----GTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKG-PIL 431
             Q+LL   +   IE        V + +  +  A    + L  + G V  + +V ++  P  
Sbjct: 30666 QKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDK 30725

Query: 432   KRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVT--- 488
                P  ++ L   +AV+  +   A   G W  +   +   C++  G    LV   ++   
Sbjct: 30726 PTGPIVIEALLKNSAVISWKP-PADDGGSWITN--YVVEKCEAKEGAEWQLVSSAISVTT 30782

Query: 489   ------REDAG-------EVTFSLGNS---RTTTLLRVKCVKHSPPGPPILAEMFKGHKN 532
                    E+AG       + TF + +     +  +++    K   PG P +  +    K+
Sbjct: 30783 CRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAV---TKD 30839

Query: 533   TVLLTWKPPEPAPETPF-IYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEG-DYRF 590
             + ++ WKPP          Y LE++E     WI   + E    V    + +  EG +Y F
Sbjct: 30840 SCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLI--EGLEYEF 30897

Query: 591   RICTVSGHGRS-----PHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLS----T 641
             R+   +  G S        +   S   +        L ++ V    +A     ++     
Sbjct: 30898 RVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKP 30957

Query: 642   IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQ-KGLQHRLILHAVKHQDS 691
             I++  W+  G+E+ ++          L+YRI++ KG  H+LI+ +V   D+
Sbjct: 30958 IVK--WYRQGKEIIAD---------GLKYRIQEFKGGYHQLIIASVTDDDA 30997



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 54/214 (25%), Positives = 86/214 (40%), Gaps = 27/214 (12%)

Query: 127 APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALD-EVWDSSHFALQPGRAE 185
           AP F    +S  VL G+         G P P + W +DG  +          +   GRA+
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 186 DGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVV 245
                   L I A    +SG Y   A N  G A + A L V           + AP   V
Sbjct: 65  --------LTIPAVTKANSGRYSLKATNGSGQATSTAELLV---------KAETAPPNFV 107

Query: 246 EPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLK 305
           + L    ++  V +G   + +  V G P P ++++ +G  +   +  L ++    G +  
Sbjct: 108 QRL----QSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI---QSSLDFQISQEGDLYS 160

Query: 306 VLYCQA--KDRGLYVCAARNSAGQTLSAVQLHVK 337
           +L  +A  +D G Y   A NS G+  S  +L V+
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 9/119 (7%)

Query: 7     DQGSPPCFLRFPR---PVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPAD 63
             D+  PP     P+    + V +G   ++   + G+P P + W KG Q+L+ + RL   + 
Sbjct: 22536 DEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKST 22595

Query: 64    GAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
                  L +  A+  D+G Y+ +A+N AGE      V VL+ P       P E P+   G
Sbjct: 22596 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPG------PPEGPVVISG 22648



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 28/92 (30%), Positives = 48/92 (52%)

Query: 10  SPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
           +PP F++  + + V  G++  L+  V G P PVV + + G ++ +S       +G  + L
Sbjct: 102 APPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSL 161

Query: 70  LLTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
           L+  A P D+G Y   A N+ G A + A + V
Sbjct: 162 LIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 195/938 (20%), Positives = 327/938 (34%), Gaps = 198/938 (21%)

Query: 713  SPVHI-LSPQDRVS----LTFTTSERVVLTCELSRVDFPA-TWYKDGQKVEESELLVVKM 766
            +PV I ++P   VS    +T    E V L C +S    P  TWY++  ++E S    +  
Sbjct: 934  APVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF 993

Query: 767  DGRKHRLILPEA-------------------------KVQDSGEFECRTEGVSAFFGVT- 800
                 RL++ EA                          VQ S EFE  T  V+  F    
Sbjct: 994  QSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEE 1053

Query: 801  ---VQDPPVHIVD---------PREHVFVHAITSECV---------MLACEVDREDAP-V 838
               V+   V + D         P E    + IT   V         +  C+V     P V
Sbjct: 1054 KRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHV 1113

Query: 839  RWYKDGQEVEESDF--VVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTI---- 892
             W K G  +       V    +    +LV+  T   D GE+  V  ++    + +     
Sbjct: 1114 YWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE 1173

Query: 893  -----------------TDVSSWIVYPS------GKVYVAAVR---LERVVLTCELCRPW 926
                             T V++++  P       G VY    +    E+ ++  ++ +  
Sbjct: 1174 EADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDT 1233

Query: 927  AEVR-WTKDGEEVVESPALLLQKEDTVRRLVLPAVQL-EDSGEYLCEIDDESASFTVTVT 984
              VR + +D E  + S    L KE   R +     +L E+ GE    +D   +    +  
Sbjct: 1234 VVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGF 1293

Query: 985  EPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDGLEVEESEALVLE--RDG 1041
            +  ++     + +         V   C++S    P + WYKDG  ++  E   ++  +DG
Sbjct: 1294 DSRIKNYRILEGMG--------VTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG 1345

Query: 1042 PRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVEL 1101
             R  L +P   PED G +   A +             +  V PAA       GAP  +  
Sbjct: 1346 -RASLRIPVVLPEDEGIYTAFASNIKG----NAICSGKLYVEPAA-----PLGAPTYIPT 1395

Query: 1102 RCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAIT 1161
               V+   S          +  S A    A      ++     P    E   E++ E + 
Sbjct: 1396 LEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERL- 1454

Query: 1162 FNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPV---VWSHNGRP-VQEGE 1217
            +  +    PV F  LE   +              +L   G P+    W H+G+  V +  
Sbjct: 1455 YKPVFVLKPVSFKCLEGQTARF------------DLKVVGRPMPETFWFHDGQQIVNDYT 1502

Query: 1218 GLELHAEGPRRVLCIQAAGPAHAGLYT--CQSGAAPGAPSLSFTVQVAEPPVRVVAPEAA 1275
               +  E   + L I  A P+ +G +T   Q+ A   + S+  TV+  E  V+ +  E  
Sbjct: 1503 HKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKL 1562

Query: 1276 QTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLA--SQGRVQLEQAGARQVLRVQGAR 1332
            +  V    G  LE+ V  +G P   + W K+ + +      ++++E       L++    
Sbjct: 1563 K-NVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTV 1621

Query: 1333 SGDAGEY----LCDAPQDSRIFLVSVE-----------------------------EPLL 1359
            S D+  Y    +  A +D+    V+VE                             EPL 
Sbjct: 1622 SQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLH 1681

Query: 1360 VKLVSE---------------------LTPLTVHEGDDATFRCEVSP---PDADVTWLRN 1395
            ++   E                     LT L +     A F C ++P   P   V WL +
Sbjct: 1682 LRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHD 1741

Query: 1396 GAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELLF 1451
            G  +    ++ M        L        D+G +T RA    G+  TSA L V++ + L 
Sbjct: 1742 GKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL- 1800

Query: 1452 LRRLQDVRAEEGQDVCLEV-ETGRVGAAGAVRWVRGGQ 1488
               +++ +  EG+     + E  R+   GA+  V   Q
Sbjct: 1801 ---VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQ 1835



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 67/309 (21%), Positives = 111/309 (35%), Gaps = 55/309 (17%)

Query: 139  VLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRA----------EDGP 188
            +L G  V   C+  G P P + W KDG  +          LQ GRA          ++G 
Sbjct: 1302 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1361

Query: 189  GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQ----PPESPPADPDEAPAPV 244
              + A  I    +    +YV  A           L  V +     P S    P       
Sbjct: 1362 YTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPAR 1421

Query: 245  VEPLKCAPK----------------------------------TFWVNEGKHAKFRCYVM 270
            + P + +P                                   +F   EG+ A+F   V+
Sbjct: 1422 MSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVV 1481

Query: 271  GKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLS 330
            G+P PE  W  +G+ ++ D    +    DG   L ++     D G +   A+N AG++  
Sbjct: 1482 GRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSI 1541

Query: 331  AVQLHVK----EPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFREDQRLLPCRK 385
            +V L V+    + +  F   L++V  +E     ++ +   +  P   W +    ++P  K
Sbjct: 1542 SVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVP-HK 1600

Query: 386  YEQIE-EGT 393
            Y +I  EGT
Sbjct: 1601 YPKIRIEGT 1609



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 1/93 (1%)

Query: 21    VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
             +++++G    +  VV G P P  VW K   +L   +R+     G +  L++  AL  D G
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELD-KDRVVIDNVGTKSELIIKDALRKDHG 15172

Query: 81    VYVCRARNAAGEAYAAAAVTVLEPPASDPELQP 113
              YV  A N+ G  +AAA V V + P    +L+P
Sbjct: 15173 RYVITATNSCGSKFAAARVEVFDVPGPVLDLKP 15205



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 1/105 (0%)

Query: 5     SGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG 64
             S +    P F+  PR   +  G      C + GEP P + W K    ++ S  +S     
Sbjct: 33127 SKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSR 33186

Query: 65    AEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDP 109
               + L +  A  +D+G Y  +A+N  G+  A A++ VL P   +P
Sbjct: 33187 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVL-PLVEEP 33230



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 45/157 (28%), Positives = 63/157 (40%), Gaps = 16/157 (10%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             + V + +GA   L   V G PPPV+ W K G  LA+  R       +   L++      D
Sbjct: 29454 KTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLAS--RAIIDTTESYSLLIVDKVNRYD 29511

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS-------PGSGEGAPV-- 129
             AG Y   A N +G+  A   V V + P   P ++  E    S       P    GAPV  
Sbjct: 29512 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 29571

Query: 130   FLTGPRSQWVLRGAEVVLTC-----RAGGLPEPTLYW 161
             ++   R   +     V   C     R  GL E T+Y+
Sbjct: 29572 YIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYY 29608



 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 13/178 (7%)

Query: 1640 VTEGDTATFECELSQ-ALADVTWEKDGNALTPS--PRLRLQALGTRRLLQLRRCGPSDAG 1696
            V EG TATFE  +S   + +V+W +DG  ++ S  P +++     R  L +     +++G
Sbjct: 17   VLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSG 76

Query: 1697 TYSCAV--GTARA-GPVRLTVRERTVA--VLSELRSVSAREGDGATFECTVSEVET-TGR 1750
             YS     G+ +A     L V+  T     +  L+S++ R+G     +  V+ + T   +
Sbjct: 77   RYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVK 136

Query: 1751 WELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA----GPAQSLALLEVE 1804
            +   G  ++     +I QEG  + L+++E   ED+G     A    G A S A L V+
Sbjct: 137  FYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 11    PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
             PP F        V++G + ++    +G P P V W K    L  + R++  A+  E+  L
Sbjct: 22147 PPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVN--AESTENNSL 22204

Query: 71    LTA--ALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
             LT   A   D G YV +  N+AGEA     V VL+ P
Sbjct: 22205 LTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKP 22241



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 58/264 (21%), Positives = 108/264 (40%), Gaps = 22/264 (8%)

Query: 1631  IVRGPHDLEVTEGDTATFECELS-QALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRR 1689
             IV G  D  V+    A F  + + +      W KDG A+T   + +L        L++ +
Sbjct: 32854 IVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHK 32913

Query: 1690  CGPSDAGTYSCAVGTARAGPVRLTVRERTVAVL-SELRSVSAREGDGATFECTVSEVETT 1748
                SD+G Y+C V  + AG V  + +    A+  +E + VS ++    T E T  + +  
Sbjct: 32914 TDTSDSGLYTCTVKNS-AGSVSSSCKLTIKAIKDTEAQKVSTQK----TSEIT-PQKKAV 32967

Query: 1749  GRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE--DAGEVRFQAGPAQSLALLEVEAL 1806
              + E+  + LR    +++ +   +  L L E  ++   + EV+  A  +   +++  E  
Sbjct: 32968 VQEEISQKALR-SEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEIT 33026

Query: 1807  PLQMCRHPPR----------EKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEM 1856
                      R          + ++  G+R VL+  ++     V W+  G EL   ++Y  
Sbjct: 33027 KTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA-GATDVKWVLNGVELTNSEEYRY 33085

Query: 1857  RSHGPTHSLVIHDVRPEDQGTYCC 1880
                G   +L I      D+G   C
Sbjct: 33086 GVSGSDQTLTIKQASHRDEGILTC 33109



 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 180/863 (20%), Positives = 317/863 (36%), Gaps = 125/863 (14%)

Query: 228   QPPESPPADP--DEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRP 285
             +P ES  A    DE   P +        T  V+ G+  K    + GKP P I+W  +G  
Sbjct: 22524 EPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWI-KGDQ 22582

Query: 286   LLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV--------- 336
              L +  RL  +  D    L V      D G Y+  A+N AG+    V + V         
Sbjct: 22583 ELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 22642

Query: 337   ---------KEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYE 387
                      ++  L +  PLQD  G    I  +  +   SR+       + + L C+  +
Sbjct: 22643 PVVISGVTAEKCTLAWKPPLQD--GGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTK 22700

Query: 388   QIE--EGTVRRLIIHRLKADDD---------GIYLCEMRGRVRTVANVTVKGPILKRLPR 436
              +E  E T R + +++    +            ++     +   V  VT    I+     
Sbjct: 22701 LLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVW--- 22757

Query: 437   KLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQSSSGHMHALVLPGVTRED---- 491
             +    +G + +L     +   EG RW+R  + L        G +   V   +   D    
Sbjct: 22758 ERPASDGGSEILGYVLEKRDKEGIRWTRCHKRL-------IGELRLRVTGLIENHDYEFR 22810

Query: 492   -AGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP--EPAPETP 548
              + E    L      +  +  C     PGPP   ++    +++V L+W  P  +   E  
Sbjct: 22811 VSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ 22870

Query: 549   FIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHG 608
               Y +E+ +V   +W  C          +  + +  + +Y FRIC ++  G   H    G
Sbjct: 22871 G-YIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPG 22929

Query: 609   SAHLVPTARLVAGLEDVQV----YDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
                ++   +L A   D+ +         A  SL L   I+G       E+K  + +G++ 
Sbjct: 22930 P--IIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGR---PTPEVKWGKVDGEIR 22984

Query: 665   PGALRYRIEQKGLQHRLILHAVKHQDSG--ALVGFSCPGVQDSAALTIQ--ESPVHILSP 720
               A+   I+       L+L  V   DSG   L   +  G + SA +T++  ++P    SP
Sbjct: 22985 DAAI---IDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTK-SAFVTVRVLDTP----SP 23036

Query: 721   QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDG-RKHRLILPEAK 779
                + +T  T + V +T E   +D        G K++    +V K +  RK    +    
Sbjct: 23037 PVNLKVTEITKDSVSITWEPPLLD-------GGSKIK--NYIVEKREATRKSYAAVVTNC 23087

Query: 780   VQDSGEFECRTEGVSAFFGVTVQDP-----PVHIVDPREHVFVHAITSECVMLACEVDRE 834
              ++S + +   EG S +F VT ++      P    DP +   V     +  +   +V R 
Sbjct: 23088 HKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGK--ITVDDVTRN 23145

Query: 835   DAPVRWYK----DGQEVEESDFVVLENEGPH----------RRLVLPATQPSDGGE--FQ 878
                + W K     G ++ +    ++E +  H          + L    T  + G E  F+
Sbjct: 23146 SVSLSWTKPEHDGGSKIIQ---YIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFR 23202

Query: 879   CVAGDE--------CAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVR 930
              VA +E         A   V    V    V P+   Y   V  +  +      RP   + 
Sbjct: 23203 VVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTIT 23262

Query: 931   WTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEY----LCEIDDESASFTVTVTEP 986
             WTKDG  + ++  + +     +  L +     +D G+Y       +  ++AS  +   + 
Sbjct: 23263 WTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDK 23322

Query: 987   PVRIIYPRDEVTLIAVTLECVVL 1009
             P     P+  V    V+ E + L
Sbjct: 23323 PDP---PKGPVKFDDVSAESITL 23342



 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 44/198 (22%), Positives = 77/198 (38%), Gaps = 24/198 (12%)

Query: 1100  ELRCEVAPAG-SQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHE 1158
             +L C++       ++WY+ G E+  S   ++ ++G T TLT+   + ED G Y C     
Sbjct: 30551 QLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC----- 30605

Query: 1159  AITFNVILAEPPVQFLALETTPSPLCVAPGEPV----------VLSCELSRAGAPV---V 1205
              I  N +        L L+ TP      PG P+           L   +   G PV    
Sbjct: 30606 -IATNEVGEVETSSKLLLQATPQ---FHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMT 30661

Query: 1206  WSHNGRPVQEGEGLEL-HAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE 1264
             W H  + +Q  E + + + E    ++        HAG Y  Q     G       V++ +
Sbjct: 30662 WFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQD 30721

Query: 1265  PPVRVVAPEAAQTRVRST 1282
              P +   P   +  ++++
Sbjct: 30722 KPDKPTGPIVIEALLKNS 30739



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 40/149 (26%), Positives = 68/149 (45%), Gaps = 13/149 (8%)

Query: 925  PWAEVRWTKDGEEVVES--PALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVT 982
            P  EV W +DG+ +  S  P + +   D   +L +PAV   +SG Y  +  + S   T T
Sbjct: 33   PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATST 92

Query: 983  V-------TEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV-RWYKDGLEVEESEA 1034
                    T PP   +     +T+   +   V L   ++    PV ++Y+DG E++ S  
Sbjct: 93   AELLVKAETAPP-NFVQRLQSMTVRQGSQ--VRLQVRVTGIPTPVVKFYRDGAEIQSSLD 149

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDA 1063
              + ++G    L++  A PED G +  +A
Sbjct: 150  FQISQEGDLYSLLIAEAYPEDSGTYSVNA 178



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 75/330 (22%), Positives = 128/330 (38%), Gaps = 32/330 (9%)

Query: 516   SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIE-KAG 573
             SPP PP+   +    +  + + WKPPE    +P I Y +E   VG+E W++  S   K  
Sbjct: 14283 SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDL 14342

Query: 574   AVEVPGDCVPSEGDYRFRICTVSGHGRS-PHVVFHGSAHLVPTARLVAGLE--DVQVYDG 630
               +V    VP + +Y  R+  V+  G S P  +        P  +    LE  D+ V +G
Sbjct: 14343 KFKVEEGVVPDK-EYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEG 14401

Query: 631   EDAVFSLDLSTIIQGT--WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKH 688
             E     +    +   T  W  +G+E+K+++          R  ++   +   L +     
Sbjct: 14402 EKLSIPVPFRAVPVPTVSWHKDGKEVKASD----------RLTMKNDHISAHLEVPKSVR 14451

Query: 689   QDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD--FP 746
              D+G +   +      SA  +I    + +  P   +  +  T     LT E    D   P
Sbjct: 14452 ADAG-IYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTP 14510

Query: 747   ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFG-------- 798
                Y   ++       +  M G +++L      +  +GE+  R + V+   G        
Sbjct: 14511 ILHYVLERREAGRRTYIPVMSG-ENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKN 14569

Query: 799   -VTVQDPPVHIVDPREHVFVHAITSECVML 827
              V  QDP     DP   V VH  T+E + +
Sbjct: 14570 PVIAQDPK-QPPDPPVDVEVHNPTAEAMTI 14598



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 25/81 (30%), Positives = 40/81 (49%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G   +++  VLG P P V W+KG Q L  ++R++F        L +   + +D+G Y  
Sbjct: 21079 AGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPL 21138

Query: 85    RARNAAGEAYAAAAVTVLEPP 105
              ARN  GE      + V + P
Sbjct: 21139 TARNIVGEVGDVITIQVHDIP 21159



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 127/603 (21%), Positives = 215/603 (35%), Gaps = 98/603 (16%)

Query: 37    GEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAA 96
             G P   V W K GQ L  + R++  +      L +  A   D G Y     N+AG     
Sbjct: 25420 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 25479

Query: 97    AAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPR-SQWVLRGAEVVLTCRAGGLP 155
               + VL+ P     ++  E    S       P +  G + S +++   E   T       
Sbjct: 25480 ITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT------ 25533

Query: 156   EPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVY---VCHAR 212
                  W     A+                     A  +++I+  RL     Y   VC A 
Sbjct: 25534 -----WHIVSQAV---------------------ARTSIKIV--RLTTGSEYQFRVC-AE 25564

Query: 213   NAHG---HAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFW---VNEGKHAKFR 266
             N +G   ++++ A+  V + P SPP  P      VV   K      W   VN+G      
Sbjct: 25565 NRYGKSSYSESSAV--VAEYPFSPPGPP--GTPKVVHATKSTMLVTWQVPVNDGGSRVIG 25620

Query: 267   CYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCA------ 320
              ++  K    I W    + L+ D + +     D G + +         G+  C+      
Sbjct: 25621 YHLEYKERSSILWSKANKILIADTQ-MKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPV 25679

Query: 321   -ARNSA---GQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFRE 376
              AR+     GQ      +  K   L++++P  D   +  G  V   ++P           
Sbjct: 25680 PARDPCDPPGQP-EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELP----------- 25727

Query: 377   DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVK-GPILKR-- 433
             D R L C  Y  I+E       +  L  D    +    R    +V+  +   GPI+ +  
Sbjct: 25728 DGRWLKCN-YTNIQETYFE---VTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDD 25783

Query: 434   --LPRKLDVLEGENAVLL----VETLEAGVEGR------WSRDGEELPVICQS---SSGH 478
                PR +  ++  + +++    V  + A + GR      W++DG E+    ++   S+ +
Sbjct: 25784 VEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN 25843

Query: 479   MHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKG-HKNTVLLT 537
                L +    R D G+   +L N   T  + V C     PGPP       G       L+
Sbjct: 25844 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLS 25903

Query: 538   W-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVS 596
             W +P E        Y +E++E     W  C    +  + +V    +    +Y FR+  V+
Sbjct: 25904 WGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTK--LLKGNEYIFRVTGVN 25961

Query: 597   GHG 599
              +G
Sbjct: 25962 KYG 25964



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 24/85 (28%), Positives = 43/85 (50%)

Query: 21    VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
             V + +G++  L   V G+P P ++W KG ++L   E++S    G     ++     +D+G
Sbjct: 29057 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 29116

Query: 81    VYVCRARNAAGEAYAAAAVTVLEPP 105
              Y    +NA+G    +  V VL+ P
Sbjct: 29117 KYTLTVKNASGTKAVSVMVKVLDSP 29141



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 87/433 (20%), Positives = 168/433 (38%), Gaps = 45/433 (10%)

Query: 516   SPPGPPILA-EMFKGHKNTVLLTW-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAG 573
             +PP PP    E+    K++V L+W +P +        Y +ER+E  ++ W++    +   
Sbjct: 30327 NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITT 30386

Query: 574   AVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLE--DVQVYDGE 631
              +      VP + +Y+FRI   +  G S            P +  V   +  D     GE
Sbjct: 30387 TMYTVTGLVP-DAEYQFRIIAQNDVGLS---------ETSPASEPVVCKDPFDKPSQPGE 30436

Query: 632   DAVFSLDLSTII--------QGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLIL 683
               + S+   ++          G   + G  ++  +        + + RI+ K      +L
Sbjct: 30437 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 30496

Query: 684   HAVKHQD---SGALVGFSCP---GVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLT 737
              A +++    +    G S P    +     LT  E+P      +D   +T    E   L+
Sbjct: 30497 EATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKD---VTTKLGEAAQLS 30553

Query: 738   CELSRVDFP-ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFEC----RTEG 792
             C++     P   WY+ G+++ +S    +  DGR H L +   + +D G + C        
Sbjct: 30554 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 30613

Query: 793   VSAFFGVTVQ-DPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESD 851
             V     + +Q  P  H   P +  +  A+ S   +    + R    + W+   + ++ S+
Sbjct: 30614 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 30673

Query: 852   FVVLENEGPHRRLVLPATQ-PSDGGEFQC----VAGDECAYFTVTITDVSSWIVYPSGKV 906
              + +EN   +  LV+   Q  +  G+++     V G   A   V I D       P+G +
Sbjct: 30674 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD---KPTGPI 30730

Query: 907   YVAAVRLERVVLT 919
              + A+     V++
Sbjct: 30731 VIEALLKNSAVIS 30743



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 42/188 (22%), Positives = 74/188 (39%), Gaps = 10/188 (5%)

Query: 1638  LEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGT 1697
             + + EG     +  ++ A  DV W  +G  LT S   R    G+ + L +++    D G 
Sbjct: 33048 MSINEGQRLVLKANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGI 33106

Query: 1698  YSCAVGTARAGPVR----LTVRER---TVAVLSELRSVSAREGDGATFECTVS-EVETTG 1749
              +C +   + G V+    LT+ +      A +S+ RS +  EG    F C +S E     
Sbjct: 33107 LTC-ISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEI 33165

Query: 1750  RWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQ 1809
              W     P+   + V I +    + L +      D+G+   +A   +         + L 
Sbjct: 33166 EWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLP 33225

Query: 1810  MCRHPPRE 1817
             +   P RE
Sbjct: 33226 LVEEPSRE 33233



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 8     QGSPPCFL--RFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGA 65
             Q +P  FL  +    + V +G + EL   V G+P P + W K    L   +R++      
Sbjct: 13685 QEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPK 13744

Query: 66    EHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
             +  + +  +  +D G Y+  A N  G A A   V VL+ P
Sbjct: 13745 KSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKP 13784



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 34/147 (23%), Positives = 67/147 (45%), Gaps = 6/147 (4%)

Query: 461   WSRDGEELPVICQ---SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSP 517
             W +DG+ L    +   SSS  + +L +   ++ED G     + NS  +  + +  +    
Sbjct: 25428 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 25487

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             PGPP    + +   +++ ++W PPE         Y +E++E  S  W          +++
Sbjct: 25488 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 25547

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSPH 603
             +      SE  Y+FR+C  + +G+S +
Sbjct: 25548 IVRLTTGSE--YQFRVCAENRYGKSSY 25572



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 60/268 (22%), Positives = 101/268 (37%), Gaps = 48/268 (17%)

Query: 1300  VRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQD-------SRIFLV 1352
             V WY    +L +  + ++       +L V+     D G Y C    D       + +F+ 
Sbjct: 31600 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVK 31659

Query: 1353  SVEEPL-------------------LVKLVSELT-PL---TVHEGDDATFRCEVSP-PDA 1388
              V E                     L++   E T PL   T + G++  F   ++  P+ 
Sbjct: 31660 GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEP 31719

Query: 1389  DVTWLRNGAVVTPGPQVEMAQNGSSR---ILTLRGCQLGDAGTVTLRA----GSTATSAR 1441
              VTW ++G  + PG   +     S +    LT+      D    T+ A    G  +  A+
Sbjct: 31720 HVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAK 31779

Query: 1442  L----HVRETEL----LFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHD 1493
             L    H   T+     +F R L +   +EGQ VC E+    +     ++W + GQPL   
Sbjct: 31780 LTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGI-PPPTLKWEKDGQPLSLG 31838

Query: 1494  SRLSMAQDG-HIHRLFIHGVILADQGTY 1520
               + +  +G   + L I   +  D G Y
Sbjct: 31839 PNIEIIHEGLDYYALHIRDTLPEDTGYY 31866



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 52/187 (27%), Positives = 87/187 (46%), Gaps = 19/187 (10%)

Query: 1725 LRSVSAREGDGATFECTVS-----EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSE 1779
            L+SV   EG  ATFE  +S     EV      ++      PG ++    +G+  + + + 
Sbjct: 12   LQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISF-SDGRAKLTIPAV 70

Query: 1780 LRAEDAGEVRFQA----GPAQSLA--LLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVS 1833
             +A ++G    +A    G A S A  L++ E  P    +   +  TV  G +  L+V V+
Sbjct: 71   TKA-NSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRL-QSMTVRQGSQVRLQVRVT 128

Query: 1834 RSGGHVC-WLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA----GQDSTH 1888
                 V  + R+GAE+     +++   G  +SL+I +  PED GTY   A    G+ ++ 
Sbjct: 129  GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST 188

Query: 1889 TRLLVEG 1895
              LLV+G
Sbjct: 189  AELLVQG 195



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 1812  RHPPREKTVLVGRRAVLEVT-VSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDV 1870
             R   ++ T  +G  A L    V R    + W R G EL    KY+M S G TH+L +   
Sbjct: 30536 RKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTE 30595

Query: 1871  RPEDQGTYCC----QAGQDSTHTRLLVE 1894
               ED+G Y C    + G+  T ++LL++
Sbjct: 30596 EQEDEGVYTCIATNEVGEVETSSKLLLQ 30623



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 44/93 (47%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V+ G +  +       P P V W K G+++ AS+RL+   D     L +  ++  DAG+Y
Sbjct: 14398 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 14457

Query: 83    VCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
                  N  G A A+  V V+  P    +++ ++
Sbjct: 14458 TITLENKLGSATASINVKVIGLPGPCKDIKASD 14490



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 40/85 (47%)

Query: 21    VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
             + V  G    +   V G P P + W K G+ L   +R+    D     L +  A+  D G
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 17977

Query: 81    VYVCRARNAAGEAYAAAAVTVLEPP 105
              Y+  A+N++G A  +A V VL+ P
Sbjct: 17978 KYIISAKNSSGHAQGSAIVNVLDRP 18002



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 33/101 (32%), Positives = 42/101 (41%), Gaps = 2/101 (1%)

Query: 7     DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVW--EKGGQQLAASERLSFPADG 64
             D   P   L+    + V +G    L+  V G+P P V W  +K    L  S R+      
Sbjct: 18197 DLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRA 18256

Query: 65    AEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
                   LT A  +D G YV  A N AG   A A V VL+ P
Sbjct: 18257 DSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP 18297



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 8/149 (5%)

Query: 461   WSRDGEEL---PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSP 517
             WS+ G+++    +   +S+     L +   TR+DAGE T +  N   T +  VK      
Sbjct: 20413 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDV 20472

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPF-IYRLERQEVGSEDW-IQCFSIEKAGAV 575
             PGPP   E+         LTW PP     +P   Y LE++E     W +    I+    V
Sbjct: 20473 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHV 20532

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRSPHV 604
                   +    +Y FR+  V+ +G+   V
Sbjct: 20533 ATK---LIQGNEYIFRVSAVNHYGKGEPV 20558



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 248   LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVLKV 306
             ++  P    ++EGK     C   G+P PE+ W   GR +   ++ R    + D    L +
Sbjct: 33331 IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLII 33390

Query: 307   LYCQAKDRGLYVCAARNSAGQTLSAVQLHVK 337
             +  Q +D GLY  +  N  G   + V +H++
Sbjct: 33391 MDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 33421



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 83/382 (21%), Positives = 142/382 (37%), Gaps = 51/382 (13%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP 541
             LV+    R D G  T  L N   T    +     + P  P   +     K++V LTW+PP
Sbjct: 13452 LVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPP 13511

Query: 542   EPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVS--GH 598
             +    +P   Y +E++EV  + W +           VP D V  + +Y F++C  +  G 
Sbjct: 13512 DDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVP-DLVQGK-EYLFKVCARNKCGP 13569

Query: 599   GRSPHV---VFHGSAHLVP-----------TARLVAGLEDVQVYDGEDAVFSLDLSTIIQ 644
             G   +V   V   +   VP           TA  +    D    DG   +    +    +
Sbjct: 13570 GEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPR 13629

Query: 645   GT--WFLNGEELKSNEPE--GQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP 700
             G+  W   GE +   + E  G  E     YR++    Q                 G S P
Sbjct: 13630 GSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQ-----------------GASKP 13672

Query: 701   G--VQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFP-ATWYKDGQKVE 757
                 ++  A+  QE+P   L  +    LT     ++ L   ++    P  TW K    ++
Sbjct: 13673 SRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILK 13732

Query: 758   ESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGV----SAFFGVTVQDPPVHIVDPRE 813
             + + + ++   +K  + + ++K  D+G +      V    +A   V V D P     P  
Sbjct: 13733 QDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKP----GPPA 13788

Query: 814   HVFVHAITSECVMLACEVDRED 835
                +  +T+E  +L     R+D
Sbjct: 13789 AFDITDVTNESCLLTWNPPRDD 13810



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 38/163 (23%), Positives = 62/163 (38%), Gaps = 16/163 (9%)

Query: 7     DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE 66
             +Q  PP  L  P  + + +G +  ++  V G+P P   W+KG  ++  S  L+     + 
Sbjct: 18895 EQLLPPKIL-MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSS 18953

Query: 67    HGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPAS----------DPELQPAER 116
               L++      D+G Y   A N++G       V V++ P            D +      
Sbjct: 18954 SILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSW 19013

Query: 117   PLPSPGSGEGAPVFLTG----PRSQWVLRGAEVVLT-CRAGGL 154
              +P    G     ++       R  WV   A V  T CR G L
Sbjct: 19014 HIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKL 19056



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 117/570 (20%), Positives = 217/570 (38%), Gaps = 77/570 (13%)

Query: 345   RPLQDVEGREHGIAVLECKVPNSRIPTA-WFREDQRLLPCRKYEQIEEGTVRRLIIHRLK 403
             + ++DV  +    A L C++    +P   W+R  + L+  RKY+   +G    L +   +
Sbjct: 30537 KEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEE 30596

Query: 404   ADDDGIYLCEMRGRVRTVANVTVKGPILKRLPR---------KLDVLEGENAVLLVETLE 454
              +D+G+Y C     V  V   T    +L+  P+         K     G    L V  + 
Sbjct: 30597 QEDEGVYTCIATNEVGEVE--TSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIG 30654

Query: 455   AGVEGRWSRDGEEL----PVICQSSSGHMHALVLPGVTRED-AGEVTFSLGNSRTTTL-- 507
               V       G++L      I   ++ H   LV+  V R+  AG+    L N   T    
Sbjct: 30655 RPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI 30714

Query: 508   --LRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE-----TPFIYRLERQEVGS 560
               + ++     P GP ++  + K   N+ +++WKP  PA +     T ++      + G+
Sbjct: 30715 LDVEIQDKPDKPTGPIVIEALLK---NSAVISWKP--PADDGGSWITNYVVEKCEAKEGA 30769

Query: 561   EDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSP-----HVVFHGSAHLVPT 615
             E W    S        +    +     Y FR+   +  G S       VV   S    P 
Sbjct: 30770 E-WQLVSSAISVTTCRIVN--LTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPG 30826

Query: 616   ARLVAGLEDVQVYDGEDAVFSLDLSTIIQGT----WFLNGEELKSNE----PEGQVEPGA 667
             A    G   +     +  V +        G     ++L   E K N+       ++    
Sbjct: 30827 A---PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETV 30883

Query: 668   LRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSP---QDRV 724
                +   +GL++      VK ++ G    +S    + S  +T  +S V I +P   ++  
Sbjct: 30884 FSVKNLIEGLEYEF---RVKCENLGGESEWS----EISEPIT-PKSDVPIQAPHFKEELR 30935

Query: 725   SLTFTTSERVVLTCELSRVDFPAT-WYKDGQKVEESELL--VVKMDGRKHRLILPEAKVQ 781
             +L         L C+++    P   WY+ G+++    L   + +  G  H+LI+      
Sbjct: 30936 NLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDD 30995

Query: 782   DSGEFECRTEG----VSAFFGVTVQDPP-VHIVDPREHV-FVHAITSECVMLACEVDRED 835
             D+  ++ R       VS    + V+ P  +H+    E +  VHA+  E V +      + 
Sbjct: 30996 DATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 31055

Query: 836   APVRWYKDGQEVEESDFVVLENEGPHRRLV 865
              PV  ++ GQ+       +++N G ++ +V
Sbjct: 31056 DPVITWQKGQD-------LIDNNGHYQVIV 31078



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 60/287 (20%), Positives = 101/287 (35%), Gaps = 49/287 (17%)

Query: 1461  EEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTY 1520
             EEG  V    +      +  V W  G + L +  +  +  +  +  L++  +   D GTY
Sbjct: 31580 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 31639

Query: 1521  GCESHHD------------------------RTLARLSVRPRQLRVLRPLEDVTISEGGS 1556
              C+  +D                        RT+ ++  R   +R+L    + T+     
Sbjct: 31640 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 31699

Query: 1557  ATFQLELSQEGVT--------GEWARGGVQLYPG---PKCHIHSDGHRHRLVLNGLGLAD 1605
               +  E  + GVT          W + G ++ PG    K    SD   ++L +N +   D
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 31759

Query: 1606  SGCVSFTA------DSLRCAARLIVREVPVTIVRGP------HDLEVTEGDTATFECELS 1653
                 +  A      DS +    + +   P      P       + E  EG +  FE  +S
Sbjct: 31760 DAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVS 31819

Query: 1654  Q-ALADVTWEKDGNALTPSPRLRLQALG-TRRLLQLRRCGPSDAGTY 1698
                   + WEKDG  L+  P + +   G     L +R   P D G Y
Sbjct: 31820 GIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 31866



 Score = 44.7 bits (104), Expect = 9e-04
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 16    RFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAAL 75
             +F   + V +G    L+  V G+P P + W +G +++  S R        +  L++  A+
Sbjct: 23630 KFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAI 23689

Query: 76    PTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
               D G Y+ RA N AG       V VL+ P       P E P+   G
Sbjct: 23690 RIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTG 23730



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 45/180 (25%), Positives = 75/180 (41%), Gaps = 17/180 (9%)

Query: 1284 GGDLELVVHLSG-PGGPVRWYKDGERLASQGR--VQLEQAGARQVLRVQGARSGDAGEYL 1340
            G       H+SG P   V W++DG+ +++     VQ+  +  R  L +      ++G Y 
Sbjct: 20   GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYS 79

Query: 1341 CDAPQDSRIFLVSVEEPLLVK-------LVSELTPLTVHEGDDATFRCEVSP-PDADVTW 1392
              A   S     + E  LLVK        V  L  +TV +G     +  V+  P   V +
Sbjct: 80   LKATNGSGQATSTAE--LLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKF 137

Query: 1393 LRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETE 1448
             R+GA +      +++Q G    L +      D+GT ++ A    G   ++A L V+  E
Sbjct: 138  YRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEE 197



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 23/75 (30%), Positives = 35/75 (46%)

Query: 31    LKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAA 90
             LK  + G+P P V W+KG   LA   R+S  +      L++     +DAG Y    +N A
Sbjct: 20002 LKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVA 20061

Query: 91    GEAYAAAAVTVLEPP 105
             G      ++ V+  P
Sbjct: 20062 GTKEGTISIKVVGKP 20076



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 6/104 (5%)

Query: 15    LRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
             ++F   V + +G    L+  V G PPP + W K G++L  + +L          L+   +
Sbjct: 21465 VKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS 21524

Query: 75    LPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPL 118
                D+G Y   A N  G A     V VL+ P       P E PL
Sbjct: 21525 TRRDSGAYTLTATNPGGFAKHIFNVKVLDRPG------PPEGPL 21562



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G + ++     G PPP V W K  + L +  R S     +   L +      D G Y+ 
Sbjct: 27285 AGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYIL 27344

Query: 85    RARNAAGEAYAA-AAVTVLEPPASDPELQ 112
                N  GE  ++  +V VL+ PA+  +LQ
Sbjct: 27345 TIENGVGEPKSSTVSVKVLDTPAACQKLQ 27373



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 50/213 (23%), Positives = 75/213 (35%), Gaps = 40/213 (18%)

Query: 1721  VLSELRSVSAREGDGATFECTVSEVE--TTGRWELGGRPLRPGARVRIRQEGKKHILVLS 1778
             V  ++      EG    + C +   +  T   W  G R L    +  I  E    IL + 
Sbjct: 31570 VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVK 31629

Query: 1779  ELRAEDAGEVRFQA----GPAQSLALLEVEAL--------------------PLQMCRHP 1814
             ++   D G  R +     G   S A L V+ +                     +++   P
Sbjct: 31630 DITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERP 31689

Query: 1815  PR------EKTVLVGRRAVLEVTVS-RSGGHVCWLREGAELCPGD---KYEMRSHGPTHS 1864
             P        KT  VG      VT++     HV W + G ++ PGD   KY   S    + 
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 31749

Query: 1865  LVIHDVRPEDQGTYCCQA----GQDSTHTRLLV 1893
             L I+ V  +D   Y   A    G+DS   +L V
Sbjct: 31750 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 1/91 (1%)

Query: 12    PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE-HGLL 70
             P F R         G     +  V G PPP + WEK GQ L+    +    +G + + L 
Sbjct: 31795 PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 31854

Query: 71    LTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
             +   LP D G Y   A N AG     A + V
Sbjct: 31855 IRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP 541
             L +     ED G  + ++ N   +  + VK +    PGPP   E+ +  K++  LTWK P
Sbjct: 17274 LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEP 17333

Query: 542   -EPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR 600
              +        Y +ER++V S  W    +  K  +       +     Y FR+   + +GR
Sbjct: 17334 LDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKH--LNEGNQYLFRVAAENQYGR 17391

Query: 601   SPHV 604
              P V
Sbjct: 17392 GPFV 17395



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PPGPP   E+    K+++ L WKPP     +P   Y +E QE G+ DW +   + +   +
Sbjct: 15704 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKR---VNEPDKL 15760

Query: 576   EVPGDCVPSE----GDYRFRICTVSGHGRS 601
                 +CV         YRFR+  V+  G S
Sbjct: 15761 ITTCECVVPNLKELRKYRFRVKAVNEAGES 15790



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 23/83 (27%), Positives = 32/83 (38%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +G       ++ G P P   W   G ++   E  +   D     L +   L  D G Y
Sbjct: 17522 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 17581

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                  NAAG    A  +TVL+ P
Sbjct: 17582 QITVSNAAGSKTVAVHLTVLDVP 17604



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 100/465 (21%), Positives = 172/465 (36%), Gaps = 60/465 (12%)

Query: 1021  RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER 1080
             +W  DG E++  E   +E D     L +      D GE+     + +   TV V      
Sbjct: 17543 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 17602

Query: 1081  IVHPAARSLDLHFGAPGRVELRCEVAP--AGSQVRWYKDGLEVEASDALQLGAEGPTRT- 1137
             +  P    +++    P  + +  +      GS V  Y    +    D   + + G ++T 
Sbjct: 17603 VPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK 17662

Query: 1138  LTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALE-----TTPSPLCVAPGEPVV 1192
             L +PH Q     EYV   R E    N I   PP+           + PSP    PG+PVV
Sbjct: 17663 LKIPHLQK--GCEYVFRVRAE----NKIGVGPPLDSTPTVAKHKFSPPSP----PGKPVV 17712

Query: 1193  LSCELSRAGAPVVW----SHNGRPVQ---------EGEGLELHAEGPRRVLCIQAAGPAH 1239
                +++   A V W    S  G P+           G+ + ++ + P   L  +  G   
Sbjct: 17713 T--DITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVN-KTPIADLKFRVTGLYE 17769

Query: 1240  AGLYTCQ------SGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHL 1293
                Y  +      +G +  +PS S  ++   P      P   + + +S    DL     L
Sbjct: 17770 GNTYEFRVFAENLAGLSKPSPS-SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPL 17828

Query: 1294  SGPGGPVRWY-----KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDA----- 1343
             S  G P+  Y     K G   A   R+  ++   +   RV G   G+   +   A     
Sbjct: 17829 SDGGSPILGYVVECQKPGT--AQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVG 17886

Query: 1344  ---PQD--SRIFLVSVEEPLLVKL-VSELTPLTVHEGDDATFRCEVSP-PDADVTWLRNG 1396
                P++    +    +  P  V+L V+    +TV  G        V   P+ D+TW + G
Sbjct: 17887 EGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG 17946

Query: 1397  AVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSAR 1441
              V+    +V++ Q+     L ++     D G   + A +++  A+
Sbjct: 17947 KVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 17991



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 72/378 (19%), Positives = 127/378 (33%), Gaps = 62/378 (16%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             R + V +G    +   + G P P V W K    L    R +     +   L++      D
Sbjct: 20784 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL--KNRANIENTESFTLLIIPECNRYD 20841

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPR-SQ 137
              G +V    N AG+      V VL+ P     L+P +    S       P+   G R + 
Sbjct: 20842 TGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITN 20901

Query: 138   WVLRGAEV-------------------------------VLTCRAGGLPEPTLYWEK--- 163
             +++   E                                V+     G+ EPT   E    
Sbjct: 20902 YIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKA 20961

Query: 164   -------DGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYV-------- 208
                    D + + ++  S+     P    DG G+ +   ++ A+   S  +         
Sbjct: 20962 SEAPSPPDSLNIMDITKSTVSLAWPKPKHDG-GSKITGYVIEAQRKGSDQWTHITTVKGL 21020

Query: 209   -CHARN-AHGHAQAGALLQVHQPPESPPADP------DEAPAPVVEPLKCAPKTFWVNEG 260
              C  RN   G      ++ V+    S P +       ++   P ++      K      G
Sbjct: 21021 ECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAG 21080

Query: 261   KHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCA 320
              + K    V+G+P+P + W  +G  +L   +R+ +       +L +  C   D G Y   
Sbjct: 21081 DNIKVEIPVLGRPKPTVTWK-KGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLT 21139

Query: 321   ARNSAGQTLSAVQLHVKE 338
             ARN  G+    + + V +
Sbjct: 21140 ARNIVGEVGDVITIQVHD 21157



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 24/83 (28%), Positives = 39/83 (46%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             + +G + +++  V+G P P + W K G+ L  + R++         L +      D G Y
Sbjct: 24323 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 24382

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                A N+AG A    +V VLE P
Sbjct: 24383 TVTATNSAGTATENLSVIVLEKP 24405



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 22/92 (23%), Positives = 40/92 (43%)

Query: 10    SPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
             S P  +   +   V S + A+      GEP P  +W K G+ +    +     D     L
Sbjct: 32850 SKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFL 32909

Query: 70    LLTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
              +     +D+G+Y C  +N+AG   ++  +T+
Sbjct: 32910 EIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 32941



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 52/216 (24%), Positives = 87/216 (40%), Gaps = 29/216 (13%)

Query: 727 TFTTSERVVLTCELSRVDFPA----------TWYKDGQKVEESELLVVKM---DGRKHRL 773
           TFT   + V+  E S   F A          +W++DGQ +  S L  V++   DGR  +L
Sbjct: 7   TFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA-KL 65

Query: 774 ILPEAKVQDSGEFECRTEGVS------AFFGVTVQDPPVHIVDPREHVFVHAITSECVML 827
            +P     +SG +  +    S      A   V  +  P + V   + + V   +   V L
Sbjct: 66  TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ--VRL 123

Query: 828 ACEVDREDAPV-RWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECA 886
              V     PV ++Y+DG E++ S    +  EG    L++    P D G +   A +   
Sbjct: 124 QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183

Query: 887 YFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCEL 922
             T T        +   G+  V A + + +V T ++
Sbjct: 184 RATSTAE------LLVQGEEEVPAKKTKTIVSTAQI 213



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 38/122 (31%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 219   QAGALLQVHQPPESPPADPDEAPAPVVEP---LKCAPKTFW-VNEGKHAKFRCYVMGKPE 274
             +A A   V+  P S P+DP    A  V P   L  A K+   V  G +      V GKP 
Sbjct: 19265 RAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPM 19324

Query: 275   PEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             P + W  +G  L P     M   R+    L++     KD G Y   A NS+G   + ++L
Sbjct: 19325 PTVSWKKDGTLLKPAEGIKMAMQRN-LCTLELFSVNRKDSGDYTITAENSSGSKSATIKL 19383

Query: 335   HV 336
              V
Sbjct: 19384 KV 19385



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 23/87 (26%), Positives = 34/87 (39%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             + + V +G   EL   + G PPP   W   G +L  SER++         L +      D
Sbjct: 29746 KTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRD 29805

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPP 105
              G Y    +N  G       V +L+ P
Sbjct: 29806 TGEYTLELKNVTGTTSETIKVIILDKP 29832



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 48/225 (21%), Positives = 86/225 (38%), Gaps = 25/225 (11%)

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
             G    L+C+  G P P + W + G    E+  S  + +         G +  L ++    
Sbjct: 30547 GEAAQLSCQIVGRPLPDIKWYRFGK---ELIQSRKYKMS------SDGRTHTLTVMTEEQ 30597

Query: 202   PDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGK 261
              D GVY C A N  G  +  + L +   P+  P            PLK   + ++   G 
Sbjct: 30598 EDEGVYTCIATNEVGEVETSSKLLLQATPQFHPG----------YPLK---EKYYGAVGS 30644

Query: 262   HAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDR-GLYVCA 320
               +     +G+P P + W + G+ LL +   +   + +    L +   Q K   G Y   
Sbjct: 30645 TLRLHVMYIGRPVPAMTW-FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQ 30703

Query: 321   ARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVP 365
               N  G   + + + +++   + T P+  +E      AV+  K P
Sbjct: 30704 LSNVFGTVDAILDVEIQDKPDKPTGPIV-IEALLKNSAVISWKPP 30747



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 2/99 (2%)

Query: 5     SGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG 64
             +G +G PP     P  + +  G    + C   GEP P V W  GG+++ + E+  F  + 
Sbjct: 33322 AGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIEN 33381

Query: 65    AEH--GLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
              +    L++      D G+Y     N  G   A   + +
Sbjct: 33382 TDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/83 (30%), Positives = 35/83 (42%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             + SG    +K +V G P P V W K G ++     +          L +  A     GVY
Sbjct: 27970 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 28029

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                A+NA+G A A   V V + P
Sbjct: 28030 TVEAKNASGSAKAEIKVKVQDTP 28052



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 119/577 (20%), Positives = 207/577 (35%), Gaps = 118/577 (20%)

Query: 1111 QVRWYKDGLEVEASDALQLG-AEGPTRTLTLPHAQPEDAGEYVC---ETRHEAITFNVIL 1166
            ++ WYKDG  ++  +  Q+   +    +L +P   PED G Y       +  AI    + 
Sbjct: 1321 KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY 1380

Query: 1167 AEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGP 1226
             EP     A      P  +   EPV      SR  +    S +  P++           P
Sbjct: 1381 VEPAAPLGA------PTYIPTLEPV------SRIRSLSPRSVSRSPIRMSPA----RMSP 1424

Query: 1227 RRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGD 1286
             R+       PA         G        S   ++ +P V V+ P + +     T   D
Sbjct: 1425 ARM------SPARMSPARMSPGRRLEETDESQLERLYKP-VFVLKPVSFKCLEGQTARFD 1477

Query: 1287 LELVVHLSGPGGPVRWYKDGERLASQ--GRVQLEQAGARQVLRVQGARSGDAGEYLCDAP 1344
            L++V     P     W+ DG+++ +    +V +++ G + ++ V    S D+GE+   A 
Sbjct: 1478 LKVV---GRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPS-DSGEWTVVAQ 1533

Query: 1345 QDSRIFLVSV-------EEPLLVKLVSELTPLTVHEGDDATFRCEVSP-PDADVTWLRNG 1396
              +    +SV       E  +    V +L  + + EG     +   +  P+ D+ WL+N 
Sbjct: 1534 NRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNS 1593

Query: 1397 AVVTPG--PQVEMAQNGSSRILTLRGCQLGDA----GTVTLRAGSTATSARLHVR----- 1445
             ++ P   P++ +        L +      D+     T   +AG   T  +++V      
Sbjct: 1594 DIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAE 1653

Query: 1446 ---ETELLFLR---RLQDVRAEE--------GQDVCLE--------------------VE 1471
               E +L+  R   R +++ A E        GQ+   E                    + 
Sbjct: 1654 PEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLR 1713

Query: 1472 TGRVGAAG-------------AVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQG 1518
              R G A               V W+  G+PL   +RL M  +     L        D G
Sbjct: 1714 LKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSG 1773

Query: 1519 TYGCESHH----DRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLE----LSQEG-VT 1569
               C + +    D T A L V+  +  V    E+  + EG     ++E    ++ EG +T
Sbjct: 1774 IITCRATNKYGTDHTSATLIVKDEKSLV----EESQLPEGRKGLQRIEELERMAHEGALT 1829

Query: 1570 G------EWARGGVQLYPGPKCHIHSDGHRHRLVLNG 1600
            G      E  +  + LYP P   +  +  R R  + G
Sbjct: 1830 GVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTG 1866



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 79/341 (23%), Positives = 128/341 (37%), Gaps = 51/341 (14%)

Query: 105   PASDPELQPAERPLPSPG----------SGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGL 154
             P+SDP    A RP+  PG          S E A +  T P S         V+ C+  G 
Sbjct: 17790 PSSDPI--KACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPG- 17846

Query: 155   PEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNA 214
                T  W +  +  DE+     F + PG  E   G     RI AA +   G         
Sbjct: 17847 ---TAQWNR--INKDELIRQCAFRV-PGLIE---GNEYRFRIKAANIVGEG-------EP 17890

Query: 215   HGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPE 274
                A++     +  PPE             VE          V  G+  +    V G+PE
Sbjct: 17891 RELAESVIAKDILHPPE-------------VELDVTCRDVITVRVGQTIRILARVKGRPE 17937

Query: 275   PEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             P+I W  EG+ L+ ++R  + +D      L++      D G Y+ +A+NS+G    +  +
Sbjct: 17938 PDITWTKEGKVLVREKRVDLIQDLP-RVELQIKEAVRADHGKYIISAKNSSGHAQGSAIV 17996

Query: 335   HVKEPRLRFTRPLQDVE----GREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIE 390
             +V    L    P Q+++     +E+     E  + N       F  + R    + +  + 
Sbjct: 17997 NV----LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVA 18052

Query: 391   EGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPIL 431
                 +RLI   L A+++  +      +V     +  K PIL
Sbjct: 18053 SDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPIL 18093



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 25/100 (25%), Positives = 41/100 (41%), Gaps = 1/100 (1%)

Query: 239   EAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDR 298
             EA   ++ P    P+   +  GK  +   +V GKP P  +W  +G   +     L     
Sbjct: 18892 EAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWK-KGEDEVVTSSHLAVHKA 18950

Query: 299   DGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKE 338
             D   +L +     KD G Y   A NS+G     +++ V +
Sbjct: 18951 DSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 18990



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 458   EGRWSRD-GEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHS 516
             E +W+RD GE L      S+     L++  V R D+G+   ++ NS  +    V      
Sbjct: 21891 EVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLD 21950

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPP 541
              PGPP   ++ +  K +V LTW PP
Sbjct: 21951 TPGPPQDLKVKEVTKTSVTLTWDPP 21975



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 34/119 (28%), Positives = 47/119 (39%), Gaps = 11/119 (9%)

Query: 231   ESPPADPDEAPAPVVEP-------LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEG 283
             E   +DP     PV+         LK    T+ +  G+  K    V+G+P P I W  +G
Sbjct: 24290 EKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDG 24349

Query: 284   RPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAG---QTLSAVQLHVKEP 339
              P L    R+   +     VL +      D G Y   A NSAG   + LS + L    P
Sbjct: 24350 EP-LKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGP 24407



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 23/91 (25%), Positives = 42/91 (46%)

Query: 15    LRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
             L +   V+  +G   +L+  + G+P P + W K  ++L  +  +          +L+  A
Sbjct: 26876 LEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDA 26935

Query: 75    LPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
                ++G Y  + RNA G A A   V +L+ P
Sbjct: 26936 DRLNSGCYELKLRNAMGSASATIRVQILDKP 26966



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 21/182 (11%)

Query: 1178 TTPSPLCVAPGEPVVL------SCELSRAGAPVV---WSHNGRPVQEGE--GLELHAEGP 1226
            TT +P    P + VV+      + E   +G PV    W  +G+ +      G+++     
Sbjct: 2    TTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDG 61

Query: 1227 RRVLCIQAAGPAHAGLYTCQ----SGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRST 1282
            R  L I A   A++G Y+ +    SG A     L    + A PP  V   ++   R    
Sbjct: 62   RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA-PPNFVQRLQSMTVR---- 116

Query: 1283 PGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
             G  + L V ++G P   V++Y+DG  + S    Q+ Q G    L +  A   D+G Y  
Sbjct: 117  QGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSV 176

Query: 1342 DA 1343
            +A
Sbjct: 177  NA 178



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQL-AASERLSFPADGAEHGLLLTAALPTDAGV 81
             V +G    L+  + G+P P VVW K G++L   + R+   +   +  L++   + TD G 
Sbjct: 24719 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 24778

Query: 82    YVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
             Y+ +  N  G       V VL+ P       P E PL   G
Sbjct: 24779 YILKLSNVGGTKSIPITVKVLDRPG------PPEGPLKVTG 24813



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 68/300 (22%), Positives = 118/300 (39%), Gaps = 39/300 (13%)

Query: 516   SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC-FSIEKAG 573
             SP  PP   +     + T+ L W PP     +  + Y +E+++ G+E W++C F+     
Sbjct: 27853 SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVRCNFTDVSEC 27911

Query: 574   AVEVPGDCVPSEGD-YRFRIC------TVSGHGRSPHVVFHGSAHLVPTARLVAGLED-V 625
                V G    S GD Y FRI       T+S   +S  ++     ++ P         D +
Sbjct: 27912 QYTVTG---LSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGL 27968

Query: 626   QVYDGEDAVFSLDLSTIIQG------TWFLNGEEL-KSNEPEGQVEPGALRYRIEQKGLQ 678
              +  GE    SL +  ++QG      TWF +G E+ K    E     G+    +      
Sbjct: 27969 IIKSGE----SLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRD 28024

Query: 679   HRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTC 738
             HR +        SG+         +    + +Q++P  ++ P   +  T  T E++ L  
Sbjct: 28025 HRGVYTVEAKNASGS--------AKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWW 28073

Query: 739   ELSRVD--FPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF 796
             +    D   P T Y   +K E S L    ++ +         K+ +  E++ R   V+ F
Sbjct: 28074 DAPLNDGCAPITHYII-EKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKF 28132



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 54/252 (21%), Positives = 102/252 (40%), Gaps = 38/252 (15%)

Query: 373   WFREDQRLLPCRKY--EQIEEGTVRRLIIHRLKADDDG-------IYLCEMRGRVRTVAN 423
             W R  ++++  R+Y  ++I EG   +L +  + A  +G       + + E +       +
Sbjct: 15048 WSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPVTVAEPQEPPAVELD 15107

Query: 424   VTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGR------WSRDGEELPV--ICQSS 475
             V+VKG I         ++ G+        + A V GR      W+++  EL    +   +
Sbjct: 15108 VSVKGGI--------QIMAGKTL-----RIPAVVTGRPVPTKVWTKEEGELDKDRVVIDN 15154

Query: 476   SGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVL 535
              G    L++    R+D G    +  NS  +     +      PGP +  +    ++   L
Sbjct: 15155 VGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL 15214

Query: 536   LTWKPPEP---APETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRI 592
             L W  PE    +  T FI  +ER++     W Q    E++   ++ G  +    +Y+FR+
Sbjct: 15215 LNWSDPEDDGGSEITGFI--IERKDAKMHTWRQPIETERS-KCDITG--LLEGQEYKFRV 15269

Query: 593   CTVSGHGRSPHV 604
                +  G  P V
Sbjct: 15270 IAKNKFGCGPPV 15281



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 34/112 (30%), Positives = 46/112 (41%), Gaps = 11/112 (9%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +G    L   V G+P P V W+K G  L  +E +          L L +    D+G Y
Sbjct: 19307 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 19366

Query: 83    VCRARNAAGEAYAAAAVTVLE---PPA--------SDPELQPAERPLPSPGS 123
                A N++G   A   + VL+   PPA        SD  +   E PL   GS
Sbjct: 19367 TITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGS 19418



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PPGPP   +++   +++V L+W  P     +P I Y +E +   S++W++C   +     
Sbjct: 19588 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 19647

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS 601
                   +  +  Y+FR+  V+  G S
Sbjct: 19648 RFEVTGLMEDTQYQFRVYAVNKIGYS 19673



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 108/551 (19%), Positives = 196/551 (35%), Gaps = 81/551 (14%)

Query: 418   VRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQ--- 473
             V  +A   V  P  K L     VL GE+  + V  +        W +D   L    +   
Sbjct: 22137 VPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNA 22196

Query: 474   SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPI-LAEMFKGHKN 532
              S+ +   L +    RED G     L NS    +  +  +    PGPP    +M +   +
Sbjct: 22197 ESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTAD 22256

Query: 533   TVLLTWKPPE-PAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFR 591
             ++ L+W PP+     +   Y +E+++  +  W Q  S   A    +    + +  +Y+FR
Sbjct: 22257 SITLSWGPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVA-RTTIKACRLKTGCEYQFR 22314

Query: 592   ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
             I   + +G+S ++    +    P               G      + LS+        + 
Sbjct: 22315 IAAENRYGKSTYLNSEPTVAQYPFK-----------VPGPPGTPVVTLSS-------RDS 22356

Query: 652   EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQ 711
              E++ NEP        + Y +E+K  +   IL    ++       F   G+++      +
Sbjct: 22357 MEVQWNEPISDGGSRVIGYHLERK--ERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFR 22414

Query: 712   ESPVHI--LSPQDRVSLTFTT---------SERVVLTCELSRVDFPATWYKDGQK----- 755
              S  +I  +    +VS  +            E +++T     + +    Y  G K     
Sbjct: 22415 VSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYI 22474

Query: 756   VEESELLVVKMDGR---------------------KHRLILPEAKVQDSGEFECRTEGVS 794
             VE+ EL     +GR                      HR          +G F   +E   
Sbjct: 22475 VEKKEL----PEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTG 22530

Query: 795   AFFGVTVQDPPVHIVDP--REHVFVHAITSECVMLACEVDREDAP-VRWYKDGQEVEESD 851
             A       DPP   +DP  ++ + VHA   E   +  ++  +  P ++W K  QE+  + 
Sbjct: 22531 AITARDEVDPPRISMDPKYKDTIVVHA--GESFKVDADIYGKPIPTIQWIKGDQELSNTA 22588

Query: 852   FVVLENEGPHRRLVLPATQPSDGGEF----QCVAGDECAYFTVTITDVSSWIVYPSGKVY 907
              + +++      L +      D G +    + VAG+      V + D       P G V 
Sbjct: 22589 RLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPG---PPEGPVV 22645

Query: 908   VAAVRLERVVL 918
             ++ V  E+  L
Sbjct: 22646 ISGVTAEKCTL 22656



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 94/441 (21%), Positives = 167/441 (37%), Gaps = 67/441 (15%)

Query: 461   WSRDGEELP--VICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPP 518
             WS+ G +L    I  ++  +   L++  V R DAG+ T    N        V    +  P
Sbjct: 29480 WSKQGIDLASRAIIDTTESYS-LLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTP 29538

Query: 519   GPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEV 577
             GP    ++ +  +++V +TW+ P      P   Y +E++E     +    +        +
Sbjct: 29539 GPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRI 29598

Query: 578   PGDCVPSEGD-YRFRICTVSGHG-----RSPHVVFHGSAHLVP--------TARLVAGLE 623
              G     EG  Y FR+   + +G      +   V      LVP        T   V    
Sbjct: 29599 SGLV---EGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAW 29655

Query: 624   DVQVYDGEDAVFSLDLSTIIQGT--WFLNGEELKSNEPEGQVEPGALRYRIEQ--KGLQH 679
             +  +YDG   +    L     GT  W               ++P  L + +    +G Q+
Sbjct: 29656 EKPLYDGGSRLTGYVLEACKAGTERWM----------KVVTLKPTVLEHTVTSLNEGEQY 29705

Query: 680   RLILHAVKHQDSGALVGFSCPGVQDSAALTIQES---PVHILSPQDRVSLTFTTSERVVL 736
                + A   +      G S P  +   A+T+Q+    P   LS   + ++       V L
Sbjct: 29706 LFRIRAQNEK------GVSEPR-ETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVEL 29758

Query: 737   TCELSRVDFPA-TWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSA 795
                ++    PA +W+  G K+ ESE + V+   +  +L + E  ++D+GE+    + V+ 
Sbjct: 29759 VIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVT- 29817

Query: 796   FFGVTVQDPPVHIVD----PREHVFVHAITSECVMLACEVDRED--APVRWYKDGQEVEE 849
               G T +   V I+D    P   + +  I +  + ++ E    D  AP+  Y        
Sbjct: 29818 --GTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGY-------- 29867

Query: 850   SDFVVLENEGPHRRLVLPATQ 870
                 V+E    HR   LP ++
Sbjct: 29868 ----VVEQRDAHRPGWLPVSE 29884



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 54/219 (24%), Positives = 82/219 (37%), Gaps = 32/219 (14%)

Query: 127   APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
             AP F    R+  V   +   L C+  G P+P + W + G  +  + D   +     R ++
Sbjct: 30927 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI--IADGLKY-----RIQE 30979

Query: 187   GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
               G    L I +    D+ VY   A N  G     A L+V            E PA +  
Sbjct: 30980 FKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEV------------EVPAKI-- 31025

Query: 247   PLKCAPKTFWVNEGKHA------KFRCYVMGKPEPEIEWHWEGRPLLPDRRRL-MYRDRD 299
                  PKT       HA        +    GKP+P I W  +G+ L+ +     +   R 
Sbjct: 31026 ---HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQ-KGQDLIDNNGHYQVIVTRS 31081

Query: 300   GGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKE 338
                ++     + KD G YV  A+N  G     V+L V +
Sbjct: 31082 FTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVAD 31120



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 58/260 (22%), Positives = 101/260 (38%), Gaps = 55/260 (21%)

Query: 259   EGKHAKFRCYVMGKPEP-EIEWHWEGRPLL-PDRRRLMYRDRDGGFVLKVLYCQAKDRGL 316
             EG H K+ C +    +  ++ W++  R L   ++  + Y D  G  +L V      D G 
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYED--GVAILYVKDITKLDDGT 31638

Query: 317   YVCAARNSAGQTLSAVQLHVKEPRLRF----TRPLQDVEGREHGIAVLECKVPNSRIP-- 370
             Y C   N  G+  S  +L VK  R  +     R ++ ++ R   + +LE + P   +P  
Sbjct: 31639 YRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLE-RPPEFTLPLY 31697

Query: 371   -----------------------TAWFREDQRLLP---CRKYEQIEEGTVRRLIIHRLKA 404
                                      W++  Q++ P    +KY    +  + +L I+ +  
Sbjct: 31698 NKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTT 31757

Query: 405   DDDGIYLCEMR---GRVRTVANVTVK----------GPILKRLPRKLDVLEGENAVLLVE 451
             DDD  Y    R   G     A +TV            P+ KRL    +  EG++  +  E
Sbjct: 31758 DDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQS--VCFE 31815

Query: 452   TLEAGVEG---RWSRDGEEL 468
                +G+     +W +DG+ L
Sbjct: 31816 IRVSGIPPPTLKWEKDGQPL 31835



 Score = 40.8 bits (94), Expect = 0.013
 Identities = 45/169 (26%), Positives = 63/169 (37%), Gaps = 38/169 (22%)

Query: 85    RARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAE 144
             RA NAAG         + EP  + P  +  + P+ +P       V L    S  V RG E
Sbjct: 14655 RAENAAG---------ISEPSRATPPTKAVD-PIDAP------KVILR--TSLEVKRGDE 14696

Query: 145   VVLTCRAGGLPEPTLYWEKDGMAL-----------------DEVWDSSHFAL---QPGRA 184
             + L     G P PT+ W KD   +                  EV +   F L   Q    
Sbjct: 14697 IALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSI 14756

Query: 185   EDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESP 233
             ++       LR+  +  PD G+Y+    N HG A+A   + V   P  P
Sbjct: 14757 DNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPP 14805



 Score = 40.8 bits (94), Expect = 0.013
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 6/145 (4%)

Query: 914   ERVVLTCELC-RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLC-- 970
             E   L+C++  RP  +++W + G+E+++S    +  +     L +   + ED G Y C  
Sbjct: 30548 EAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 30607

Query: 971   --EIDD-ESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGL 1027
               E+ + E++S  +    P     YP  E    AV     + +  + R    + W+    
Sbjct: 30608 TNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK 30667

Query: 1028  EVEESEALVLERDGPRCRLVLPAAQ 1052
              ++ SE + +E       LV+   Q
Sbjct: 30668 LLQNSENITIENTEHYTHLVMKNVQ 30692



 Score = 40.4 bits (93), Expect = 0.017
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 14/168 (8%)

Query: 1544 RPLEDVTISEGGSATFQLELSQEGVTG-EWARGG----VQLYPGPKCHIHSDGHRHRLVL 1598
            +PL+ V + EG +ATF+  +S   V    W R G        PG +    SDG R +L +
Sbjct: 10   QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISF-SDG-RAKLTI 67

Query: 1599 NGLGLADSGCVSFTADS----LRCAARLIVR--EVPVTIVRGPHDLEVTEGDTATFECEL 1652
              +  A+SG  S  A +        A L+V+    P   V+    + V +G     +  +
Sbjct: 68   PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRV 127

Query: 1653 SQALADVT-WEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYS 1699
            +     V  + +DG  +  S   ++   G    L +    P D+GTYS
Sbjct: 128  TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175



 Score = 40.4 bits (93), Expect = 0.017
 Identities = 61/249 (24%), Positives = 93/249 (37%), Gaps = 58/249 (23%)

Query: 1614 DSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELS-QALADVTWEKDGNALTPSP 1672
            ++ R  A + +   P T+V G  ++ V EG++ T EC +S      VTW ++   +  S 
Sbjct: 928  ETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSI 987

Query: 1673 RLRLQALGTRRLLQLRRCGPSDAGTYSCA----VGTAR-----AGPVRLTVRERTVAV-- 1721
              ++        L +R     D+G ++C+     GT       A  V     + T AV  
Sbjct: 988  DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTE 1047

Query: 1722 ---LSELRSVSAR----------------------------------EGDGATFECTV-S 1743
                 E R V +R                                  EG    F C V  
Sbjct: 1048 KFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGG 1107

Query: 1744 EVETTGRWELGGRPLRPGARVRI---RQEGKKHILVLSELRAEDAGE----VRFQAGPAQ 1796
              +    W+  G PL  G R ++   +Q G+   LV+S   A+DAGE    VR + G   
Sbjct: 1108 NPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK-LVISMTFADDAGEYTIVVRNKHGETS 1166

Query: 1797 SLALLEVEA 1805
            + A L  EA
Sbjct: 1167 ASASLLEEA 1175



 Score = 40.4 bits (93), Expect = 0.017
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 7/144 (4%)

Query: 232   SPPADPDEAPAPVVEP-LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDR 290
             S P  P ++  P+  P  K   +   V    +A   C V G P+P ++W+ +G+ ++ D 
Sbjct: 30914 SEPITP-KSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADG 30972

Query: 291   RRLMYRDRDGGF-VLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEP-RLRFTRPLQ 348
              +   ++  GG+  L +      D  +Y   A N  G       L V+ P ++   + L+
Sbjct: 30973 LKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLE 31032

Query: 349   DVEGREHGI--AVLECKVPNSRIP 370
              + G  H +   V+  K+P S  P
Sbjct: 31033 GM-GAVHALRGEVVSIKIPFSGKP 31055



 Score = 40.0 bits (92), Expect = 0.022
 Identities = 25/97 (25%), Positives = 40/97 (41%), Gaps = 2/97 (2%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             R   +  G    L  ++ G P P V W+K  +      R+     G++  L +  A   D
Sbjct: 17226 REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK--LEIRNAAHED 17283

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
              G+Y     N AG    +  V VL+ P    +L+ +E
Sbjct: 17284 GGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSE 17320



 Score = 40.0 bits (92), Expect = 0.022
 Identities = 75/311 (24%), Positives = 119/311 (38%), Gaps = 33/311 (10%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             PGPP + E+ K  KN++ + W  P     +    Y LE+++  S  W +    E      
Sbjct: 27066 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLK-ETIRDTR 27124

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSPH---VVFHGSAHLV----PTARL---------VA 620
                  +    DY++R+C V+  G+ P      F+ +A  +    P A++         + 
Sbjct: 27125 QKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSIT 27184

Query: 621   GLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHR 680
                   VYDG  AV    +  I QG      EE  +   +G+V          + G+ + 
Sbjct: 27185 LGWSKPVYDGGSAVTGY-VVEIRQG----EEEEWTTVSTKGEVRTTEYVVSNLKPGVNYY 27239

Query: 681   LILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERV-VLTCE 739
               + AV     G  +  + P VQ   A  I E+P   L    R S+     E V VL   
Sbjct: 27240 FRVSAVNCAGQGEPIEMNEP-VQ---AKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPF 27295

Query: 740   LSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE-GV----S 794
               R     TW KD + +       ++       L +P+    D+G++    E GV    S
Sbjct: 27296 KGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKS 27355

Query: 795   AFFGVTVQDPP 805
             +   V V D P
Sbjct: 27356 STVSVKVLDTP 27366



 Score = 39.7 bits (91), Expect = 0.028
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 5/103 (4%)

Query: 492   AGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI- 550
             A E  + +G     + +  K  +  PPGPP   E     K+ V LTW  P+    +P   
Sbjct: 13858 AAENMYGVGEPVQASPITAK-YQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITG 13916

Query: 551   YRLERQEVGSEDWIQCFSIE-KAGAVEVPGDCVPSEGDYRFRI 592
             Y +ER +  ++ W++C  +  K     V G  + ++  YRFR+
Sbjct: 13917 YWVERLDPDTDKWVRCNKMPVKDTTYRVKG--LTNKKKYRFRV 13957



 Score = 39.7 bits (91), Expect = 0.028
 Identities = 34/164 (20%), Positives = 71/164 (43%), Gaps = 17/164 (10%)

Query: 823   ECVMLACEVDREDAP-VRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVA 881
             E   L+C++     P ++WY+ G+E+ +S    + ++G    L +   +  D G + C+A
Sbjct: 30548 EAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 30607

Query: 882   GDECAYFTVTITDVSSWIV----------YPSGKVYVAAVRLERVVLTCELCRPWAEVRW 931
              +E     V   + SS ++          YP  + Y  AV     +    + RP   + W
Sbjct: 30608 TNE-----VGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTW 30662

Query: 932   TKDGEEVVESPALLLQKEDTVRRLVLPAVQLE-DSGEYLCEIDD 974
                 + +  S  + ++  +    LV+  VQ +  +G+Y  ++ +
Sbjct: 30663 FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSN 30706



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 516   SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGA 574
             SPPGPPI   +      T+ L W+PP        + Y +++Q VG+ +W +C   EK   
Sbjct: 15001 SPPGPPI-PRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRC--TEKMIK 15057

Query: 575   VEVPGDCVPSEG-DYRFRICTVSGHGRSP 602
             V         EG DY+ R+  V+  G  P
Sbjct: 15058 VRQYTVKEIREGADYKLRVSAVNAAGEGP 15086



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 32/91 (35%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPE---PAPETPFIYR-LERQEVGS--EDWIQCFSIE 570
             PP PPI  ++    KNTV L+WKPP+    +P T +I   L     G+  E W QC   +
Sbjct: 16011 PPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD 16070

Query: 571   KAGAVEVPGDCVPSEGDYRFRICTVSGHGRS 601
                      D V   G+Y FR+  V+  G S
Sbjct: 16071 VEELQFTVEDLVEG-GEYEFRVKAVNAAGVS 16100



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 43/144 (29%), Positives = 52/144 (36%), Gaps = 17/144 (11%)

Query: 93    AYAAAAVTVLEPPA-SDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRA 151
             A A  AV +  P   SDP    AE   P           LT      V  G  V L    
Sbjct: 19266 AIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLT------VKAGTNVCLDATV 19319

Query: 152   GGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHA 211
              G P PT+ W+KDG  L    +    A+Q             L + +    DSG Y   A
Sbjct: 19320 FGKPMPTVSWKKDGTLLKPA-EGIKMAMQRNLC--------TLELFSVNRKDSGDYTITA 19370

Query: 212   RNAHGHAQAGALLQVHQPPESPPA 235
              N+ G   A   L+V   P  PPA
Sbjct: 19371 ENSSGSKSATIKLKVLDKP-GPPA 19393



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 235   ADPDEAPAPVVEPLKCAP-------KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLL 287
             +DP +   PV+      P        TF V  G+  K     +G+P P + WH +  P L
Sbjct: 22130 SDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVP-L 22188

Query: 288   PDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
                 R+     +   +L +     +D G YV    NSAG+ +  + + V
Sbjct: 22189 KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIV 22237



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 3/100 (3%)

Query: 15    LRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
             ++F   + V +G   ++   + G P PV+ W K G ++    R    +      L +   
Sbjct: 25793 VKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDC 25852

Query: 75    LPTDAGVYVCRARNAAGEAYAAAAVTVLE---PPASDPEL 111
             +  D G YV   +N AG    A    VL+   PPA   E+
Sbjct: 25853 IRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEI 25892



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 5/84 (5%)

Query: 42   VVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRAR-NAAGEAYAAAAVT 100
            +V W KG  +L  S++ +F  DG  H + +    P D GVY   AR    GEA + A + 
Sbjct: 8863 IVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELY 8922

Query: 101  V----LEPPASDPELQPAERPLPS 120
            +    ++     P++  +  P+P+
Sbjct: 8923 LTTKEIKLELKPPDIPDSRVPIPT 8946



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 25/112 (22%), Positives = 48/112 (42%), Gaps = 11/112 (9%)

Query: 460   RWSRDGEELPV---ICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHS 516
             +W+ DG E+         +      L +    R D GE   ++ N+  +  + V      
Sbjct: 17543 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 17602

Query: 517   PPGPPI----LAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW 563
              PGPP     + ++   H   + ++W+PP+    +P I Y +E+Q+   + W
Sbjct: 17603 VPGPPTGPINILDVTPEH---MTISWQPPKDDGGSPVINYIVEKQDTRKDTW 17651



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 3/122 (2%)

Query: 479   MHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTW 538
             M  LV+P  TR+D+G+ + +L N      + V       PGP    ++    K +  ++W
Sbjct: 18660 MAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSW 18719

Query: 539   KPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSG 597
              PPE    +    Y +E++E   + W       K  +  V  + VP   +Y FR+  V+ 
Sbjct: 18720 APPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVT-NLVPG-NEYYFRVTAVNE 18777

Query: 598   HG 599
             +G
Sbjct: 18778 YG 18779



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 108/521 (20%), Positives = 190/521 (36%), Gaps = 75/521 (14%)

Query: 475   SSGHMHALVLPGVTREDAGEVTFSL----GNSRTTTLLRVKCVKHSPPGPPILAEMFKGH 530
             SS     L++    + DAG+ T +L    G    T  ++V      P GP    E+    
Sbjct: 20033 SSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTA-- 20090

Query: 531   KNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEG-DY 588
                + L W PP+    +    Y LE+++  +  W+ C S  +     V       EG +Y
Sbjct: 20091 -EAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR---LHEGMEY 20146

Query: 589   RFRICTVS----GHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQ 644
              FR+   +    G G     +       VP A     + DV+ +D     ++    T   
Sbjct: 20147 TFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVR-HDSVSLTWTDPKKT--- 20202

Query: 645   GTWFLNGEELKSNEPEGQVEPGALRYRIEQK---------GLQHRLILHAVKHQDSGALV 695
             G   + G  L+  E    +   A +  I  +         GL++   + A+       L 
Sbjct: 20203 GGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAIN------LA 20256

Query: 696   GFSCPGVQDSAALTIQE-----SPVHILSPQDRVSLTFTTSE----RVVLTCELSRVDFP 746
             G   P +     + +        P  I   ++ V+L +T  +      +    + + D P
Sbjct: 20257 GVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLP 20316

Query: 747   A-TWYKDGQ-KVEESELLVVKM-DGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQD 803
             + +W K     V E    V  + +G K+   +  AK   +G     +E           +
Sbjct: 20317 SKSWMKANHVNVPECAFTVTDLVEGGKYEFRI-RAK-NTAGAISAPSESTETIICKDEYE 20374

Query: 804   PPVHIVDPREHVFVHAITSECVML-ACEVDREDAPVR-WYKDGQEVEESDFVVLENEGPH 861
              P  ++DP     +     + ++L A  +  +  P   W K G+++  SD   + +    
Sbjct: 20375 APTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTS 20434

Query: 862   RRLVLPATQPSDGGEFQCVA----GDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVV 917
               L +      D GE+   A    G +  +  VT+ DV      P G V ++ V  E+  
Sbjct: 20435 SMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPG----PPGPVEISNVSAEKAT 20490

Query: 918   LTCELCRPWAEVRWT---KDGEEVVESPALLLQKEDTVRRL 955
             LT           WT   +DG   ++S   +L+K +T R L
Sbjct: 20491 LT-----------WTPPLEDGGSPIKS--YILEKRETSRLL 20518



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 43/170 (25%), Positives = 66/170 (38%), Gaps = 14/170 (8%)

Query: 253   KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLP--DRRRLMYRDRDGGFVLKVLYCQ 310
             KT +V  G++ +F   +   PEP + W+  G+ + P  + ++  +    G + L +    
Sbjct: 31699 KTAYV--GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVT 31756

Query: 311   AKDRGLYVCAARNSAGQTLSAVQLHV--------KEPRLRFTRPLQDVEGREHGIAVLEC 362
               D   Y   ARN  G+     +L V           R  F R L + E +E      E 
Sbjct: 31757 TDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEI 31816

Query: 363   KVPNSRIPT-AWFREDQRLLPCRKYEQIEEG-TVRRLIIHRLKADDDGIY 410
             +V     PT  W ++ Q L      E I EG     L I     +D G Y
Sbjct: 31817 RVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 31866



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 34/128 (26%), Positives = 51/128 (39%), Gaps = 12/128 (9%)

Query: 119   PSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAG----------GLPEPTLYWEKDGMAL 168
             PS  +GE     +      ++  GA+  L C+AG          G P P   WE DG A 
Sbjct: 15792 PSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAK 15851

Query: 169   DEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQ 228
               + D  H   +  + E    +S+ + I   +   +G Y   A+N  G   A   ++V  
Sbjct: 15852 KAMKDGVHDIPEDAQLETAENSSVII-IPECKRSHTGKYSITAKNKAGQKTANCRVKVMD 15910

Query: 229   PPESPPAD 236
              P  PP D
Sbjct: 15911 VP-GPPKD 15917



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 38/131 (29%), Positives = 51/131 (38%), Gaps = 27/131 (20%)

Query: 124   GEGAPVFLTGP----------------RSQWVLR-GAEVVLTCRAGGLPEPTLYWEKDGM 166
             G+G P F T P                R +  +R G    LT R  G P+P + W KD  
Sbjct: 16798 GQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEA 16857

Query: 167   ALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQV 226
              + E  D +H    P        A+LAL  + A+  DSG Y     N+ G  +    + V
Sbjct: 16858 DVLED-DRTHIKTTP--------ATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 16908

Query: 227   HQPPESPPADP 237
                P  PP  P
Sbjct: 16909 VDRP-GPPVGP 16918



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC-FSIEKAGAV 575
             P PP+  E      N+V LTW+PP     +  + Y +E Q+VG E+W +   + E     
Sbjct: 17113 PSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPET 17172

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS 601
             +     +     Y+FR+  V+  G S
Sbjct: 17173 KYKVTGLRDGQTYKFRVLAVNAAGES 17198



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 43/154 (27%), Positives = 67/154 (43%), Gaps = 19/154 (12%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PPGPP         K  V L W  P+    +P   Y +E QE G++DWI+  ++     V
Sbjct: 17409 PPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECV 17468

Query: 576   EVPGDCVPSEGDYRFRIC--TVSGHGRSPHVV-FHGSAHLVPTARLVAGLEDVQVYDG-- 630
              V G  +     YRFR+    + G G     +       LVP +  +    DV++ +G  
Sbjct: 17469 -VTG--LQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVEL----DVKLIEGLV 17521

Query: 631   EDAVFSLDLSTIIQGT------WFLNGEELKSNE 658
               A  ++    II+G       W  +G E+K++E
Sbjct: 17522 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDE 17555



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILA-EMFKGHKNTVLLTWK- 539
             L++  VTR+D+G  + +  NS  T   ++K V    PGPP    ++     +   L+W  
Sbjct: 18956 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHI 19015

Query: 540   PPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRI 592
             P E        Y +E+ +V   DW+   +     +  V G  +P + +Y FR+
Sbjct: 19016 PLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRV-GKLIPGQ-EYIFRV 19066



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 42/163 (25%), Positives = 63/163 (38%), Gaps = 22/163 (13%)

Query: 453   LEAGVEGR------WSRDGEELPVICQ----SSSGHMHALVLPGVTREDAGEVTFSLGNS 502
             LEA + G+      WS+DG+EL          S+     LV+    R D G+    L N 
Sbjct: 24727 LEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNV 24786

Query: 503   RTTTLLRVKCVKHSPPGPPILAEMFKG-HKNTVLLTWKPP-EPAPETPFIYRLERQEVGS 560
               T  + +       PGPP       G       L W PP +        Y +E++E   
Sbjct: 24787 GGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSR 24846

Query: 561   EDWIQCFSIEKAGAVEV----PGDCVPSEGDYRFRICTVSGHG 599
               W Q  +  +A   +V    PG+      +Y FR+  V+ +G
Sbjct: 24847 LSWTQVSTEVQALNYKVTKLLPGN------EYIFRVMAVNKYG 24883



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 39/171 (22%), Positives = 71/171 (41%), Gaps = 12/171 (7%)

Query: 1005  ECVVLMCELSREDAP-VRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC-- 1061
             E   L C++     P ++WY+ G E+ +S    +  DG    L +   + ED G + C  
Sbjct: 30548 EAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 30607

Query: 1062  --DAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQV---RWYK 1116
               + G+      + + A P+   HP     + ++GA G   LR  V   G  V    W+ 
Sbjct: 30608 TNEVGEVETSSKLLLQATPQ--FHPGYPLKEKYYGAVGST-LRLHVMYIGRPVPAMTWFH 30664

Query: 1117  DGLEVEASDALQLGAEGPTRTLTLPHAQPE-DAGEYVCETRHEAITFNVIL 1166
                 ++ S+ + +        L + + Q +  AG+Y  +  +   T + IL
Sbjct: 30665 GQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAIL 30715



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 29/112 (25%), Positives = 45/112 (40%), Gaps = 6/112 (5%)

Query: 231  ESPPADPDEAPAPVVEP-----LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRP 285
            E+   +    PAPV  P     L    K   V EG+     C++ G P P + W+ E   
Sbjct: 923  EAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 982

Query: 286  LLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK 337
             +          + G   L +    A+D G + C+A N AG   ++  L V+
Sbjct: 983  -IESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ 1033



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKG-HKNTVLLTWKP 540
             LV+P   R D G  T +  N+  T    ++      PGPP+    F+    + + L+W P
Sbjct: 16181 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFP 16240

Query: 541   PEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
             P+    +    Y +E++E   + W+   S  K     +P   +    +Y FRI   + +G
Sbjct: 16241 PKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPK--LLEGHEYVFRIMAQNKYG 16298



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 512   CVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW--IQCFS 568
             C    PPGPPI  ++    + T  L W  P     +P + Y +E Q+ G+  W  I    
Sbjct: 17798 CRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDE 17857

Query: 569   IEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
             + +  A  VPG    +E  +R +   + G G
Sbjct: 17858 LIRQCAFRVPGLIEGNEYRFRIKAANIVGEG 17888



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 71/336 (21%), Positives = 122/336 (36%), Gaps = 30/336 (8%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             P  P  A + K +K+ + + W  P+    +P I Y +ER+E  S  W++  +     + E
Sbjct: 19092 PSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKA-NDTLVRSTE 19150

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSP------------HVVFHGSAHLVPTARLVAGLED 624
              P   +    +Y FRI  ++  G SP             V   G   ++   +    L  
Sbjct: 19151 YPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIW 19210

Query: 625   VQ-VYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLI 682
              +  +DG   +    +    + G  ++         P+ +     L    E+   Q R I
Sbjct: 19211 ARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLE---EKAQYQFRAI 19267

Query: 683   LHAVKHQDSGALVGFSCPG-VQDSAALTIQESPVHI-LSPQDRVSLTFTTSERVVLTCEL 740
                         V  S P    D   +  +  P  I LS   +  LT      V L   +
Sbjct: 19268 ARTA--------VNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATV 19319

Query: 741   SRVDFP-ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGV 799
                  P  +W KDG  ++ +E + + M      L L     +DSG++    E  S     
Sbjct: 19320 FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 19379

Query: 800   TVQDPPVHIVDPREHVFVHAITSECVMLACEVDRED 835
             T++   +    P   V ++ + S+  ML+ E   ED
Sbjct: 19380 TIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLED 19415



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 22/71 (30%), Positives = 30/71 (42%)

Query: 35    VLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAY 94
             +LG+P P   W K G+ +  S+     +      L +  A   DAG Y   A N  G   
Sbjct: 20403 ILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKV 20462

Query: 95    AAAAVTVLEPP 105
                 VTVL+ P
Sbjct: 20463 EHVKVTVLDVP 20473



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 481   ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP 540
             +L +    R D+G+ T ++ N  +   L +       PGPP    +    K + +L+W  
Sbjct: 26241 SLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV 26300

Query: 541   PEPAPETPF-IYRLERQEVGSEDWI 564
             PE     P   Y +E++E   + W+
Sbjct: 26301 PENDGGAPVKNYHIEKREASKKAWV 26325



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 7/114 (6%)

Query: 238   DEAPAPVVEPLKCAPKTF---WVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLM 294
             DE   P+VE     P+ F    +  G+  + +  V G+P P + W  +G   +  R  + 
Sbjct: 27951 DENVPPIVE---FGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVE-IEKRMNME 28006

Query: 295   YRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQ 348
               D  G   L V       RG+Y   A+N++G   + +++ V++   +   P++
Sbjct: 28007 ITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIR 28060



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 50/248 (20%), Positives = 90/248 (36%), Gaps = 25/248 (10%)

Query: 1384  SPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGT----VTLRAGSTATS 1439
             S P A+V W  NG  +    ++          L +  C   D+GT     T   G  +  
Sbjct: 32399 SKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDY 32458

Query: 1440  ARLHV-----------RETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQ 1488
             A L V           R  E +      ++   E   V    +T  + A+ +VR V+   
Sbjct: 32459 ATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQM 32518

Query: 1489  PLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLED 1548
                 ++R S++   H     +    L +      +S  +++  R        R+L     
Sbjct: 32519 T---ETRESLSSYEHSASAEMKSAALEE------KSLEEKSTTRKIKTTLAARILTKPRS 32569

Query: 1549  VTISEGGSATFQLELSQEGV-TGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSG 1607
             +T+ EG SA F  +   E V T  W R G  L    +  + +  ++    ++ +  +D G
Sbjct: 32570 MTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEG 32629

Query: 1608  CVSFTADS 1615
               S   ++
Sbjct: 32630 NYSVVVEN 32637



 Score = 37.7 bits (86), Expect = 0.11
 Identities = 26/108 (24%), Positives = 39/108 (36%), Gaps = 1/108 (0%)

Query: 229   PPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLP 288
             P E      D+  AP ++        +   E  + + +  + GKP P + W     PL  
Sbjct: 19966 PSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLAT 20025

Query: 289   DRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
             D  R+          L V  CQ  D G Y    +N AG     + + V
Sbjct: 20026 D-TRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKV 20072



 Score = 37.7 bits (86), Expect = 0.11
 Identities = 61/268 (22%), Positives = 96/268 (35%), Gaps = 52/268 (19%)

Query: 312   KDRGLYVCAARNSAGQTLSAVQ----LHVKEPRLRF---TRPLQDVEGREHGIAVLECKV 364
             KD  + V AAR S G  + + +      VK   +     +  +    G E G     CK+
Sbjct: 31532 KDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKI 31591

Query: 365   PNSRIPT--AWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEM---RGRVR 419
              N    T   W+   ++L    KYE   E  V  L +  +   DDG Y C++    G   
Sbjct: 31592 ENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDS 31651

Query: 420   TVANVTVKG----------PILKRLPRKLDVLE-------------------GENAVLLV 450
             + A + VKG            +K++ R+ D +                    GEN    V
Sbjct: 31652 SYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGV 31711

Query: 451   E-TLEAGVEGRWSRDGEEL-------PVICQSSSGHMHALVLPGVTREDAGEVTFSLGN- 501
               T+       W + G+++           +S  G ++ L +  VT +D  E T    N 
Sbjct: 31712 TITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG-LYQLTINSVTTDDDAEYTVVARNK 31770

Query: 502   -SRTTTLLRVKCVKHSPPGPPILAEMFK 528
                 +   ++    H PP    L  MFK
Sbjct: 31771 YGEDSCKAKLTVTLHPPPTDSTLRPMFK 31798



 Score = 37.4 bits (85), Expect = 0.14
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 223   LLQVHQPPESPP---ADPDEAPAPVVEP-LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIE 278
             ++ V++   S P   A P  A   V+EP +K A  ++ V  G+  K    + G+P+P I 
Sbjct: 23203 VVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTIT 23262

Query: 279   WHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             W  +G P L    R+   D      L +      D G Y     N  GQ  +++++
Sbjct: 23263 WTKDGLP-LKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEI 23317



 Score = 37.4 bits (85), Expect = 0.14
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 1284  GGDLELVVHLSGPGGP-VRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCD 1342
             G DL++ + + G   P + W KDGE L    RV +E+     VL ++     D G+Y   
Sbjct: 24326 GEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVT 24385

Query: 1343  A 1343
             A
Sbjct: 24386 A 24386



 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 3/80 (3%)

Query: 257   VNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGL 316
             V+ G   +   YV GKP P + W+   R  LP    +         V+K   CQ   +G+
Sbjct: 16536 VHAGGVIRIIAYVSGKPPPTVTWNMNER-TLPQEATIETTAISSSMVIK--NCQRSHQGV 16592

Query: 317   YVCAARNSAGQTLSAVQLHV 336
             Y   A+N AG+    + + V
Sbjct: 16593 YSLLAKNEAGERKKTIIVDV 16612



 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 1/80 (1%)

Query: 257   VNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGL 316
             V  G   +F   + G P P  +W  +G  +  D    +  D     VL +  C  +D G 
Sbjct: 17522 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSS-VLTIKNCLRRDTGE 17580

Query: 317   YVCAARNSAGQTLSAVQLHV 336
             Y     N+AG    AV L V
Sbjct: 17581 YQITVSNAAGSKTVAVHLTV 17600



 Score = 37.0 bits (84), Expect = 0.18
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 1274  AAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGAR 1332
             A +T V +  G D+++++   G P   V W KD + L S  R  +E   +  +L +    
Sbjct: 27276 ALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVT 27335

Query: 1333  SGDAGEYL 1340
               D G+Y+
Sbjct: 27336 RNDTGKYI 27343



 Score = 36.6 bits (83), Expect = 0.24
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC 566
             P PP+        +++V L W+PP     +P + Y +ER E G ++WI+C
Sbjct: 13292 PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRC 13341



 Score = 36.6 bits (83), Expect = 0.24
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 516   SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGA 574
             +PPG P    +    + +V L W  PE    +    Y +E Q+V   +W +C +      
Sbjct: 30031 APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKC-NTTPTKI 30089

Query: 575   VEVPGDCVPSEGDYRFRI--CTVSGHGRSPHV 604
              E     +P   +YRFR+  C   G G    V
Sbjct: 30090 REYTLTHLPQGAEYRFRVLACNAGGPGEPAEV 30121



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             + V V    +A  +CV+  E    V+W KG   + +S++    ADG +H L++  +   D
Sbjct: 11493 KDVTVPERRQARFECVLTREAN--VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDD 11550

Query: 79    AGVY 82
              GVY
Sbjct: 11551 EGVY 11554



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 3/106 (2%)

Query: 231   ESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDR 290
             E    D  EAP   ++    A  T  V  G   +    V GKPEP+I W  +   +L   
Sbjct: 13678 EIQAVDTQEAPEIFLDVKLLAGLT--VKAGTKIELPATVTGKPEPKITW-TKADMILKQD 13734

Query: 291   RRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
             +R+   +      + ++  +  D G Y+  A N  G+  + V+++V
Sbjct: 13735 KRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQ 565
             PGPP   ++F   ++ + LTW PPE    +    Y +ER+EV ++ W++
Sbjct: 29932 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVR 29980



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 1725  LRSVSAREGDGATFECTVSEVET-TGRWELGGRPLRPGARVRIRQEG-KKHILVLSELRA 1782
             L +   +EG    FE  VS +   T +WE  G+PL  G  + I  EG   + L + +   
Sbjct: 31801 LANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLP 31860

Query: 1783  EDAGEVRF----QAGPAQSLALLEVEAL 1806
             ED G  R      AG     A L+VE L
Sbjct: 31861 EDTGYYRVTATNTAGSTSCQAHLQVERL 31888



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW--IQCFSIEKAGA 574
             PGPP   ++    K ++L++W PP     +P   Y LE++E GS  W  +    I K G 
Sbjct: 15599 PGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGL 15658

Query: 575   VEVPGDCVPS--EG-DYRFRICTVSGHGRSP 602
               V  + VP   EG  Y+FR   ++  G  P
Sbjct: 15659 KGVEFN-VPRLLEGVKYQFRAMAINAAGIGP 15688



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 129/621 (20%), Positives = 223/621 (35%), Gaps = 84/621 (13%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PP PP    +    + +  L W+ PE    +  + Y +E Q  G+E W      +   AV
Sbjct: 24212 PPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAV 24271

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS-PHV----VFHGSAHLVPTARLVAGLEDVQVYDG 630
              V G  + S  +Y+FR+   +  G+S P V    V      + P+ +L      +Q   G
Sbjct: 24272 -VTG--LSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQA--G 24326

Query: 631   EDAVFSLDLSTIIQG----TWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAV 686
             ED    +++  I +     +W  +GE LK             R  +E+      L +   
Sbjct: 24327 ED--LKIEIPVIGRPRPNISWVKDGEPLKQ----------TTRVNVEETATSTVLHIKEG 24374

Query: 687   KHQDSG---ALVGFSCPGVQDSAALTIQESPVHILSPQ--DRVSLTFT--TSERVVLT-- 737
                D G        S     ++ ++ + E P   + P   D VS  F   + E    T  
Sbjct: 24375 NKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGG 24434

Query: 738   CELS------RVDFPATWYKDGQKVEESELLVVKM-DGRKHRL-ILPEAKVQDSGEFECR 789
             C++S      R     TW+     V  + + + K+  G +++  I  E +   S   + +
Sbjct: 24435 CQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSK 24494

Query: 790   TEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVR--WYKDGQEV 847
                        +   P     P    FV +I+ + +++       D   +   Y   Q+ 
Sbjct: 24495 ---------AVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKE 24545

Query: 848   EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY-----P 902
             + S   V  N+ P +      T   +G E++     E        + VS   V      P
Sbjct: 24546 KNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP 24605

Query: 903   SGKVYVAAVRLERVVLT---------CELCRPWAEVRWTKDGEEVVESPALLLQKEDTVR 953
              G+     +    V L           ++     E +   DG  +  S   +L+ E TV 
Sbjct: 24606 PGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVS 24665

Query: 954   RLV------LPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECV 1007
              LV         +    +G +    D   A       + P   + P+ +  ++    E  
Sbjct: 24666 GLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETF 24725

Query: 1008  VLMCELSREDAP-VRWYKDGLEVEESEA-LVLERDGPRCRLVLPAAQPEDGGEFVCD--- 1062
             VL  ++  +  P V W KDG E+EE+ A + ++    +  LV+      DGG+++     
Sbjct: 24726 VLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSN 24785

Query: 1063  -AGDDSAFFTVTV---TAPPE 1079
               G  S   TV V     PPE
Sbjct: 24786 VGGTKSIPITVKVLDRPGPPE 24806



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 7/146 (4%)

Query: 461   WSRDGEELPVICQ---SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSP 517
             W +DGE L    +     +     L +    ++D G+ T +  NS  T    +  +    
Sbjct: 24345 WVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEK 24404

Query: 518   PGPPILAEMF-KGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PGPP+    F +   + V+++W+PP          Y +E+++  +  W    +      +
Sbjct: 24405 PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTI 24464

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS 601
             ++    + +  +Y+FRI   + +G+S
Sbjct: 24465 KITK--LKTGTEYQFRIFAENRYGKS 24488



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 190/979 (19%), Positives = 339/979 (34%), Gaps = 168/979 (17%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQ---EVGSEDWIQC-FSIEKA 572
             PG P + ++ +   +TV L W  P     +  + Y +ER+   EVG   W++C ++I   
Sbjct: 28942 PGRPEVTDVTR---STVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSD 28998

Query: 573   GAVEVPGDCVPSEGD-YRFRICTVSGHG------RSPHVVFHGSAHLVPTARLVAGLED- 624
                 V      SEGD Y FR+   +  G       S   V     +  P A L A L   
Sbjct: 28999 NFFTVTA---LSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD 29055

Query: 625   -VQVYDGEDAVFSLDLSTIIQGT------WFLNGEELKSNEPEGQVEPGALRYRIEQKGL 677
              V +  G D V    L   + G       W    +EL   E          +  ++  G 
Sbjct: 29056 LVTIRAGSDLV----LDAAVGGKPEPKIIWTKGDKELDLCE----------KVSLQYTGK 29101

Query: 678   QHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLT 737
             +   ++      DSG     +      + A+++    +    P  +++++  T E+  L 
Sbjct: 29102 RATAVIKFCDRSDSGKYT-LTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLA 29160

Query: 738   CELSRVDFPAT-WYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF 796
               L + D  A   +   ++ E S L  V ++G    L     ++  + E+  R   V+ +
Sbjct: 29161 WSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKY 29220

Query: 797   F-GVTVQDPPV----------------HIVDPREHVFVHAITSEC-----VMLACEVDRE 834
               GV V+  P+                 +   +EH+ +     E      +       RE
Sbjct: 29221 GPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKRE 29280

Query: 835   DAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITD 894
                +RW +  +     D+VV +         L  T   +G ++Q       A      ++
Sbjct: 29281 KKSLRWTRVNK-----DYVVYDTR-------LKVTSLMEGCDYQFRVTAVNAAGNSEPSE 29328

Query: 895   VSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTK---DGEEVVESPALLLQKEDT 951
              S++I               RVV T +       + WTK   DG   +    L +Q++DT
Sbjct: 29329 ASNFISCREPSYTPGPPSAPRVVDTTKHS---ISLAWTKPMYDGGTDIVGYVLEMQEKDT 29385

Query: 952   -----------VRRLVLPAVQLEDSGEYLCEIDDESA------SFTVTVTEPPVRIIYPR 994
                        +R        L+   +Y   +   +       S ++   EP  RI  P 
Sbjct: 29386 DQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD 29445

Query: 995   DEVT---LIAVTLEC---VVLMCELSREDAPV-RWYKDGLEVEESEALVLERDGPRCRLV 1047
              E+       VT+     + LM  +S    PV  W K G+++  +   +++       L+
Sbjct: 29446 LELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDL--ASRAIIDTTESYSLLI 29503

Query: 1048  LPAAQPEDGGEFVCDAGDDSAFFTVTVTA---------PPERIVHPAARSLDLHFGAP-- 1096
             +      D G++  +A + S   + TV           P  ++   +  S+ + +  P  
Sbjct: 29504 VDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTI 29563

Query: 1097  --GRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDA---GEY 1151
               G       V    + +R +K  +  + S  L   +     T+      PE+    GE 
Sbjct: 29564 DGGAPVNNYIVEKREAAMRAFKT-VTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE- 29621

Query: 1152  VCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVV--------LSCELSRAGA- 1202
              CET    +   V L   P +   ++ T S + +A  +P+            E  +AG  
Sbjct: 29622 PCETSDAVLVSEVPLV--PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTE 29679

Query: 1203  ---------PVVWSHNGRPVQEGEG--LELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAP 1251
                      P V  H    + EGE     + A+  + V                   + P
Sbjct: 29680 RWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGV-------------------SEP 29720

Query: 1252  GAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLA 1310
                  + TVQ       +      Q  +    G  +ELV+ ++G P     W+  G +L 
Sbjct: 29721 RETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR 29780

Query: 1311  SQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLT 1370
                RV +E       L ++     D GEY  +    +     +++  +L K      P+ 
Sbjct: 29781 ESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIK 29840

Query: 1371  VHEGDDATFRCEVSPPDAD 1389
             + E D  +      PP+ D
Sbjct: 29841 IDEIDATSITISWEPPELD 29859



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 22/188 (11%)

Query: 705  SAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVV 764
            SA  + Q+    + +P  + S T   +E   L  +    D P T YK    VE  + + V
Sbjct: 847  SATSSAQKITKSVKAPTVKPSETRVRAEPTPLP-QFPFADTPDT-YKSEAGVEVKKEVGV 904

Query: 765  KMDG---RKHRLIL---PEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVH 818
             + G   R+ R  +    EAKV ++       E         +   P  +V   ++V V 
Sbjct: 905  SITGTTVREERFEVLHGREAKVTETARVPAPVE---------IPVTPPTLVSGLKNVTV- 954

Query: 819  AITSECVMLACEVDREDAP-VRWYKDGQEVEES-DFVVLENEGPHRRLVLPATQPSDGGE 876
             I  E V L C +    +P V WY++  ++E S DF +    G   RL++      D G 
Sbjct: 955  -IEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSG-IARLMIREAFAEDSGR 1012

Query: 877  FQCVAGDE 884
            F C A +E
Sbjct: 1013 FTCSAVNE 1020



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 3/92 (3%)

Query: 332  VQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA-WFREDQRLLPCRKYEQIE 390
            V++ V  P L     L++V   E     LEC +     PT  W+RED ++     ++   
Sbjct: 936  VEIPVTPPTL--VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF 993

Query: 391  EGTVRRLIIHRLKADDDGIYLCEMRGRVRTVA 422
            +  + RL+I    A+D G + C       TV+
Sbjct: 994  QSGIARLMIREAFAEDSGRFTCSAVNEAGTVS 1025



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 229   PPESPP---ADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRP 285
             P E+ P   A+P E PA  VE          +  GK  +    V G+P P   W  E   
Sbjct: 15087 PGETQPVTVAEPQEPPA--VELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGE 15144

Query: 286   LLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
             L  D+ R++  +      L +     KD G YV  A NS G   +A ++ V
Sbjct: 15145 L--DKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 15193



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 2/83 (2%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +G    +   V G+PPP V W    + L     +   A  +   +++     +  GVY
Sbjct: 16536 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSS--MVIKNCQRSHQGVY 16593

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                A+N AGE      V VL+ P
Sbjct: 16594 SLLAKNEAGERKKTIIVDVLDVP 16616



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 21/90 (23%), Positives = 36/90 (40%), Gaps = 2/90 (2%)

Query: 26    GAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCR 85
             G + +++  + G P P + W K G  L  + R++         L +      D G Y   
Sbjct: 23244 GQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGIT 23303

Query: 86    ARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
               N  G+  A+  +  L+ P  DP   P +
Sbjct: 23304 VANVVGQKTASIEIVTLDKP--DPPKGPVK 23331



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 93/414 (22%), Positives = 145/414 (35%), Gaps = 55/414 (13%)

Query: 226   VHQPPES--PPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEG 283
             + +P +S  P    DE   P +        T  VN G+  +    V GKP P IEW   G
Sbjct: 23604 ISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEW-LRG 23662

Query: 284   RPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV------- 336
                + +  R   ++ D   +L V      D G Y+  A N AG     V + V       
Sbjct: 23663 DKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPP 23722

Query: 337   -----------KEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAW-FREDQRLLPCR 384
                        ++  L ++ PLQD  G +    V+E K   SR+  AW     + +    
Sbjct: 23723 EGPVQVTGVTSEKCSLTWSPPLQD-GGSDISHYVVE-KRETSRL--AWTVVASEVVTNSL 23778

Query: 385   KYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGP-ILKRLPRKLDVLEG 443
             K  ++ EG     +   +  +  G+      G     A V +K P +L   P+ L+V   
Sbjct: 23779 KVTKLLEG--NEYVFRIMAVNKYGV------GEPLESAPVLMKNPFVLPGPPKSLEVTNI 23830

Query: 444   ENAVLLV-----------ETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTREDA 492
                 + V           E +   VE R  R G    + C         L + G+T +  
Sbjct: 23831 AKDSMTVCWNRPDSDGGSEIIGYIVEKR-DRSGIRW-IKCNKRRITDLRLRVTGLTEDHE 23888

Query: 493   GEVTFS------LGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTW-KPPEPAP 545
              E   S      +G     T+    C     PGPP  A +    KN++ L W KP     
Sbjct: 23889 YEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGG 23948

Query: 546   ETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
                  Y +E  +   E+W                  +    +Y+ R+C ++  G
Sbjct: 23949 SEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVG 24002



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 487   VTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE 546
             V + DAG+   +L NS       +       PGPP+   + +  K++  +TW+PP     
Sbjct: 19756 VNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGG 19815

Query: 547   TPFI-YRLERQEVGSEDW 563
             +P I Y +++++   + W
Sbjct: 19816 SPIINYVVQKRDAERKSW 19833



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 4/91 (4%)

Query: 514   KHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKA 572
             +  PPGPP   E+    KNT  ++WK P     +    Y +ER+E  S  W++      +
Sbjct: 20568 RFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVS 20627

Query: 573   G-AVEVPGDCVPSEGDYRFRICTVSGHGRSP 602
                 +V G  +     Y FR+   +  G  P
Sbjct: 20628 DLRCKVTG--LQEGSTYEFRVSAENRAGIGP 20656



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 1/82 (1%)

Query: 461   WSRDGEELPVICQSSSGHMHA-LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPG 519
             WSR+  E     Q   G  +  L +    R DAG+    L NS  +    V       PG
Sbjct: 24058 WSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPG 24117

Query: 520   PPILAEMFKGHKNTVLLTWKPP 541
             PP    + +  K++  L W+PP
Sbjct: 24118 PPQNLAVKEVRKDSAFLVWEPP 24139



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 3/64 (4%)

Query: 1657  ADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAG---PVRLT 1713
             A V W KDG  L  + R+ + +  T   L ++     D GTY   V  +      P+ + 
Sbjct: 25424 ATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITII 25483

Query: 1714  VRER 1717
             V +R
Sbjct: 25484 VLDR 25487



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 269   VMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQ 327
             V GKPEP+I W    + L L ++  L Y  +    V+K  +C   D G Y    +N++G 
Sbjct: 29071 VGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIK--FCDRSDSGKYTLTVKNASGT 29128

Query: 328   TLSAVQLHV 336
                +V + V
Sbjct: 29129 KAVSVMVKV 29137



 Score = 34.7 bits (78), Expect = 0.91
 Identities = 22/81 (27%), Positives = 30/81 (37%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G    L   V G PPP + W K    L     L   +   +  L        DAG Y+ 
Sbjct: 19707 AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYIL 19766

Query: 85    RARNAAGEAYAAAAVTVLEPP 105
                N+ G+      V VL+ P
Sbjct: 19767 TLENSCGKKEYTIVVKVLDTP 19787



 Score = 34.7 bits (78), Expect = 0.91
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 8/102 (7%)

Query: 1351  LVSVEEPLLVKLVSELTPLTVHEGDDATFRCE-VSPPDADVTWLRNGAVVTPGPQVEMAQ 1409
             L S E P + K   E+  +T   G+ A   C+ V  P  D+ W R G  +    + +M+ 
Sbjct: 30527 LTSGEAPGIRK---EMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSS 30583

Query: 1410  NGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRET 1447
             +G +  LT+   +  D G  T  A    G   TS++L ++ T
Sbjct: 30584 DGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQAT 30625



 Score = 34.7 bits (78), Expect = 0.91
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 10/128 (7%)

Query: 1775  LVLSELRAEDAGEVRFQAGPAQS---LALLEVEALPLQMCRHPPREKTVLVGRRAVLEVT 1831
             +V+S  R    G +R Q G + +   +A +E+  +  Q+  H   E+   V  + V ++ 
Sbjct: 31536 MVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIM-HAVGEEGGHV--KYVCKIE 31592

Query: 1832  VSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA----GQDST 1887
                    V W     +L   +KYE+        L + D+   D GTY C+     G+DS+
Sbjct: 31593 NYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSS 31652

Query: 1888  HTRLLVEG 1895
             +  L V+G
Sbjct: 31653 YAELFVKG 31660



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 51/238 (21%), Positives = 89/238 (37%), Gaps = 41/238 (17%)

Query: 965   SGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYK 1024
             S EY   +  E+    V V+EPP+    P   VTL+ VT           R  A ++W K
Sbjct: 25275 SNEYGIGLPAETTE-PVKVSEPPL----PPGRVTLVDVT-----------RNTATIKWEK 25318

Query: 1025  ---DGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVT----AP 1077
                DG        + ++  G          +  +       AG++  F    V     + 
Sbjct: 25319 PESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSD 25378

Query: 1078  PERIVHPA-ARSLDLH---------FGAPGRVELRCEVAPAG---SQVRWYKDGLEVEAS 1124
             P ++  P  AR +++          F    R +L+ +V   G   + V W KDG  ++ +
Sbjct: 25379 PRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKET 25438

Query: 1125  DALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSP 1182
               + + +     +L++  A  ED G Y     + A +  V     P+  + L+    P
Sbjct: 25439 TRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITV-----PITIIVLDRPGPP 25491



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 487   VTREDAGEVTFSLGNSRTTTLLRVKCVKH-SPPGPPILAEMFKGHKNTVLLTWKPPEPAP 545
             V  E+A  V  + G SR      +KC +  +PPGPP + ++    K TV L W  P    
Sbjct: 28227 VMAENAAGVGPASGISRL-----IKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDG 28281

Query: 546   ETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR 600
                 I Y +E  +    DW +  + E           + +  +Y+FR+  ++G G+
Sbjct: 28282 GMEIIGYIIEMCKADLGDWHK-VNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGK 28336



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 7/114 (6%)

Query: 489   REDAGEVTFSLGN--SRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE 546
             R D G       N   R T ++ V  +    PGPP   ++      + LLTW PP     
Sbjct: 13755 RSDTGTYIIEAVNVCGRATAVVEVNVL--DKPGPPAAFDITDVTNESCLLTWNPPRDDGG 13812

Query: 547   TPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
             +    Y +ER+   SE W +  S  K    +     +P++ +Y FR+   + +G
Sbjct: 13813 SKITNYVVERRATDSEVWHKLSSTVKDTNFKAT-KLIPNK-EYIFRVAAENMYG 13864



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 19/79 (24%), Positives = 36/79 (45%)

Query: 925   PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVT 984
             P   V W KDG+EV  S  L ++ +     L +P     D+G Y   ++++  S T ++ 
Sbjct: 14414 PVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASIN 14473

Query: 985   EPPVRIIYPRDEVTLIAVT 1003
                + +  P  ++    +T
Sbjct: 14474 VKVIGLPGPCKDIKASDIT 14492



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 838   VRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTI 892
             V W+KDG+EV+ SD + ++N+     L +P +  +D G +     ++    T +I
Sbjct: 14418 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASI 14472



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 1112  VRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
             V W+KDG EV+ASD L +  +  +  L +P +   DAG Y
Sbjct: 14418 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 14457



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFT 980
             +P    +W K  +EVV S  L + K D+   L++  V  +DSG Y    ++ S + T
Sbjct: 18925 KPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDT 18981



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 33/149 (22%), Positives = 60/149 (40%), Gaps = 15/149 (10%)

Query: 748   TWYKDGQKV---EESELLVVKMDGRKHRLILPEAKVQDSGEF------ECRTEGVSAFFG 798
             TWYK GQK+   +  +    + D   ++L +      D  E+      +   +   A   
Sbjct: 31722 TWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLT 31781

Query: 799   VTVQDPPVH--IVDPREHVFVHAITSECVMLACEVDREDAP---VRWYKDGQEVEESDFV 853
             VT+  PP    +    + +  +A   E   +  E+     P   ++W KDGQ +     +
Sbjct: 31782 VTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNI 31841

Query: 854   VLENEG-PHRRLVLPATQPSDGGEFQCVA 881
              + +EG  +  L +  T P D G ++  A
Sbjct: 31842 EIIHEGLDYYALHIRDTLPEDTGYYRVTA 31870



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 18   PRPVRVVSGAEAELKC--------VVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
            PRP+ ++ G   +  C        V +       VW K GQ++  S+R+    D   H L
Sbjct: 2353 PRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHML 2412

Query: 70   LLTAALPTDAGVY 82
            L+      DAG Y
Sbjct: 2413 LIEDMTKEDAGNY 2425



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP 541
             LV+  VTR D+G    +L N+  +    V       P  P+   + +  K++V L+W+PP
Sbjct: 25163 LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPP 25222



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 41/171 (23%), Positives = 64/171 (37%), Gaps = 28/171 (16%)

Query: 63    DGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
             D +E    +T   P D   +   ARNA G        T+  P  S   +   +  +P   
Sbjct: 27907 DVSECQYTVTGLSPGDRYEFRIIARNAVG--------TISPPSQSSGIIMTRDENVP--- 27955

Query: 123   SGEGAPVFLTGPR---SQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFAL 179
                  P+   GP       +  G  + +     G P P + W KDG+ +++  +      
Sbjct: 27956 -----PIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNME---- 28006

Query: 180   QPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPP 230
                   D  G S +L +  A     GVY   A+NA G A+A   ++V   P
Sbjct: 28007 ----ITDVLG-STSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTP 28052



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 1/91 (1%)

Query: 1183  LCVAPGEPVVLSCELSRAGAP-VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAG 1241
             L +  GE + +   +     P V W  +G  +++   +E+        L ++ A   H G
Sbjct: 27968 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 28027

Query: 1242  LYTCQSGAAPGAPSLSFTVQVAEPPVRVVAP 1272
             +YT ++  A G+      V+V + P +VV P
Sbjct: 28028 VYTVEAKNASGSAKAEIKVKVQDTPGKVVGP 28058



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 39/167 (23%), Positives = 65/167 (38%), Gaps = 32/167 (19%)

Query: 453   LEAGVEGR------WSRDGEELPVICQSSS----GHMHALVLPGVTREDAGEVTFSLGNS 502
             L+A V G+      W++  +EL  +C+  S    G     V+    R D+G+ T ++ N+
Sbjct: 29067 LDAAVGGKPEPKIIWTKGDKELD-LCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 29125

Query: 503   RTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWK-PPEPAPETPFIYRLERQEVGSE 561
               T  + V       PGP     + +  +    L W  P E        Y +ER+E    
Sbjct: 29126 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 29185

Query: 562   DWIQCFSIEKAGAVEVPGDC---------VPSEGDYRFRICTVSGHG 599
             +W           V V G+C         +    +Y FR+  V+ +G
Sbjct: 29186 NW-----------VIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYG 29221



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 1721  VLSELRSVSAREGDGATFEC-TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSE 1779
             +L++ RS++  EG+ A F C T  E   T  W   G+ L   AR ++     K    +S 
Sbjct: 32563 ILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISS 32622

Query: 1780  LRAEDAG 1786
             ++A D G
Sbjct: 32623 VQASDEG 32629



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 9/97 (9%)

Query: 139   VLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILA 198
             V  G ++ L     G PEP + W K  M L +        +     E+ P  S  + I+ 
Sbjct: 13702 VKAGTKIELPATVTGKPEPKITWTKADMILKQ---DKRITI-----ENVPKKS-TVTIVD 13752

Query: 199   ARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPA 235
             ++  D+G Y+  A N  G A A   + V   P  P A
Sbjct: 13753 SKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA 13789



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 32/111 (28%), Positives = 44/111 (39%), Gaps = 11/111 (9%)

Query: 134   PRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLA 193
             P    +  G ++ +     G P PT  W+K     DEV  SSH A+          +S  
Sbjct: 18905 PEQITIKAGKKLRIEAHVYGKPHPTCKWKK---GEDEVVTSSHLAVHKA------DSSSI 18955

Query: 194   LRILAARLPDSGVYVCHARNAHG-HAQAGALLQVHQP-PESPPADPDEAPA 242
             L I      DSG Y   A N+ G   Q   ++ +  P P  PP D  +  A
Sbjct: 18956 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA 19006



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 13/89 (14%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTV 983
             RP  EV+W +D  E ++  +  ++   +   L++  V   DSG+Y+  +++ S S +  V
Sbjct: 21887 RPAPEVKWARDHGESLDKAS--IESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFV 21944

Query: 984   TEPPVRII----YPRD----EVTLIAVTL 1004
                 VR++     P+D    EVT  +VTL
Sbjct: 21945 N---VRVLDTPGPPQDLKVKEVTKTSVTL 21970



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 1640  VTEGDTATFECEL-SQALADVTWEKDGNAL-TPSPRLRLQALGTRRLLQLRRCGPSDAGT 1697
             V  G+T   E ++  + + DV W KDG  L   + R+ +++   +  L ++ C  +D G 
Sbjct: 24719 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 24778

Query: 1698  YSCA---VGTARAGPVRLTVRER 1717
             Y      VG  ++ P+ + V +R
Sbjct: 24779 YILKLSNVGGTKSIPITVKVLDR 24801



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 512   CVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC 566
             C  + PPGPP   E+    K+++++TW  P     T    Y LE+++     W +C
Sbjct: 24896 CNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKC 24951



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 491   DAGEVTFSLGNSRTTTLLRVKCVKHSPPGPP----ILAEMFKGHKNTVLLTWKPPE-PAP 545
             DAG    +  NS  TT   +  V    PGPP    +++++    + +V L W+PP+    
Sbjct: 26543 DAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDI---TEESVTLKWEPPKYDGG 26599

Query: 546   ETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHV 604
                  Y L ++E  +  W +  +      ++V    + +  +Y+FRI   +  G S H+
Sbjct: 26600 SQVTNYILLKRETSTAVWTEVSATVARTMMKVMK--LTTGEEYQFRIKAENRFGISDHI 26656



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 24/92 (26%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query: 16    RFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAAL 75
             R+   + V  G    L   + G+P P+  W K GQ +  S+R           L++  A 
Sbjct: 30141 RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSETHTELVIKEAD 30198

Query: 76    PTDAGVYVCRARNAAGEAYAAAAVTVLEPPAS 107
               D+G Y     N  G+      V V+  P S
Sbjct: 30199 RGDSGTYDLVLENKCGKKAVYIKVRVIGSPNS 30230



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 33/158 (20%), Positives = 60/158 (37%), Gaps = 22/158 (13%)

Query: 720   PQDRVSLTFTTSERVVLTCELSRVDFP--------ATWYKDGQKVEESELLVVKMDGRKH 771
             P  + ++   T + +V+  E   +  P         +W+KDG++V+ S+ L +K D    
Sbjct: 14383 PDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISA 14442

Query: 772   RLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEV 831
              L +P++   D+G +    E        ++    + +  P + +    IT     L  E 
Sbjct: 14443 HLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEP 14502

Query: 832   DRED--APVRWYKDGQEVEESDFVVLENEGPHRRLVLP 867
                D   P+  Y            VLE     RR  +P
Sbjct: 14503 PEFDGGTPILHY------------VLERREAGRRTYIP 14528



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 34/109 (31%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 1638  LEVTEGDTATFECEL-SQALADVTWEKDGNA--LTPSPRLRLQALGTRRLLQLRRCGPSD 1694
             L V  GDT   E  +  +   +V W KD +A  LT SPR+++          L +   SD
Sbjct: 18211 LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSD 18270

Query: 1695  AGTYSCAVGTARAGPVRLTVRERTVAVLSELRSV-SAREGDGATFECTV 1742
              G Y     T  AG     V   TV VL +   V + +  D ++  CTV
Sbjct: 18271 GGKY-VVTATNTAGSF---VAYATVNVLDKPGPVRNLKIVDVSSDRCTV 18315



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 40/173 (23%), Positives = 66/173 (38%), Gaps = 17/173 (9%)

Query: 1096  PGRVELRCEVAPAG-SQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCE 1154
             PG   +RC  AP    Q  +   GLE +A    Q  A   T     P ++P D    + E
Sbjct: 19232 PGDKWVRCNTAPHQIPQEEYTATGLEEKAQ--YQFRAIARTAVNISPPSEPSDPVTILAE 19289

Query: 1155  TRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVV-WSHNGRPV 1213
                  I  +V +              S L V  G  V L   +     P V W  +G  +
Sbjct: 19290 NVPPRIDLSVAMK-------------SLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLL 19336

Query: 1214  QEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPP 1266
             +  EG+++  +     L + +     +G YT  +  + G+ S +  ++V + P
Sbjct: 19337 KPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKP 19389



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 4/85 (4%)

Query: 518   PGPPILAEMFKGHKNTVLLTW-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVE 576
             P PP    +    K+TV L W KP          Y +E Q  GS+ W    +++  G   
Sbjct: 20965 PSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVK--GLEC 21022

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRS 601
             V  +    E +Y F++  V+  GRS
Sbjct: 21023 VVRNLTEGE-EYTFQVMAVNSAGRS 21046



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 26/102 (25%), Positives = 41/102 (40%), Gaps = 8/102 (7%)

Query: 232   SPPADP-------DEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGR 284
             SPP++P       D+  AP ++       T  +  G+  +    V G+P P +EW  +G+
Sbjct: 21441 SPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGK 21500

Query: 285   PLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAG 326
               L    +L  +  D    L       +D G Y   A N  G
Sbjct: 21501 E-LEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGG 21541



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 20/87 (22%), Positives = 36/87 (41%)

Query: 833   REDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTI 892
             R  A V W KDGQ ++E+  V + +      L +      D G ++    +     TV I
Sbjct: 25421 RPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPI 25480

Query: 893   TDVSSWIVYPSGKVYVAAVRLERVVLT 919
             T +      P G + +  V  + + ++
Sbjct: 25481 TIIVLDRPGPPGPIRIDEVSCDSITIS 25507



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             P PP    +    K++V LTW  PE    +  + Y +E  E G ++W++C ++ K+    
Sbjct: 26375 PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC-AVAKSTHHV 26433

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRS 601
             V G  +    +Y FR+   +  G S
Sbjct: 26434 VSG--LRENSEYFFRVFAENQAGLS 26456



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD---ESASFT 980
             RP   V W KD + +       ++  D+   L +P V   D+G+Y+  I++   E  S T
Sbjct: 27298 RPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSST 27357

Query: 981   VTV 983
             V+V
Sbjct: 27358 VSV 27360



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/89 (25%), Positives = 35/89 (39%), Gaps = 9/89 (10%)

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
             G+++VL    GG PEP + W K    LD          +      G  A+  ++      
Sbjct: 29062 GSDLVLDAAVGGKPEPKIIWTKGDKELD-------LCEKVSLQYTGKRATAVIKF--CDR 29112

Query: 202   PDSGVYVCHARNAHGHAQAGALLQVHQPP 230
              DSG Y    +NA G      +++V   P
Sbjct: 29113 SDSGKYTLTVKNASGTKAVSVMVKVLDSP 29141



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 2/75 (2%)

Query: 1637  DLEVTEGDTATFECEL-SQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDA 1695
             D+    G+ A   C++  + L D+ W + G  L  S + ++ + G    L +      D 
Sbjct: 30541 DVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDE 30600

Query: 1696  GTYSCAVGTARAGPV 1710
             G Y+C + T   G V
Sbjct: 30601 GVYTC-IATNEVGEV 30614



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 18/76 (23%), Positives = 32/76 (42%)

Query: 37    GEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAA 96
             G P P   W  G + L   +R+      A   L+++ +  +D G+Y  +  N        
Sbjct: 13420 GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGE 13479

Query: 97    AAVTVLEPPASDPELQ 112
               V V+  P++  EL+
Sbjct: 13480 IDVNVIARPSAPKELK 13495



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW 563
             PP PP   E+    KNT  L W  PE    +P   Y +E+++V  + W
Sbjct: 14083 PPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW 14130



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 8/99 (8%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASER--LSFPADG----AEHG--LLLTAALP 76
             +G++  +  V+ G P P   WE  G+   A +      P D     AE+   +++     
Sbjct: 15824 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKR 15883

Query: 77    TDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
             +  G Y   A+N AG+  A   V V++ P    +L+ ++
Sbjct: 15884 SHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSD 15922



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 924   RPWAEVRWTKDGE--EVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASF-- 979
             +P+ EV WTKD +  ++  SP + +       +  L   +  D G+Y+    + + SF  
Sbjct: 18228 KPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVA 18287

Query: 980   --TVTVTEPP 987
               TV V + P
Sbjct: 18288 YATVNVLDKP 18297



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 19/81 (23%), Positives = 34/81 (41%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G+   +   + G P P V W+    +L  ++R+S         L +  ++  D+G Y  
Sbjct: 28661 AGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFL 28720

Query: 85    RARNAAGEAYAAAAVTVLEPP 105
                N AG    +  V V+  P
Sbjct: 28721 TLENTAGVKTFSVTVVVIGRP 28741



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 1432  RAGSTATSARLHVRETELLFLRR-LQDVRAEEGQDVCLEVE-TGRVGAAGAVRWVRGGQP 1489
             R   TA S +  +   E   +R+ ++DV  + G+   L  +  GR      ++W R G+ 
Sbjct: 30515 RPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGR--PLPDIKWYRFGKE 30572

Query: 1490  LPHDSRLSMAQDGHIHRLFIHGVILADQGTYGC 1522
             L    +  M+ DG  H L +      D+G Y C
Sbjct: 30573 LIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC 30605



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 27/102 (26%), Positives = 42/102 (41%), Gaps = 15/102 (14%)

Query: 21    VRVVSGAEAELKCVVLGEPPPVVVWEKGG-------QQLAASERLSFPADGAEHGLLLTA 73
             V V +G    L  +V G P P V W K G        Q+   + ++F        L++  
Sbjct: 18616 VIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF--------LVIPN 18667

Query: 74    ALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
             +   D+G Y     N AGE      V VL+ P    +L+ ++
Sbjct: 18668 STRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSD 18709



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 16/60 (26%), Positives = 30/60 (50%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTV 983
             +P   V W KDG  +  +  + +  +  +  L L +V  +DSG+Y    ++ S S + T+
Sbjct: 19322 KPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 19381



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 1114  WYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
             W K G ++  SD  Q+ +   +  LT+ +A  +DAGEY
Sbjct: 20413 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEY 20450



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 517   PPGPPILAEMFKGHKNTVLLTW-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAV 575
             PPGPP    +    K +  L W KP          Y +E Q+VG E WI+  +       
Sbjct: 20672 PPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRIT 20731

Query: 576   EVPGDCVPSEGDYRFRICTVSGHG 599
             +     + ++  Y FRI  ++  G
Sbjct: 20732 QFVVPDLQTKEKYNFRISAINDAG 20755



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 1081  IVHPAARSLDLHFGAPGRVELRCEVAPAGSQ---VRWYKDGLEVEASDALQLGAEGPTRT 1137
             ++ PA + L   F      +L+ +V   G     V W+KD + ++ +  +   +      
Sbjct: 22145 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSL 22204

Query: 1138  LTLPHAQPEDAGEYVCETRH---EAI-TFNVILAEPP 1170
             LT+  A  ED G YV +  +   EAI T NVI+ + P
Sbjct: 22205 LTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKP 22241



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 38/148 (25%), Positives = 56/148 (37%), Gaps = 23/148 (15%)

Query: 93    AYAAAAVTVL---EPPASDPELQPAER-PLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLT 148
             ++  AAV V    E   S  E++P ER  +P     +     +T      +  GA + L 
Sbjct: 29414 SFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVT------IRAGASLRLM 29467

Query: 149   CRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRIL-AARLPDSGVY 207
                 G P P + W K G+ L              RA      S +L I+      D+G Y
Sbjct: 29468 VSVSGRPPPVITWSKQGIDL------------ASRAIIDTTESYSLLIVDKVNRYDAGKY 29515

Query: 208   VCHARNAHGHAQAGALLQVHQPPESPPA 235
                A N  G   A  L++V+  P   P+
Sbjct: 29516 TIEAENQSGKKSATVLVKVYDTPGPCPS 29543



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 21/110 (19%)

Query: 424 VTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEG------RWSRDGE-----ELPVIC 472
           +T + P   +  + + VLEG  A     T EA + G       W RDG+      LP + 
Sbjct: 1   MTTQAPTFTQPLQSVVVLEGSTA-----TFEAHISGFPVPEVSWFRDGQVISTSTLPGVQ 55

Query: 473 QSSSGHMHALVLPGVTREDAG----EVTFSLGNSRTTTLLRVKCVKHSPP 518
            S S     L +P VT+ ++G    + T   G + +T  L VK  + +PP
Sbjct: 56  ISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK-AETAPP 104



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 47/196 (23%), Positives = 80/196 (40%), Gaps = 24/196 (12%)

Query: 343 FTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFREDQRL----LPCRKYEQIEEGTVRRL 397
           FT+PLQ V   E   A  E  +    +P  +WFR+ Q +    LP  +     +G  +  
Sbjct: 8   FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQI-SFSDGRAKLT 66

Query: 398 IIHRLKADDD--GIYLCEMRGRVRTVANVTVKG----PILKRLPRKLDVLEGENAVLLVE 451
           I    KA+     +      G+  + A + VK     P   +  + + V +G    L V 
Sbjct: 67  IPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVR 126

Query: 452 TLEAGVEG---RWSRDGEELPVICQ---SSSGHMHALVLPGVTREDAG----EVTFSLGN 501
               G+     ++ RDG E+        S  G +++L++     ED+G      T S+G 
Sbjct: 127 V--TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184

Query: 502 SRTTTLLRVKCVKHSP 517
           + +T  L V+  +  P
Sbjct: 185 ATSTAELLVQGEEEVP 200



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 22/104 (21%), Positives = 45/104 (43%), Gaps = 2/104 (1%)

Query: 1630  TIVRGPHDLEVTEGDTATFECELSQA-LADVTWEKDGNALTPSPRLRLQALGTRRLLQLR 1688
             TI    HD+ V EG+  +         +  V+W KDG  +  S RL ++       L++ 
Sbjct: 14388 TIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVP 14447

Query: 1689  RCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSARE 1732
             +   +DAG Y+  +   + G    ++  + + +    + + A +
Sbjct: 14448 KSVRADAGIYTITLEN-KLGSATASINVKVIGLPGPCKDIKASD 14490



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 26/112 (23%), Positives = 42/112 (37%), Gaps = 8/112 (7%)

Query: 232   SPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRR 291
             S    P +   P + P     +   V EG +      + G P P + W ++  P  PD +
Sbjct: 16103 SATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTW-FKAPPKKPDNK 16161

Query: 292   RLMYRDR-------DGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
               +  D        D    L +   +  D GLY   A N+ G     ++L+V
Sbjct: 16162 EPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 16213



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 2/88 (2%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             PG P    +    K  V L W+ P+    +P + Y +ER+  GS+DW +           
Sbjct: 18101 PGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHY 18160

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSPHV 604
             +   CV ++  Y FR+ T +  G S  V
Sbjct: 18161 MVDRCVENQ-IYEFRVQTKNEGGESDWV 18187



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 25/85 (29%), Positives = 32/85 (37%), Gaps = 10/85 (11%)

Query: 153   GLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHAR 212
             G P+PT+ W+K    L +    +          +    S  L I      DSG Y   AR
Sbjct: 21091 GRPKPTVTWKKGDQILKQTQRVNF---------ETTATSTILNINECVRSDSGPYPLTAR 21141

Query: 213   NAHGHAQAGALLQVHQPPESPPADP 237
             N  G       +QVH  P  PP  P
Sbjct: 21142 NIVGEVGDVITIQVHDIP-GPPTGP 21165



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 1659  VTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTY 1698
             VTW+K    L  + R+  +   T  +L +  C  SD+G Y
Sbjct: 21097 VTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPY 21136



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 515   HSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC 566
             + PP PP   E+    K+++++ W  P+    +  I Y +ER++   + WI+C
Sbjct: 21652 YGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKC 21704



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             P PP    +    +N+V L+W+ PE    +  + Y +E Q  GS+ W  C ++ K     
Sbjct: 22049 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATV-KVTEAT 22107

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRS 601
             + G  +  E +Y FR+   +  G S
Sbjct: 22108 ITG-LIQGE-EYSFRVSAQNEKGIS 22130



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 29/107 (27%), Positives = 40/107 (37%), Gaps = 10/107 (9%)

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
             G  V L     G P PT+ W KD    D+   ++         +       ++ I  A  
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKD----DKELQTNALVCVENTTD-----LASILIKDADR 26937

Query: 202   PDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
              +SG Y    RNA G A A   +Q+   P  PP  P E      E +
Sbjct: 26938 LNSGCYELKLRNAMGSASATIRVQILDKP-GPPGGPIEFKTVTAEKI 26983



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 260   GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
             G   K R  + GKP P IEW+ + + L  +    +    D   +L +      + G Y  
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASIL-IKDADRLNSGCYEL 26945

Query: 320   AARNSAGQTLSAVQLHV 336
               RN+ G   + +++ +
Sbjct: 26946 KLRNAMGSASATIRVQI 26962



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 24/83 (28%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +GA   L     G P P  VW K    L  S R       +   L +      DAG Y
Sbjct: 28369 VRAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNRNDAGKY 28426

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                  N +G       V VL+ P
Sbjct: 28427 TLTVENNSGSKSITFTVKVLDTP 28449


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  461 bits (1185), Expect = e-129
 Identities = 389/1568 (24%), Positives = 676/1568 (43%), Gaps = 73/1568 (4%)

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
            K   V E + A+F C +    E  + W  +G  ++    +          +L +   Q  
Sbjct: 5188 KDVTVPERRQARFECVLTR--EANVIWS-KGPDIIKSSDKFDIIADGKKHILVINDSQFD 5244

Query: 313  DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA 372
            D G+Y        G+  SA +L V   RL+F  PL+D   +E   A   C++ + ++   
Sbjct: 5245 DEGVYTAEVE---GKKTSA-RLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVV 5300

Query: 373  WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILK 432
            WF+ D +L   R      EG   +L +  +  DD    + +++ +V+ +++ T +  +L+
Sbjct: 5301 WFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDD----ISQIKAQVKELSS-TAQLKVLE 5355

Query: 433  RLPRKLDVLEGENAVLLVE-TLEAGVEG----RWSRDGEEL---PVICQSSSGHMHALVL 484
              P     L  + AV   E TL+  V      +W +DGEE+   P     + G    L +
Sbjct: 5356 ADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKI 5415

Query: 485  PGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPA 544
                 +D GE     G  +T   + V+        P    E+F G      +    P+  
Sbjct: 5416 KKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVH 5475

Query: 545  PETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHV 604
             +    ++L+ Q + +    +     K   + +    +   G+  F+    + + +S   
Sbjct: 5476 GQ----WKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQ----AANAKSAAN 5527

Query: 605  VFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
            +      L+     +  L DV+V++ ++A F  ++S   +   +L G          Q  
Sbjct: 5528 LKVKELPLI----FITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGT---------QEI 5574

Query: 665  PGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRV 724
             G  R+ + + G +H +++ +   +D    + F       S  L I+   +  L+P   V
Sbjct: 5575 TGDDRFELIKDGTKHSMVIKSAAFEDEAKYM-FEAEDKHTSGKLIIEGIRLKFLTPLKDV 5633

Query: 725  SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
              T    E  V T ELS  +    W+K+ Q++  +  + ++ +G+ H +   +  + D+ 
Sbjct: 5634 --TAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTS 5691

Query: 785  EFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDG 844
            +      G+S+   +TV +   +     +      +  + V+L CE+ + DAPV+W+KDG
Sbjct: 5692 QIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYT--GVEKDEVILQCEISKADAPVKWFKDG 5749

Query: 845  QEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSG 904
            +E++ S   V++ +G  R L+L     SD G++ C  G +     + I D    +V P  
Sbjct: 5750 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH 5809

Query: 905  KVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLED 964
             V V      R     E+        W   GE ++++P   +++E  +  LVL   +L+ 
Sbjct: 5810 SVEVMETETAR--FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQ 5867

Query: 965  SGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYK 1024
            +G    +  +  +S  + V    + ++ P  +VT+ A   E     CELS ED PV WY 
Sbjct: 5868 TGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAG--ETATFDCELSYEDIPVEWYL 5925

Query: 1025 DGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHP 1084
             G ++E S+ +V   +G    L L   + ED GE    A D      + V  PP     P
Sbjct: 5926 KGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKP 5985

Query: 1085 AARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQ 1144
                 D          L CEV+   ++V+W+K+G E+  S   ++ A+G  R L +    
Sbjct: 5986 LE---DQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCT 6042

Query: 1145 PEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPV 1204
            PED   Y C+ +    + N+ +  P V+FL   T    L V   E     CELSR  A V
Sbjct: 6043 PEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTD---LQVREKEMARFECELSRENAKV 6099

Query: 1205 VWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE 1264
             W  +G  +++G+  ++ ++G  R+L I          Y+C+   A  +  L+   + A 
Sbjct: 6100 KWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEA- 6158

Query: 1265 PPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQ 1324
                V     A   V  T    ++LV  +S PG  V WYK  E +   GR ++   G ++
Sbjct: 6159 ----VFTKNLANIEVSETD--TIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKR 6212

Query: 1325 VLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVS 1384
            +L +Q A   DAG Y C  P       V V E L  + +S+   L + EG+ A F C +S
Sbjct: 6213 ILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHE-LAAEFISKPQNLEILEGEKAEFVCSIS 6271

Query: 1385 PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHV 1444
                 V W R+   +  G + ++  +G  R+L ++   L D GT  +  G+   +A L V
Sbjct: 6272 KESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV 6331

Query: 1445 RETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHI 1504
             E +L  +  L+D R +E Q+V    E    GA    +W R  + +   S+  + Q   +
Sbjct: 6332 IE-KLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKA--KWFRNEEAIFDSSKYIILQKDLV 6388

Query: 1505 HRLFIHGVILADQGTYGCESHHDR-----TLARLSVRPRQLRVLRPLEDVTISEGGSATF 1559
            + L I    L DQ  Y     + R     + A L V    LR++ PL+D+   E  S TF
Sbjct: 6389 YTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTF 6448

Query: 1560 QLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCA 1619
              ++++  VT +W + G ++    +     D ++H L +   G  D G    TA   +  
Sbjct: 6449 WCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSV 6508

Query: 1620 ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQAL 1679
            A L++ E P   V    D  VTE D A F C+LS+  A+V W ++G  +    + + +  
Sbjct: 6509 AELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKD 6568

Query: 1680 GTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFE 1739
            G+   L ++ C   D   Y+C V   R    RL V E  V ++   + +    G    F 
Sbjct: 6569 GSIHRLIIKDCRLDDECEYACGV-EDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFL 6627

Query: 1740 CTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLA 1799
              +++ +   +W      +  G + ++  EGK H L + +++  D GE RF A   ++ A
Sbjct: 6628 AELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARA 6687

Query: 1800 LLEVEALP 1807
             LE+ A P
Sbjct: 6688 KLELAAAP 6695



 Score =  439 bits (1128), Expect = e-122
 Identities = 392/1575 (24%), Positives = 667/1575 (42%), Gaps = 85/1575 (5%)

Query: 327  QTLSAVQ---LHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPC 383
            Q L+A+    L VKE  L F  PL+DV   E   A  EC V        W +    +   
Sbjct: 5164 QALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFEC-VLTREANVIWSKGPDIIKSS 5222

Query: 384  RKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRKLD--VL 441
             K++ I +G    L+I+  + DD+G+Y  E+ G+ +T A + V G  LK +    D  V 
Sbjct: 5223 DKFDIIADGKKHILVINDSQFDDEGVYTAEVEGK-KTSARLFVTGIRLKFMSPLEDQTVK 5281

Query: 442  EGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHALVLPGVTREDAGEVTFS 498
            EGE A  + E     +   W ++  +L     +  SS G  H L +  VT +D  ++   
Sbjct: 5282 EGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQ 5341

Query: 499  LGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPF-----IYRL 553
            +    +T  L+V  ++  P     L +     K+ + L  +  +  P   F     I   
Sbjct: 5342 VKELSSTAQLKV--LEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPS 5399

Query: 554  ERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLV 613
             +  + ++   +   I+KA         +  +G+Y   +C         +V     A L+
Sbjct: 5400 PKYSIKADGLRRILKIKKAD--------LKDKGEY---VCDCGTDKTKANVTVE--ARLI 5446

Query: 614  PTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGALRYRI 672
               + + G+E   V+ GE A F ++LS   + G W L G+ L ++ P+ +         I
Sbjct: 5447 KVEKPLYGVE---VFVGETAHFEIELSEPDVHGQWKLKGQPLTAS-PDCE---------I 5493

Query: 673  EQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSE 732
             + G +H LILH  +   +G  V F     + +A L ++E P+  ++P   V +     +
Sbjct: 5494 IEDGKKHILILHNCQLGMTGE-VSFQAANAKSAANLKVKELPLIFITPLSDVKVF--EKD 5550

Query: 733  RVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEG 792
                 CE+SR      W K  Q++   +   +  DG KH +++  A  +D  ++    E 
Sbjct: 5551 EAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAED 5610

Query: 793  VSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDF 852
                  + ++   +  + P + V   A   E  +   E+  ++  V+W+K+ Q +  +  
Sbjct: 5611 KHTSGKLIIEGIRLKFLTPLKDVT--AKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRS 5668

Query: 853  VVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVY-VAAV 911
            V +++EG    +        D  + +  A    +   +T+ +      Y +GK+     V
Sbjct: 5669 VSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDP---YFTGKLQDYTGV 5725

Query: 912  RLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCE 971
              + V+L CE+ +  A V+W KDG+E+  S   +++ +   R L+L      D G+Y C+
Sbjct: 5726 EKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD 5785

Query: 972  IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEE 1031
               +  S  + + +  ++++ P   V ++    E      E+S +D    W   G  + +
Sbjct: 5786 CGTDKTSGKLDIEDREIKLVRPLHSVEVMET--ETARFETEISEDDIHANWKLKGEALLQ 5843

Query: 1032 SEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDL 1091
            +    ++ +G    LVL   + +  G     A +  +   + V      ++ P     D+
Sbjct: 5844 TPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLK---DV 5900

Query: 1092 HFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
               A       CE++     V WY  G ++E SD +   +EG   TLTL   + EDAGE 
Sbjct: 5901 TVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEV 5960

Query: 1152 VCETRHEAITFNVILAEPPVQFLALETTP-SPLCVAPGEPVVLSCELSRAGAPVVWSHNG 1210
                +      N+ + EPPV+F    T P     V  G   VL CE+SR  A V W  NG
Sbjct: 5961 QLTAKDFKTHANLFVKEPPVEF----TKPLEDQTVEEGATAVLECEVSRENAKVKWFKNG 6016

Query: 1211 RPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVV 1270
              + + +  E+ A+G  R L I    P     YTC +         S  + V  P V  +
Sbjct: 6017 TEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDF----KTSCNLNVVPPHVEFL 6072

Query: 1271 APEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQG 1330
             P     +VR       E    LS     V+W+KDG  +    +  +   GA ++L +  
Sbjct: 6073 RP-LTDLQVREKEMARFEC--ELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINK 6129

Query: 1331 ARSGDAGEYLCDA--PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA 1388
                D  EY C+    + S +  V  EE +  K    L  + V E D     CEVS P A
Sbjct: 6130 CLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTK---NLANIEVSETDTIKLVCEVSKPGA 6186

Query: 1389 DVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETE 1448
            +V W +    +    + E+   G  RIL ++   L DAG    R  S+ T  ++ V E  
Sbjct: 6187 EVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELA 6246

Query: 1449 LLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLF 1508
              F+ + Q++   EG+         +   +  V+W R  + L    +  +  DG    L 
Sbjct: 6247 AEFISKPQNLEILEGEKAEFVCSISK--ESFPVQWKRDDKTLESGDKYDVIADGKKRVLV 6304

Query: 1509 IHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGV 1568
            +    L D GTY       R  A L+V  + LR++ PL+D  + E     F  E++ EG 
Sbjct: 6305 VKDATLQDMGTYVVMVGAARAAAHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGA 6363

Query: 1569 TGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGC--VSFT---ADSLRCAARLI 1623
              +W R    ++   K  I      + L +    L D     VS T    ++++ AA LI
Sbjct: 6364 KAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLI 6423

Query: 1624 VREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRR 1683
            V E  + IV    D+E  E  + TF C++++    + W K+G  +    R+  +    + 
Sbjct: 6424 VEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKH 6483

Query: 1684 LLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVS 1743
            +L ++ CG  D G Y    G  ++    L + E     +  L   +  E D A F C +S
Sbjct: 6484 MLTIKDCGFPDEGEYIVTAGQDKS-VAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLS 6542

Query: 1744 EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEV 1803
              +   +W   GR ++ G + +  ++G  H L++ + R +D  E        +S A L V
Sbjct: 6543 REKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV 6602

Query: 1804 EALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTH 1863
            E +P+++ R PP++     G   V    +++    V WLR    +  GDK++M S G  H
Sbjct: 6603 EEIPVEIIR-PPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIH 6661

Query: 1864 SLVIHDVRPEDQGTY 1878
             L I D++P DQG Y
Sbjct: 6662 RLQICDIKPRDQGEY 6676



 Score =  394 bits (1013), Expect = e-109
 Identities = 402/1699 (23%), Positives = 685/1699 (40%), Gaps = 129/1699 (7%)

Query: 228  QPPESPPADPDEAPAPVVEPLKCAPKTFWVNE------------GKHAKFRCYVMGKPEP 275
            +P       PDEAP      LK  P  F V E            G  A F C V   P  
Sbjct: 4787 RPGSGGEKPPDEAP--FTYQLKAVPLKF-VKEIKDIILTESEFVGSSAIFECLV--SPST 4841

Query: 276  EIE-WHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             I  W  +G  +    +     D      L ++  Q  D G Y C  R    +  S  +L
Sbjct: 4842 AITTWMKDGSNIRESPKHRFIADGKDR-KLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL 4900

Query: 335  HVKEPRLRFTRPLQD----VEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIE 390
             V+E  +RF + L++    V+G+      L C++ N      W R+D +++   K  +I 
Sbjct: 4901 VVEELPVRFVKTLEEEVTVVKGQP---LYLSCEL-NKERDVVW-RKDGKIV-VEKPGRIV 4954

Query: 391  EGTV---RRLIIHRLKADDDGIYLCEMRGRVRTVANVTVK-----GPILKRLPRKLDVLE 442
             G +   R L I+     D G Y   +        +  VK        L +  R   V  
Sbjct: 4955 PGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKP 5014

Query: 443  GENAVLLVETLEAGVEGRWSRDGEELPVICQSSS-----GHMHALVLPGVTREDAGEVTF 497
               A+   +  +     +W +  +E+P      +     G+   L +     ED  E   
Sbjct: 5015 KGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAV 5074

Query: 498  SLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLER-- 555
             +   R                    A++  G +   LL  KP E       IY  E   
Sbjct: 5075 EIEGKRYP------------------AKLTLGEREVELL--KPIEDVT----IYEKESAS 5110

Query: 556  --QEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLV 613
               E+   D    + ++       P   + +EG  RF         ++  V++  + + +
Sbjct: 5111 FDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQ-ALNAI 5169

Query: 614  PTARL---------VAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
             TA L            L+DV V +   A F   L+      W    + +KS++      
Sbjct: 5170 TTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTREANVIWSKGPDIIKSSD------ 5223

Query: 665  PGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRV 724
                ++ I   G +H L+++  +  D G        G + SA L +    +  +SP +  
Sbjct: 5224 ----KFDIIADGKKHILVINDSQFDDEGVYTA-EVEGKKTSARLFVTGIRLKFMSPLE-- 5276

Query: 725  SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
              T    E     CELS       W+K+  K+  S  +++  +G+ H+L + E  + D  
Sbjct: 5277 DQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDIS 5336

Query: 785  EFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVH---AITSECVMLACEVDREDAPVRWY 841
            + + + + +S+   + V +      DP   V +H   A+  + + L CEV + D PV+W+
Sbjct: 5337 QIKAQVKELSSTAQLKVLE-----ADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWF 5390

Query: 842  KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
            KDG+E+  S    ++ +G  R L +      D GE+ C  G +     VT   V + ++ 
Sbjct: 5391 KDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVT---VEARLIK 5447

Query: 902  PSGKVYVAAVRL-ERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV 960
                +Y   V + E      EL  P    +W   G+ +  SP   + ++     L+L   
Sbjct: 5448 VEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNC 5507

Query: 961  QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV 1020
            QL  +GE   +  +  ++  + V E P+  I P  +V +     +     CE+SRE    
Sbjct: 5508 QLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVF--EKDEAKFECEVSREPKTF 5565

Query: 1021 RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER 1080
            RW K   E+   +   L +DG +  +V+ +A  ED  +++ +A D      + +     +
Sbjct: 5566 RWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLK 5625

Query: 1081 IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL 1140
             + P     D+            E++    +V+W+K+   +  + ++ +  EG T ++T 
Sbjct: 5626 FLTPLK---DVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITF 5682

Query: 1141 PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA 1200
                 +D  +   E    +    + + E    F               + V+L CE+S+A
Sbjct: 5683 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTG---KLQDYTGVEKDEVILQCEISKA 5739

Query: 1201 GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV 1260
             APV W  +G+ ++  +   + A+G +R+L ++ A  +  G YTC      G    S  +
Sbjct: 5740 DAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDC----GTDKTSGKL 5795

Query: 1261 QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA 1320
             + +  +++V P      V  T     E    +S       W   GE L      ++++ 
Sbjct: 5796 DIEDREIKLVRP-LHSVEVMETETARFE--TEISEDDIHANWKLKGEALLQTPDCEIKEE 5852

Query: 1321 GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR 1380
            G    L +   R    G     A        + V +P ++ L+  L  +TV  G+ ATF 
Sbjct: 5853 GKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRV-KPRVIGLLRPLKDVTVTAGETATFD 5911

Query: 1381 CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA 1440
            CE+S  D  V W   G  + P  +V     G    LTLR  +L DAG V L A    T A
Sbjct: 5912 CELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHA 5971

Query: 1441 RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ 1500
             L V+E  + F + L+D   EEG    LE E  R  A   V+W + G  +    +  +  
Sbjct: 5972 NLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENA--KVKWFKNGTEILKSKKYEIVA 6029

Query: 1501 DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ 1560
            DG + +L IH     D  TY C++   +T   L+V P  +  LRPL D+ + E   A F+
Sbjct: 6030 DGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFE 6089

Query: 1561 LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA 1620
             ELS+E    +W + G ++  G K  I S G    LV+N   L D    S    + R + 
Sbjct: 6090 CELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSG 6149

Query: 1621 RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG 1680
             L V E      +   ++EV+E DT    CE+S+  A+V W K    +  + R  +   G
Sbjct: 6150 MLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEG 6209

Query: 1681 TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC 1740
             +R+L ++     DAG Y+C + ++R    ++ V E     +S+ +++   EG+ A F C
Sbjct: 6210 RKRILVIQNAHLEDAGNYNCRLPSSRTDG-KVKVHELAAEFISKPQNLEILEGEKAEFVC 6268

Query: 1741 TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLA- 1799
            ++S+     +W+   + L  G +  +  +GKK +LV+ +   +D G      G A++ A 
Sbjct: 6269 SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH 6328

Query: 1800 LLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSH 1859
            L  +E L + +   P ++  V   +  V    V+  G    W R    +    KY +   
Sbjct: 6329 LTVIEKLRIVV---PLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQK 6385

Query: 1860 GPTHSLVIHDVRPEDQGTY 1878
               ++L I D   +DQ  Y
Sbjct: 6386 DLVYTLRIRDAHLDDQANY 6404



 Score =  385 bits (988), Expect = e-106
 Identities = 420/1813 (23%), Positives = 709/1813 (39%), Gaps = 111/1813 (6%)

Query: 105  PASDPELQPAERP-------LPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEP 157
            P S  E  P E P       +P     E   + LT   S++V  G+  +  C        
Sbjct: 4788 PGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILT--ESEFV--GSSAIFECLVSPSTAI 4843

Query: 158  TLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGH 217
            T  W KDG  + E          P       G    L I+  +L D+G Y C  R  +  
Sbjct: 4844 TT-WMKDGSNIRE---------SPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKE 4893

Query: 218  AQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEI 277
              + A L V + P              V  +K   +   V +G+     C +    E ++
Sbjct: 4894 KTSTAKLVVEELP--------------VRFVKTLEEEVTVVKGQPLYLSCEL--NKERDV 4937

Query: 278  EWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK 337
             W  +G+ ++    R++         L +      D G Y     N+     S+    V+
Sbjct: 4938 VWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVE 4997

Query: 338  EPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFR--EDQRLLPCRKYEQIEEGTVR 395
              R    +P++D   +  G A+  C +        WF+  ++    P  K E + +G   
Sbjct: 4998 VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHL 5057

Query: 396  RLIIHRLKADDDGIYLCEMRGRVRTVANVTV---KGPILKRLPRKLDVLEGENAVLLVET 452
             L I     +D   Y  E+ G+ R  A +T+   +  +LK +   + + E E+A    E 
Sbjct: 5058 YLKIKNAMPEDIAEYAVEIEGK-RYPAKLTLGEREVELLKPI-EDVTIYEKESASFDAEI 5115

Query: 453  LEAGVEGRWSRDGEEL---PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLR 509
             EA + G+W   GE L   P     + G    L L  V  + AGEV +   N+ TT +L 
Sbjct: 5116 SEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT 5175

Query: 510  VKCVK--HSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCF 567
            VK ++   + P   +     +  +   +LT        E   I+      + S D     
Sbjct: 5176 VKEIELDFAVPLKDVTVPERRQARFECVLT-------REANVIWSKGPDIIKSSDKFDII 5228

Query: 568  SIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQV 627
            +  K   + +       EG Y      V G   S  +   G        + ++ LED  V
Sbjct: 5229 ADGKKHILVINDSQFDDEGVYT---AEVEGKKTSARLFVTGIR-----LKFMSPLEDQTV 5280

Query: 628  YDGEDAVFSLDLS-TIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAV 686
             +GE A F  +LS   +   WF N  +L ++              I  +G  H+L +  V
Sbjct: 5281 KEGETATFVCELSHEKMHVVWFKNDAKLHTSRT----------VLISSEGKTHKLEMKEV 5330

Query: 687  KHQDSGALVGFSCPGVQDSAALTIQES-PVHILSPQDRVSLTFTTSERVVLTCELSRVDF 745
               D   +       +  +A L + E+ P   +   D+   T    + + L CE+S+ D 
Sbjct: 5331 TLDDISQIKA-QVKELSSTAQLKVLEADPYFTVKLHDK---TAVEKDEITLKCEVSK-DV 5385

Query: 746  PATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPP 805
            P  W+KDG+++  S    +K DG +  L + +A ++D GE+ C          VTV+   
Sbjct: 5386 PVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARL 5445

Query: 806  VHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLV 865
            + +  P   V V     E      E+   D   +W   GQ +  S    +  +G    L+
Sbjct: 5446 IKVEKPLYGVEV--FVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILI 5503

Query: 866  LPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRP 925
            L   Q    GE    A +  +   + + ++    + P   V V     +     CE+ R 
Sbjct: 5504 LHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKV--FEKDEAKFECEVSRE 5561

Query: 926  WAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTE 985
                RW K  +E+       L K+ T   +V+ +   ED  +Y+ E +D+  S  + +  
Sbjct: 5562 PKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEG 5621

Query: 986  PPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCR 1045
              ++ + P  +VT  A   E  V   ELS ++  V+W+K+   +  + ++ ++ +G    
Sbjct: 5622 IRLKFLTPLKDVT--AKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHS 5679

Query: 1046 LVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEV 1105
            +       +D  +   +A   S+   +TV    E   +   +  D        V L+CE+
Sbjct: 5680 ITFKDLSIDDTSQIRVEAMGMSSEAKLTVL---EGDPYFTGKLQDYTGVEKDEVILQCEI 5736

Query: 1106 APAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVI 1165
            + A + V+W+KDG E++ S    + A+G  R L L  A   D G+Y C+   +  +  + 
Sbjct: 5737 SKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLD 5796

Query: 1166 LAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEG 1225
            + +  ++   L      + V   E      E+S       W   G  + +    E+  EG
Sbjct: 5797 IEDREIK---LVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEG 5853

Query: 1226 PRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGG 1285
                L +        G      G    A ++  +  +   P RV+        V  T G 
Sbjct: 5854 KIHSLVLHNCRLDQTG------GVDFQAANVKSSAHLRVKP-RVIGLLRPLKDVTVTAGE 5906

Query: 1286 DLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQ 1345
                   LS    PV WY  G++L    +V     G    L ++  +  DAGE    A  
Sbjct: 5907 TATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 5966

Query: 1346 DSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQV 1405
                  + V+EP  V+    L   TV EG  A   CEVS  +A V W +NG  +    + 
Sbjct: 5967 FKTHANLFVKEPP-VEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKY 6025

Query: 1406 EMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQD 1465
            E+  +G  R L +  C   D  T T  A    TS  L+V    + FLR L D++  E + 
Sbjct: 6026 EIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEM 6085

Query: 1466 VCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESH 1525
               E E  R  A   V+W + G  +    +  +   G +  L I+  +L D+  Y CE  
Sbjct: 6086 ARFECELSRENAK--VKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVR 6143

Query: 1526 HDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKC 1585
              RT   L+V   +    + L ++ +SE  +     E+S+ G    W +G  ++    + 
Sbjct: 6144 TARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRY 6203

Query: 1586 HIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDT 1645
             I ++G +  LV+    L D+G  +    S R   ++ V E+    +  P +LE+ EG+ 
Sbjct: 6204 EILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEK 6263

Query: 1646 ATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTA 1705
            A F C +S+    V W++D   L    +  + A G +R+L ++     D GTY   VG A
Sbjct: 6264 AEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAA 6323

Query: 1706 RAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVR 1765
            RA    LTV E+ + ++  L+    +E     F C V+      +W      +   ++  
Sbjct: 6324 RAA-AHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYI 6381

Query: 1766 IRQEGKKHILVLSELRAEDAGE-----VRFQAGPAQSLALLEVEALPLQMCRHPPREKTV 1820
            I Q+   + L + +   +D           +    +S A L VE   L++   P ++   
Sbjct: 6382 ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIV-EPLKDIET 6440

Query: 1821 LVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC 1880
            +  +       V+R    + W + G E+   ++   R     H L I D    D+G Y  
Sbjct: 6441 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 6500

Query: 1881 QAGQDSTHTRLLV 1893
             AGQD +   LL+
Sbjct: 6501 TAGQDKSVAELLI 6513



 Score =  380 bits (975), Expect = e-105
 Identities = 317/1277 (24%), Positives = 523/1277 (40%), Gaps = 41/1277 (3%)

Query: 622  LEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRL 681
            L D    + ++     ++S  +   WF +GEE+  +           +Y I+  GL+  L
Sbjct: 5364 LHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSP----------KYSIKADGLRRIL 5413

Query: 682  ILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELS 741
             +     +D G  V   C   +  A +T++   + +  P   V +     E      ELS
Sbjct: 5414 KIKKADLKDKGEYV-CDCGTDKTKANVTVEARLIKVEKPLYGVEVF--VGETAHFEIELS 5470

Query: 742  RVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTV 801
              D    W   GQ +  S    +  DG+KH LIL   ++  +GE   +     +   + V
Sbjct: 5471 EPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKV 5530

Query: 802  QDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPH 861
            ++ P+  + P   V V     +     CEV RE    RW K  QE+   D   L  +G  
Sbjct: 5531 KELPLIFITPLSDVKV--FEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTK 5588

Query: 862  RRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCE 921
              +V+ +    D  ++   A D+     + I  +    + P   V   A   E  V T E
Sbjct: 5589 HSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDV--TAKEKESAVFTVE 5646

Query: 922  LCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTV 981
            L      V+W K+ + +  + ++ +Q E     +    + ++D+ +   E    S+   +
Sbjct: 5647 LSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKL 5706

Query: 982  TVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDG 1041
            TV E          + T   V  + V+L CE+S+ DAPV+W+KDG E++ S+  V++ DG
Sbjct: 5707 TVLEGDPYFTGKLQDYT--GVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADG 5764

Query: 1042 PRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVEL 1101
             +  L+L  A   D G++ CD G D     + +     ++V P   S+++      R E 
Sbjct: 5765 KKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPL-HSVEVMETETARFET 5823

Query: 1102 RCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAIT 1161
              E++       W   G  +  +   ++  EG   +L L + + +  G    +  +   +
Sbjct: 5824 --EISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSS 5881

Query: 1162 FNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLEL 1221
             + +  +P V  + L      + V  GE     CELS    PV W   G+ ++  + +  
Sbjct: 5882 AH-LRVKPRV--IGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVP 5938

Query: 1222 HAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRS 1281
             +EG    L ++      AG     +       +L     V EPPV    P   QT    
Sbjct: 5939 RSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLF----VKEPPVEFTKPLEDQT---V 5991

Query: 1282 TPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
              G    L   +S     V+W+K+G  +    + ++   G  + L +      D   Y C
Sbjct: 5992 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 6051

Query: 1342 DAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTP 1401
            DA        ++V  P  V+ +  LT L V E + A F CE+S  +A V W ++GA +  
Sbjct: 6052 DAKDFKTSCNLNVVPPH-VEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKK 6110

Query: 1402 GPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAE 1461
            G + ++   G+ RIL +  C L D    +    +  TS  L V E E +F + L ++   
Sbjct: 6111 GKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVS 6170

Query: 1462 EGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYG 1521
            E   + L  E  + GA   V W +G + +    R  +  +G    L I    L D G Y 
Sbjct: 6171 ETDTIKLVCEVSKPGAE--VIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYN 6228

Query: 1522 CESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYP 1581
            C     RT  ++ V       +   +++ I EG  A F   +S+E    +W R    L  
Sbjct: 6229 CRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLES 6288

Query: 1582 GPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVT 1641
            G K  + +DG +  LV+    L D G       + R AA L V E  + IV    D  V 
Sbjct: 6289 GDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVK 6347

Query: 1642 EGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA 1701
            E     F CE++   A   W ++  A+  S +  +        L++R     D   Y+ +
Sbjct: 6348 EQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVS 6407

Query: 1702 VGTARAGPVR----LTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRP 1757
            +   R   V+    L V E  + ++  L+ +   E    TF C V+ +  T +W   G  
Sbjct: 6408 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 6467

Query: 1758 LRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPRE 1817
            +    RV  R +  KH+L + +    D GE    AG  +S+A L +   P +   H   +
Sbjct: 6468 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHL-ED 6526

Query: 1818 KTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGT 1877
            +TV     AV    +SR   +V W R G E+  G KY+    G  H L+I D R +D+  
Sbjct: 6527 QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECE 6586

Query: 1878 YCCQAGQDSTHTRLLVE 1894
            Y C      +  RL VE
Sbjct: 6587 YACGVEDRKSRARLFVE 6603



 Score =  371 bits (952), Expect = e-102
 Identities = 397/1661 (23%), Positives = 670/1661 (40%), Gaps = 102/1661 (6%)

Query: 276  EIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKD-RGLYVCAARNSAGQTLSAVQL 334
            E+ W++E + L+P   +         + L +     +D +G YVC A N +G+T ++ +L
Sbjct: 4463 EVNWYFENK-LVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKL 4521

Query: 335  H-VKEPRLRFTRPLQDVEGREHGIAVLECKV---PNSRIPTAWFREDQRLLPCRKYEQIE 390
              VK       R ++ +E     +A   C++   PN R    WF+  + +    K     
Sbjct: 4522 TVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRF--QWFKAGREIYESDKCSIRS 4579

Query: 391  EGTVRRLIIHRLKADDDGIYLCEMR---GRVRTVANVTVKGP-----ILKRLPRKLDVLE 442
               +  L I R +  D G Y C+     G V   A +TV  P     + K LP +    E
Sbjct: 4580 SKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKP--E 4637

Query: 443  GENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLP-GVTREDAGEVTFSLGN 501
             +  V+L   L         R  EE P +       +    +P     +   EV      
Sbjct: 4638 PKEEVVLKSVLR-------KRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVT 4690

Query: 502  SRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE-TPFIYRLERQEVGS 560
             R   +     V    P  P+ A   K      + T KPP   PE TP    +    VG 
Sbjct: 4691 KRERKIPEPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGK 4750

Query: 561  EDWIQCFSIEKA---GAVEVPGDCVPSEGDYRFRICTVSGHGRSP--HVVFHGSAHLVPT 615
            +   +    E A   G ++      PS  +   R       G  P     F      VP 
Sbjct: 4751 KAEAKAPKEEAAKPKGPIKGVPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVP- 4809

Query: 616  ARLVAGLEDV----QVYDGEDAVFS--LDLSTIIQGTWFLNGEELKSNEPEGQVEPGALR 669
             + V  ++D+      + G  A+F   +  ST I  TW  +G  ++ +           +
Sbjct: 4810 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAIT-TWMKDGSNIRESP----------K 4858

Query: 670  YRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD---SAALTIQESPVHILSPQDRVSL 726
            +R    G   +L +  V+  D+G        G ++   +A L ++E PV  +   +   +
Sbjct: 4859 HRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEE-EV 4917

Query: 727  TFTTSERVVLTCELSRVDFPATWYKDGQ-KVEESELLVVKMDGRKHRLILPEAKVQDSGE 785
            T    + + L+CEL++ +    W KDG+  VE+   +V  + G    L + +A   D+G 
Sbjct: 4918 TVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGT 4976

Query: 786  FECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECV------MLACEVDREDAPVR 839
            +    E  +     +     V +V+      V  I  + V      + AC++ ++   ++
Sbjct: 4977 YTVTVENANNLECSSC----VKVVEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIK 5032

Query: 840  WYKDGQEV--EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSS 897
            W+K   E+  E +D   +  +G H  L +    P D  E+      +     +T+ +   
Sbjct: 5033 WFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREV 5092

Query: 898  WIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVL 957
             ++ P   V +     E      E+       +W   GE +  SP   ++ E   R L L
Sbjct: 5093 ELLKPIEDVTI--YEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTL 5150

Query: 958  PAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTL---IAVTLECVVLMCELS 1014
              V+L+ +GE L +  +   +  +TV E  +    P  +VT+        ECV     L+
Sbjct: 5151 HKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFECV-----LT 5205

Query: 1015 REDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTV 1074
            RE A V W K    ++ S+   +  DG +  LV+  +Q +D G +  +         + V
Sbjct: 5206 RE-ANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFV 5264

Query: 1075 TAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGP 1134
            T    + + P     D            CE++     V W+K+  ++  S  + + +EG 
Sbjct: 5265 TGIRLKFMSPLE---DQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGK 5321

Query: 1135 TRTLTLPHAQPEDAGEYVCETRHEAIT--FNVILAEPPVQFLALETTPSPLCVAPGEPVV 1192
            T  L +     +D  +   + +  + T    V+ A+P       + T         + + 
Sbjct: 5322 THKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKT-----AVEKDEIT 5376

Query: 1193 LSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPG 1252
            L CE+S+   PV W  +G  +       + A+G RR+L I+ A     G Y C  G    
Sbjct: 5377 LKCEVSK-DVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGT--D 5433

Query: 1253 APSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQ 1312
                + TV+      R++  E     V    G      + LS P    +W   G+ L + 
Sbjct: 5434 KTKANVTVE-----ARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTAS 5488

Query: 1313 GRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVH 1372
               ++ + G + +L +   + G  GE    A        + V+E  L+  ++ L+ + V 
Sbjct: 5489 PDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLI-FITPLSDVKVF 5547

Query: 1373 EGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR 1432
            E D+A F CEVS       WL+    +T   + E+ ++G+   + ++     D       
Sbjct: 5548 EKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFE 5607

Query: 1433 AGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPH 1492
            A    TS +L +    L FL  L+DV A+E +     VE         V+W +  Q L  
Sbjct: 5608 AEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNI--RVKWFKNDQRLHT 5665

Query: 1493 DSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTIS 1552
               +SM  +G  H +    + + D      E+    + A+L+V          L+D T  
Sbjct: 5666 TRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGV 5725

Query: 1553 EGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFT 1612
            E      Q E+S+     +W + G ++ P     I +DG +  L+L     +D G  +  
Sbjct: 5726 EKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD 5785

Query: 1613 ADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSP 1672
              + + + +L + +  + +VR  H +EV E +TA FE E+S+      W+  G AL  +P
Sbjct: 5786 CGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTP 5845

Query: 1673 RLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSARE 1732
               ++  G    L L  C     G         ++    L V+ R + +L  L+ V+   
Sbjct: 5846 DCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSS-AHLRVKPRVIGLLRPLKDVTVTA 5904

Query: 1733 GDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA 1792
            G+ ATF+C +S  +    W L G+ L P  +V  R EGK H L L +++ EDAGEV+  A
Sbjct: 5905 GETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTA 5964

Query: 1793 GPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGD 1852
               ++ A L V+  P++  + P  ++TV  G  AVLE  VSR    V W + G E+    
Sbjct: 5965 KDFKTHANLFVKEPPVEFTK-PLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSK 6023

Query: 1853 KYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLV 1893
            KYE+ + G    LVIHD  PED  TY C A    T   L V
Sbjct: 6024 KYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNV 6064



 Score =  349 bits (896), Expect = 1e-95
 Identities = 341/1251 (27%), Positives = 528/1251 (42%), Gaps = 98/1251 (7%)

Query: 701  GVQDSAALTIQESPVHILS---PQDRVSLTFTTSER---VVLTCELSRVDFPATWYKDGQ 754
            G ++ A + IQE+   ++    P     L  T SE    V LT  ++       WY + +
Sbjct: 4413 GTEEVATVKIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTTSITNAK-EVNWYFENK 4471

Query: 755  KVEESELLVVKMDGRKHRLILPEAKVQD-SGEFECRT------EGVSAFFGVTVQDPPV- 806
             V   E      D   + L++ +   +D  GE+ C           SA   V  +  PV 
Sbjct: 4472 LVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVI 4531

Query: 807  -HIVDPREHVFVHAITSECVMLACEVDREDAP---VRWYKDGQEVEESDFVVLENEGPHR 862
               ++P E    H          CE+  + AP    +W+K G+E+ ESD   + +     
Sbjct: 4532 KRKIEPLEVALGHL-----AKFTCEI--QSAPNVRFQWFKAGREIYESDKCSIRSSKYIS 4584

Query: 863  RLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLER------- 915
             L +  TQ  D GE+ C A +E    + T T     +  P G+  V  +  ER       
Sbjct: 4585 SLEILRTQVVDCGEYTCKASNEYGSVSCTATLT---VTVPGGEKKVRKLLPERKPEPKEE 4641

Query: 916  VVLTCELCR------PWAEVRWTKDGE-------------EVVESPALLLQK----EDTV 952
            VVL   L +      P  E +  +  +             E VE P +  ++    E T 
Sbjct: 4642 VVLKSVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIPEPTK 4701

Query: 953  RRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCE 1012
               + PA+ L  + E   + + E  +      EP    I     V ++    E      E
Sbjct: 4702 VPEIKPAIPLP-APEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEE 4760

Query: 1013 LSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTV 1072
             ++   P++    G+  +    +  ER   R         P  GGE       D A FT 
Sbjct: 4761 AAKPKGPIK----GVPKKTPSPIEAERRKLR---------PGSGGE----KPPDEAPFTY 4803

Query: 1073 TVTAPPERIVHPAARSLDLHFGAPGRVEL-RCEVAPAGSQVRWYKDGLEVEASDALQLGA 1131
             + A P + V      +       G   +  C V+P+ +   W KDG  +  S   +  A
Sbjct: 4804 QLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIA 4863

Query: 1132 EGPTRTLTLPHAQPEDAGEYVCETR----HEAITFNVILAEPPVQFLALETTPSPLCVAP 1187
            +G  R L +   Q  DAGEY C  R     +  T  +++ E PV+F+  +T    + V  
Sbjct: 4864 DGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFV--KTLEEEVTVVK 4921

Query: 1188 GEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAE-GPRRVLCIQAAGPAHAGLYTCQ 1246
            G+P+ LSCEL++    VVW  +G+ V E  G  +    G  R L I  A    AG YT  
Sbjct: 4922 GQPLYLSCELNKE-RDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVT 4980

Query: 1247 SGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDG 1306
               A      S  V+V E     +        V+  P G       ++     ++W+K  
Sbjct: 4981 VENANNL-ECSSCVKVVEVIRDWLVKPIRDQHVK--PKGTAIFACDIAKDTPNIKWFKGY 5037

Query: 1307 ERLASQ--GRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVS 1364
            + + ++   + ++ + G    L+++ A   D  EY  +         +++ E   V+L+ 
Sbjct: 5038 DEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGERE-VELLK 5096

Query: 1365 ELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLG 1424
             +  +T++E + A+F  E+S  D    W   G ++ P P  E+   G  R LTL   +L 
Sbjct: 5097 PIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLD 5156

Query: 1425 DAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWV 1484
             AG V  +A +  T+A L V+E EL F   L+DV   E +    E    R      V W 
Sbjct: 5157 QAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTR---EANVIWS 5213

Query: 1485 RGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLR 1544
            +G   +    +  +  DG  H L I+     D+G Y  E    +T ARL V   +L+ + 
Sbjct: 5214 KGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMS 5273

Query: 1545 PLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLA 1604
            PLED T+ EG +ATF  ELS E +   W +   +L+      I S+G  H+L +  + L 
Sbjct: 5274 PLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLD 5333

Query: 1605 DSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKD 1664
            D   +      L   A+L V E         HD    E D  T +CE+S+ +  V W KD
Sbjct: 5334 DISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVP-VKWFKD 5392

Query: 1665 GNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSE 1724
            G  + PSP+  ++A G RR+L++++    D G Y C  GT +     +TV  R + V   
Sbjct: 5393 GEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT-KANVTVEARLIKVEKP 5451

Query: 1725 LRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAED 1784
            L  V    G+ A FE  +SE +  G+W+L G+PL       I ++GKKHIL+L   +   
Sbjct: 5452 LYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGM 5511

Query: 1785 AGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLRE 1844
             GEV FQA  A+S A L+V+ LPL     P  +  V     A  E  VSR      WL+ 
Sbjct: 5512 TGEVSFQAANAKSAANLKVKELPLIFIT-PLSDVKVFEKDEAKFECEVSREPKTFRWLKG 5570

Query: 1845 GAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEG 1895
              E+   D++E+   G  HS+VI     ED+  Y  +A    T  +L++EG
Sbjct: 5571 TQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEG 5621



 Score =  315 bits (807), Expect = 3e-85
 Identities = 253/996 (25%), Positives = 429/996 (43%), Gaps = 47/996 (4%)

Query: 917  VLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEI---- 972
            +  C +    A   W KDG  + ESP      +   R+L +  VQL D+GEY C +    
Sbjct: 4832 IFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGN 4891

Query: 973  DDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDG-LEVEE 1031
             +++++  + V E PVR +   +E   + V  + + L CEL++E   V W KDG + VE+
Sbjct: 4892 KEKTSTAKLVVEELPVRFVKTLEEEVTV-VKGQPLYLSCELNKE-RDVVWRKDGKIVVEK 4949

Query: 1032 SEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGD----DSAFFTVTVTAPPERIVHPAAR 1087
               +V    G    L +  A   D G +     +    + +     V    + +V P   
Sbjct: 4950 PGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR- 5008

Query: 1088 SLDLHFGAPGRVELRCEVAPAGSQVRWYK--DGLEVEASDALQLGAEGPTRTLTLPHAQP 1145
              D H    G     C++A     ++W+K  D +  E +D  ++  +G    L + +A P
Sbjct: 5009 --DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMP 5066

Query: 1146 EDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVV 1205
            ED  EY  E   +     + L E  V+ L        + +   E      E+S A  P  
Sbjct: 5067 EDIAEYAVEIEGKRYPAKLTLGEREVELL---KPIEDVTIYEKESASFDAEISEADIPGQ 5123

Query: 1206 WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAG--LYTCQSGAAPGAPSL-SFTVQV 1262
            W   G  ++     E+ AEG +R L +       AG  LY   +       ++    +  
Sbjct: 5124 WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDF 5183

Query: 1263 AEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGA 1322
            A P   V  PE  Q R       +  ++           W K  + + S  +  +   G 
Sbjct: 5184 AVPLKDVTVPERRQARFECVLTREANVI-----------WSKGPDIIKSSDKFDIIADGK 5232

Query: 1323 RQVLRVQGARSGDAGEYLCDA---PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATF 1379
            + +L +  ++  D G Y  +       +R+F+  +     +K +S L   TV EG+ ATF
Sbjct: 5233 KHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIR----LKFMSPLEDQTVKEGETATF 5288

Query: 1380 RCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATS 1439
             CE+S     V W +N A +     V ++  G +  L ++   L D   +  +    +++
Sbjct: 5289 VCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSST 5348

Query: 1440 ARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMA 1499
            A+L V E +  F  +L D  A E  ++ L+ E   V     V+W + G+ +    + S+ 
Sbjct: 5349 AQLKVLEADPYFTVKLHDKTAVEKDEITLKCE---VSKDVPVKWFKDGEEIVPSPKYSIK 5405

Query: 1500 QDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATF 1559
             DG    L I    L D+G Y C+   D+T A ++V  R ++V +PL  V +  G +A F
Sbjct: 5406 ADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHF 5465

Query: 1560 QLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCA 1619
            ++ELS+  V G+W   G  L   P C I  DG +H L+L+   L  +G VSF A + + A
Sbjct: 5466 EIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSA 5525

Query: 1620 ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQAL 1679
            A L V+E+P+  +    D++V E D A FECE+S+      W K    +T   R  L   
Sbjct: 5526 ANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKD 5585

Query: 1680 GTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFE 1739
            GT+  + ++     D   Y            +L +    +  L+ L+ V+A+E + A F 
Sbjct: 5586 GTKHSMVIKSAAFEDEAKYMFEAEDKHTSG-KLIIEGIRLKFLTPLKDVTAKEKESAVFT 5644

Query: 1740 CTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA-GPAQSL 1798
              +S      +W    + L     V ++ EGK H +   +L  +D  ++R +A G +   
Sbjct: 5645 VELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEA 5704

Query: 1799 ALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRS 1858
             L  +E  P    +   ++ T +     +L+  +S++   V W ++G E+ P     +++
Sbjct: 5705 KLTVLEGDPYFTGK--LQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKA 5762

Query: 1859 HGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVE 1894
             G    L++      D G Y C  G D T  +L +E
Sbjct: 5763 DGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIE 5798



 Score =  291 bits (745), Expect = 4e-78
 Identities = 315/1294 (24%), Positives = 508/1294 (39%), Gaps = 122/1294 (9%)

Query: 674  QKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAA-LTIQESPVHILSPQDRVSLTFTTSE 732
            +KGLQ    L  + H+  GAL G +    +     + +   PV +L             E
Sbjct: 1764 RKGLQRIEELERMAHE--GALTGVTTDQKEKQKPDIVLYPEPVRVLE-----------GE 1810

Query: 733  RVVLTCELSRVDFP-ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE 791
                 C ++    P   WY +GQ + +S+   V+ DG  H L + + K  D+GE +   E
Sbjct: 1811 TARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGEVKVTAE 1869

Query: 792  GVSAFFGVTVQDPPVHIV-------------DPREHVFVHAITSECVMLACEVDREDAPV 838
                  GV      + I              +PR    VH    E   L  EV + D PV
Sbjct: 1870 NPE---GVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH----EPGKLQFEVQKVDRPV 1922

Query: 839  -----------------RWYKDGQEVEE--SDFVVLENEGPHRRLV---LPATQPSDG-G 875
                                K  +E EE  S F     EG +  +    L + +  +   
Sbjct: 1923 DTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYE 1982

Query: 876  EFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCEL------------- 922
            E      DE  ++T  +T+     +   GK+ +   + +++ L+  +             
Sbjct: 1983 ELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2042

Query: 923  --------------CRPWAEVRWTKDGEEVVESPALLLQ-KEDTVRRLVLPAVQLEDSGE 967
                           +P  E  W K+G ++  S  +     ED V  LV+  V  EDS  
Sbjct: 2043 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSAS 2102

Query: 968  YLCE---IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLM-CELSREDAPVRWY 1023
             + +   I  E++S    + +    I + ++   ++A   + +    CE S     V+WY
Sbjct: 2103 IMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWY 2162

Query: 1024 KDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVH 1083
            KDG+EV E +   +  D     L +      D  ++ C   +D    T         +V 
Sbjct: 2163 KDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVE 2222

Query: 1084 PAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHA 1143
                  D+        EL C V+P   + +WY + +E++++    + +    + LT+   
Sbjct: 2223 FVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDV 2282

Query: 1144 QPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP 1203
              ED GEY      +  T  + +   P+  L      S   V  G+ V L  ++S     
Sbjct: 2283 TKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQ---GLSDQKVCEGDIVQLEVKVSLESVE 2339

Query: 1204 VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVA 1263
             VW  +G+ VQ  + + +  +    +L I+      AG Y+    A      LS + +V+
Sbjct: 2340 GVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPAL----GLSTSGRVS 2395

Query: 1264 EPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPG-GPVRWYKDGERLASQGRVQLEQAGA 1322
               V V+ P      V    G    L   +S P    V+WY + E++    RVQ    G 
Sbjct: 2396 VYSVDVITP---LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGT 2452

Query: 1323 RQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCE 1382
            +Q L +    + D G Y     +      +SVE+   +K++  L  LT  E  +  F  E
Sbjct: 2453 KQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK---IKIIRGLRDLTCTETQNVVFEVE 2509

Query: 1383 VSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARL 1442
            +S    DV W      + P  + ++  +G    LT+      D G  T  AG   TS +L
Sbjct: 2510 LSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKL 2569

Query: 1443 HVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDG 1502
             V    +   + L D    E Q+   E E     + G   W+R G+ LP  + +    DG
Sbjct: 2570 TVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKG--EWLRDGKHLPLTNNIRSESDG 2625

Query: 1503 HIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLE 1562
            H  RL I    L D G Y  +    +T A+L V    +++ + L+++T++E   A F +E
Sbjct: 2626 HKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA--VKIKKTLKNLTVTETQDAVFTVE 2683

Query: 1563 LSQEGVTG-EWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAAR 1621
            L+   V G +W + GV L    K  I   G  + L +    + D     F    L  +AR
Sbjct: 2684 LTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASAR 2743

Query: 1622 LIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGT 1681
            L V  V   I++ P D+   E  T  FE  +S     V W      + PS + RL +   
Sbjct: 2744 LHVETVK--IIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERK 2801

Query: 1682 RRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECT 1741
               L L+   PSDAG Y+  VG       +  +   T+ +   ++++   E   A+FEC 
Sbjct: 2802 VHKLMLQNISPSDAGEYTAVVGQLEC---KAKLFVETLHITKTMKNIEVPETKTASFECE 2858

Query: 1742 VSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALL 1801
            VS       W   G  +    + +I  +GK H L++     ED+ E  F  G  Q  A L
Sbjct: 2859 VSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATL 2918

Query: 1802 EVEALPL-QMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG 1860
             V  + +  M +    E+   +      EVTV+  G    WL+ G E+   DK +MR+  
Sbjct: 2919 TVTPIMITSMLKDINAEEKDTI----TFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK 2974

Query: 1861 PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVE 1894
             THSL I +V   D   Y   AG+ ++   L VE
Sbjct: 2975 LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVE 3008



 Score =  283 bits (723), Expect = 1e-75
 Identities = 253/1072 (23%), Positives = 449/1072 (41%), Gaps = 36/1072 (3%)

Query: 831  VDREDAPVRWYKDGQEVEESDFVVLE-NEGPHRRLVLPATQPSDGGEFQC----VAGDEC 885
            V + D    WYK+G ++E SD +     E     LV+      D          +AG+  
Sbjct: 2056 VGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETS 2115

Query: 886  AYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALL 945
            ++  + +            +  VA  +       CE   P+ +V+W KDG EV E     
Sbjct: 2116 SHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYR 2175

Query: 946  LQKEDTVRRLVLPAVQLEDSGEYLCE-IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTL 1004
            +  +  V  L +  +   D+ +Y C  ++DE+   T  +      + + ++   +     
Sbjct: 2176 MHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPES 2235

Query: 1005 ECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAG 1064
                L C +S E+   +WY + +E++ +    +     R  L +     ED GE+     
Sbjct: 2236 YSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVID 2295

Query: 1065 DDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEAS 1124
                   + +   P  I+   +   D        V+L  +V+    +  W KDG EV+ S
Sbjct: 2296 GKKTTCKLKMKPRPIAILQGLS---DQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPS 2352

Query: 1125 DALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLC 1184
            D + +  +  +  L +     EDAG Y        ++ +  ++   V  +   T    + 
Sbjct: 2353 DRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVI---TPLKDVN 2409

Query: 1185 VAPGEPVVLSCELSRAGAPVV-WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLY 1243
            V  G   VL C++S      V W  N   ++  + ++   +G ++ L I     +  G Y
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2469

Query: 1244 TCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWY 1303
                G      +LS         V  +        +  T   ++   V LS  G  V W 
Sbjct: 2470 KLIVGRVETNCNLS---------VEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWN 2520

Query: 1304 KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLV 1363
               + +    + ++E  G    L V      D G+Y   A ++     ++V    + K  
Sbjct: 2521 FKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISK-- 2578

Query: 1364 SELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQL 1423
              LT  TV E  +A F CEV+ PD+   WLR+G  +     +    +G  R L +   +L
Sbjct: 2579 -PLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKL 2637

Query: 1424 GDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRW 1483
             D G  T +  ++ TSA+L V   ++   + L+++   E QD    VE       G V+W
Sbjct: 2638 DDIGEYTYKVATSKTSAKLKVEAVKIK--KTLKNLTVTETQDAVFTVELTHPNVKG-VQW 2694

Query: 1484 VRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVL 1543
            ++ G  L  + + +++  G I+ L I    + D+  YG         ARL V    ++++
Sbjct: 2695 IKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVET--VKII 2752

Query: 1544 RPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGL 1603
            +  +DVT  E  +  F++ +S + V  +W    V++ P  K  + S+   H+L+L  +  
Sbjct: 2753 KKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2812

Query: 1604 ADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEK 1663
            +D+G  +     L C A+L V  + +T  +   ++EV E  TA+FECE+S       W K
Sbjct: 2813 SDAGEYTAVVGQLECKAKLFVETLHIT--KTMKNIEVPETKTASFECEVSHFNVPSMWLK 2870

Query: 1664 DGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLS 1723
            +G  +  S + ++   G    L +      D+  Y+   G  +   V  T+    + + S
Sbjct: 2871 NGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQ---VSATLTVTPIMITS 2927

Query: 1724 ELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE 1783
             L+ ++A E D  TFE TV+    + +W   G  ++   + ++R +   H L +  +   
Sbjct: 2928 MLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFG 2987

Query: 1784 DAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLR 1843
            DA +  F AG A S A L VEA  ++  +H  ++  VL  +RA+ E  VS     V W++
Sbjct: 2988 DAADYTFVAGKATSTATLYVEARHIEFRKHI-KDIKVLEKKRAMFECEVSEPDITVQWMK 3046

Query: 1844 EGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEG 1895
            +  EL   D+ +++     H L+I   R  D G Y   AG + +  +L VEG
Sbjct: 3047 DDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEG 3098



 Score =  263 bits (671), Expect = 2e-69
 Identities = 370/1671 (22%), Positives = 649/1671 (38%), Gaps = 200/1671 (11%)

Query: 233  PPADPDEAPAPVVEPLKCAPKTF------WVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL 286
            P   PD+     + P   APK F       V +G  A FR  V+GKP+PE EW+  G  +
Sbjct: 2016 PTFKPDKIE---LSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKI 2072

Query: 287  LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRL-RFTR 345
                R   Y   D    L +    A+D    +  A N AG+T S   L V+  +L  FT+
Sbjct: 2073 ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQ 2132

Query: 346  PLQDVEGREHG-IAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKA 404
             LQDV  +E   +A  EC+     +   W+++   +    KY    +  V  L I  +  
Sbjct: 2133 ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDT 2192

Query: 405  DDDGIYLCEM--RGRVRTVANVTVKGPILKRLP--RKLDVLEGENAVLLVETLEAGVEGR 460
             D   Y C +     V+T A + V+G +++ +   + ++V E  +  L        +EG+
Sbjct: 2193 SDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGK 2252

Query: 461  WSRDGEEL----PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHS 516
            W  +  EL         S  G  + L +  VT+ED GE +F +   +TT  L++K     
Sbjct: 2253 WYHNDVELKSNGKYTITSRRGRQN-LTVKDVTKEDQGEYSFVIDGKKTTCKLKMK----- 2306

Query: 517  PPGPPILAEMFKGHK----NTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKA 572
             P P  + +     K    + V L  K    + E   ++  + QEV   D +     +++
Sbjct: 2307 -PRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEG--VWMKDGQEVQPSDRVHIVIDKQS 2363

Query: 573  GAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGED 632
              + +        G+Y F I  + G   S  V  +    + P       L+DV V +G  
Sbjct: 2364 HMLLIEDMTKEDAGNYSFTIPAL-GLSTSGRVSVYSVDVITP-------LKDVNVIEGTK 2415

Query: 633  AVFSLDLST--IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQD 690
            AV    +S   +    W+LN E++K ++          R +   KG + RL+++     D
Sbjct: 2416 AVLECKVSVPDVTSVKWYLNDEQIKPDD----------RVQAIVKGTKQRLVINRTHASD 2465

Query: 691  SG---ALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPA 747
             G    +VG     V+ +  L++++  + I   +D   LT T ++ VV   ELS      
Sbjct: 2466 EGPYKLIVG----RVETNCNLSVEKIKI-IRGLRD---LTCTETQNVVFEVELSHSGIDV 2517

Query: 748  TWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEF-----ECRTEGVSAFFGVTVQ 802
             W    ++++ S    ++  G+ ++L +      D G++     E  T G     G  + 
Sbjct: 2518 LWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS 2577

Query: 803  DPPVH--IVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGP 860
             P     + + +E VF            CEV   D+   W +DG+ +  ++ +  E++G 
Sbjct: 2578 KPLTDQTVAESQEAVF-----------ECEVANPDSKGEWLRDGKHLPLTNNIRSESDGH 2626

Query: 861  HRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKV-----YVAAVRLER 915
             RRL++ AT+  D GE+          + V  +  S+ +   + K+      +     + 
Sbjct: 2627 KRRLIIAATKLDDIGEYT---------YKVATSKTSAKLKVEAVKIKKTLKNLTVTETQD 2677

Query: 916  VVLTCELCRPWAE-VRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD 974
             V T EL  P  + V+W K+G  +  +    +  + T+  L +    + D   Y   +  
Sbjct: 2678 AVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGR 2737

Query: 975  ESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEA 1034
              AS  + V    V+II    +VT  A+    V     +S +  PV+W+   +E++ S+ 
Sbjct: 2738 LGASARLHV--ETVKIIKKPKDVT--ALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK 2793

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDAGD---DSAFF--TVTVTAPPERIVHPAARSL 1089
              L  +    +L+L    P D GE+    G     +  F  T+ +T   + I  P  ++ 
Sbjct: 2794 HRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKT- 2852

Query: 1090 DLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAG 1149
                         CEV+       W K+G+E+E S+  ++  +G    L + +   ED+ 
Sbjct: 2853 ---------ASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2903

Query: 1150 EY--VCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWS 1207
            EY  VC     + T  V     P+   ++      +     + +     ++  G    W 
Sbjct: 2904 EYTFVCGNDQVSATLTV----TPIMITSM---LKDINAEEKDTITFEVTVNYEGISYKWL 2956

Query: 1208 HNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE--- 1264
             NG  ++  +  ++  +     L I+      A  YT  +G A    +L    +  E   
Sbjct: 2957 KNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRK 3016

Query: 1265 --PPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGA 1322
                ++V+  + A                 +S P   V+W KD + L    R+++++   
Sbjct: 3017 HIKDIKVLEKKRAM------------FECEVSEPDITVQWMKDDQELQITDRIKIQKEKY 3064

Query: 1323 RQVLRVQGARSGDAGEYLCDA---PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATF 1379
               L +   R  DAG+Y   A      +++F+    E   V++ S    + V E   A  
Sbjct: 3065 VHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFV----EGRDVRIRSIKKEVQVIEKQRAVV 3120

Query: 1380 RCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRI--LTLRGCQLGDAGTVTLRAGSTA 1437
              EV+  D D  W ++G  +    Q         RI  + +   +  DAG  T  AG   
Sbjct: 3121 EFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNR 3180

Query: 1438 TSARLHVRETE-LLFLRRLQDVRAEEGQDV-CLEVETGRVGAAGAVRWVRGGQPLPHDSR 1495
            +S  L+V   E    L+ LQ V  + G+      V +GR      + W +  Q L    +
Sbjct: 3181 SSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGR--PQPKISWYKEEQLLSTGFK 3238

Query: 1496 LSMAQDGHIHRLFIHGVILADQGTYGCESHHD----RTLARLSVRPRQL----------- 1540
                 DG  + L +      D   Y CE+ +D     T A LSV   ++           
Sbjct: 3239 CKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3298

Query: 1541 -RVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLN 1599
              ++ PL+D   SEG  A FQ  +S   +   W     ++ P     +      ++L + 
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIA 3358

Query: 1600 GLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADV 1659
                 D G  +F A +   A   +     +++     D + +  D    E   SQA+AD 
Sbjct: 3359 EAYPEDEGTYTFVASN---AVGQVSSTANLSLEVQALDRQSSGKDVR--ESAKSQAVADS 3413

Query: 1660 TWEKDGNALTPSPRLRLQALGTRRLLQL-RRCGPSDAGTYSCAVGTARAGPVRLT-VRER 1717
            ++ K+ + ++       Q       +Q+      S   T +    T       L+ + E 
Sbjct: 3414 SFTKEESKISQKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQLCHTASLSQIAES 3473

Query: 1718 T--------------VAVLSELRSVSAREGDGATFECTVSE---VETTGRWELGGRPLRP 1760
            T                +   L+ V+ + GD A F C + +   ++ T  W   G  +  
Sbjct: 3474 TELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVT--WTHEGAKIEE 3531

Query: 1761 GARVRIRQEGKKHILVLSELRAEDAG----EVRFQAGPAQSLALLEVEALP 1807
              R++  Q G    L +  ++  D G     V    G   + A+L VE  P
Sbjct: 3532 SERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAP 3582



 Score =  257 bits (657), Expect = 7e-68
 Identities = 273/1217 (22%), Positives = 467/1217 (38%), Gaps = 48/1217 (3%)

Query: 681  LILHAVKHQDSGALV--GFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVV-LT 737
            L++  V  +DS +++    +  G   S A  + ++   I   Q+   +     + +    
Sbjct: 2090 LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFE 2149

Query: 738  CELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFEC---RTEGVS 794
            CE S       WYKDG +V E +   +  D + H L +      D+ ++ C     E V 
Sbjct: 2150 CETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVK 2209

Query: 795  AFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVV 854
                + V+   V  V   + + V    S    L C V  E+   +WY +  E++ +    
Sbjct: 2210 TTAKLIVEGAVVEFVKELQDIEVPESYSG--ELECIVSPENIEGKWYHNDVELKSNGKYT 2267

Query: 855  LENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLE 914
            + +    + L +      D GE+  V   +    T  +      I    G         +
Sbjct: 2268 ITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKT--TCKLKMKPRPIAILQGLSDQKVCEGD 2325

Query: 915  RVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD 974
             V L  ++     E  W KDG+EV  S  + +  +     L++  +  ED+G Y   I  
Sbjct: 2326 IVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPA 2385

Query: 975  ESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDGLEVEESE 1033
               S +  V+   V +I P  +V +I  T    VL C++S  D   V+WY +  +++  +
Sbjct: 2386 LGLSTSGRVSVYSVDVITPLKDVNVIEGTK--AVLECKVSVPDVTSVKWYLNDEQIKPDD 2443

Query: 1034 ALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSL-DLH 1092
             +     G + RLV+      D G +    G       ++V    E+I     R L DL 
Sbjct: 2444 RVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSV----EKI--KIIRGLRDLT 2497

Query: 1093 FGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYV 1152
                  V    E++ +G  V W     E++ S   ++ A G    LT+ +   +D G+Y 
Sbjct: 2498 CTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYT 2557

Query: 1153 CETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRP 1212
                    +  + +A   +     + T     VA  +  V  CE++   +   W  +G+ 
Sbjct: 2558 FYAGENMTSGKLTVAGGAISKPLTDQT-----VAESQEAVFECEVANPDSKGEWLRDGKH 2612

Query: 1213 VQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAP 1272
            +     +   ++G +R L I A      G YT +   +  +  L          V  V  
Sbjct: 2613 LPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLK---------VEAVKI 2663

Query: 1273 EAAQTRVRSTPGGDLELVVHLSGPGGP-VRWYKDGERLASQGRVQLEQAGARQVLRVQGA 1331
            +     +  T   D    V L+ P    V+W K+G  L S  +  +   G    LR++  
Sbjct: 2664 KKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNC 2723

Query: 1332 RSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVT 1391
               D   Y     +      + VE   ++K   ++T L   E     F   VS     V 
Sbjct: 2724 AIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTAL---ENATVAFEVSVSHDTVPVK 2780

Query: 1392 WLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLF 1451
            W      + P  +  +        L L+     DAG  T   G     A+L V    +  
Sbjct: 2781 WFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHIT- 2839

Query: 1452 LRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHG 1511
             + ++++   E +    E E           W++ G  +    +  +   G +H+L I  
Sbjct: 2840 -KTMKNIEVPETKTASFECEVSHFNVPSM--WLKNGVEIEMSEKFKIVVQGKLHQLIIMN 2896

Query: 1512 VILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGE 1571
                D   Y     +D+  A L+V P  + +   L+D+   E  + TF++ ++ EG++ +
Sbjct: 2897 TSTEDSAEYTFVCGNDQVSATLTVTP--IMITSMLKDINAEEKDTITFEVTVNYEGISYK 2954

Query: 1572 WARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTI 1631
            W + GV++    KC + +    H L +  +   D+   +F A      A L V    +  
Sbjct: 2955 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3014

Query: 1632 VRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCG 1691
             +   D++V E   A FECE+S+    V W KD   L  + R+++Q       L +    
Sbjct: 3015 RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3074

Query: 1692 PSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRW 1751
             SDAG Y+   G       +L V  R V + S  + V   E   A  E  V+E +    W
Sbjct: 3075 MSDAGKYTVVAG-GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHW 3133

Query: 1752 ELGGRPLRPGARVRIRQ--EGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQ 1809
               G  +    + R +   E + H + +SE R  DAGE  F AG  +S   L V A    
Sbjct: 3134 YKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPP 3193

Query: 1810 MCRHPPREKTVLVGRRAVLEVTVS-RSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIH 1868
                  +  TV  G+ A     +S R    + W +E   L  G K +    G  ++L++ 
Sbjct: 3194 QVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLI 3253

Query: 1869 DVRPEDQGTYCCQAGQD 1885
            +  PED   Y C+A  D
Sbjct: 3254 EAFPEDAAVYTCEAKND 3270



 Score =  254 bits (650), Expect = 4e-67
 Identities = 296/1330 (22%), Positives = 527/1330 (39%), Gaps = 109/1330 (8%)

Query: 612  LVPTARLVAGLEDVQ--VYDGEDAVFSLDLST---IIQGTWFLNGEELKSNEPEGQVEPG 666
            LV   +L+   +++Q  V   +D + + +  T    ++  W+ +G E+   +        
Sbjct: 2121 LVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGD-------- 2172

Query: 667  ALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD-----SAALTIQESPVHILSPQ 721
              +YR+      H L +  +   D+     +SC  V+D     +A L ++ + V  +   
Sbjct: 2173 --KYRMHSDRKVHFLSILTIDTSDAE---DYSCVLVEDENVKTTAKLIVEGAVVEFVKEL 2227

Query: 722  DRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQ 781
              + +  + S    L C +S  +    WY +  +++ +    +     +  L + +   +
Sbjct: 2228 QDIEVPESYSGE--LECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKE 2285

Query: 782  DSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWY 841
            D GE+    +G      + ++  P+ I+       V     + V L  +V  E     W 
Sbjct: 2286 DQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKV--CEGDIVQLEVKVSLESVEGVWM 2343

Query: 842  KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
            KDGQEV+ SD V +  +     L++      D G +          FT+    +S+    
Sbjct: 2344 KDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYS---------FTIPALGLST---- 2390

Query: 902  PSGKVYVAAVRL------------ERVVLTCELCRP-WAEVRWTKDGEEVVESPALLLQK 948
             SG+V V +V +             + VL C++  P    V+W  + E++     +    
Sbjct: 2391 -SGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIV 2449

Query: 949  EDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVV 1008
            + T +RLV+      D G Y   +     +  ++V +  ++II    ++T      + VV
Sbjct: 2450 KGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK--IKIIRGLRDLT--CTETQNVV 2505

Query: 1009 LMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSA 1068
               ELS     V W     E++ S    +E  G   +L +     +D G++   AG++  
Sbjct: 2506 FEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMT 2565

Query: 1069 FFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQ 1128
               +TV      I  P     D            CEVA   S+  W +DG  +  ++ ++
Sbjct: 2566 SGKLTVAGGA--ISKPLT---DQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIR 2620

Query: 1129 LGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPG 1188
              ++G  R L +   + +D GEY  +     +  +   A+  V+ + ++ T   L V   
Sbjct: 2621 SESDGHKRRLIIAATKLDDIGEYTYK-----VATSKTSAKLKVEAVKIKKTLKNLTVTET 2675

Query: 1189 EPVVLSCELSRAGAP-VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQS 1247
            +  V + EL+      V W  NG  ++  E   +  +G    L I+        +Y  + 
Sbjct: 2676 QDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRL 2735

Query: 1248 GAAPGAPSLSF-TVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDG 1306
            G    +  L   TV++ + P  V A E A               V +S    PV+W+   
Sbjct: 2736 GRLGASARLHVETVKIIKKPKDVTALENATVAFE----------VSVSHDTVPVKWFHKS 2785

Query: 1307 ERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSEL 1366
              +    + +L        L +Q     DAGEY     Q      + VE   + K +  +
Sbjct: 2786 VEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNI 2845

Query: 1367 TPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDA 1426
                V E   A+F CEVS  +    WL+NG  +    + ++   G    L +      D+
Sbjct: 2846 E---VPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDS 2902

Query: 1427 GTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRG 1486
               T   G+   SA L V  T ++    L+D+ AEE   +  EV     G +   +W++ 
Sbjct: 2903 AEYTFVCGNDQVSATLTV--TPIMITSMLKDINAEEKDTITFEVTVNYEGIS--YKWLKN 2958

Query: 1487 GQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPL 1546
            G  +    +  M      H L I  V   D   Y   +    + A L V  R +   + +
Sbjct: 2959 GVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHI 3018

Query: 1547 EDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADS 1606
            +D+ + E   A F+ E+S+  +T +W +   +L    +  I  + + HRL++    ++D+
Sbjct: 3019 KDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDA 3078

Query: 1607 GCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGN 1666
            G  +  A      A+L V    V I     +++V E   A  E E+++   D  W KDG 
Sbjct: 3079 GKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGI 3138

Query: 1667 ALTPSPRLRLQALGTRRL--LQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSE 1724
             +    + R + +  RR+  + +     SDAG Y+   G  R+             VL E
Sbjct: 3139 EINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQE 3198

Query: 1725 LRSVSAREGDGATFECTVS-EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE 1783
            L+ V+ + G  A F   +S   +    W    + L  G + +   +G+++ L+L E   E
Sbjct: 3199 LQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPE 3258

Query: 1784 DAG----EVRFQAGPAQSLALLEVEALPL-----QMCRHPPREKTVLV------GRRAVL 1828
            DA     E +   G A + A L VE   +     +M  +PP   T L       G+ A  
Sbjct: 3259 DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF 3318

Query: 1829 EVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA----GQ 1884
            +  VS +   V W  +  ++ P   + M     T+ L I +  PED+GTY   A    GQ
Sbjct: 3319 QCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3378

Query: 1885 DSTHTRLLVE 1894
             S+   L +E
Sbjct: 3379 VSSTANLSLE 3388



 Score =  254 bits (649), Expect = 6e-67
 Identities = 394/1834 (21%), Positives = 682/1834 (37%), Gaps = 213/1834 (11%)

Query: 127  APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
            AP      +SQ V +G++     R  G P+P   W K+G+ ++       +   P   ED
Sbjct: 2031 APKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIER--SDRIYWYWP---ED 2085

Query: 187  GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
                 L +R + A   DS   +  A N  G   + A L V                 ++ 
Sbjct: 2086 NV-CELVIRDVTAE--DSASIMVKAINIAGETSSHAFLLVQAKQ-------------LIT 2129

Query: 247  PLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKV 306
              +         +   A F C    +P  +++W+ +G  +    +  M+ DR   F L +
Sbjct: 2130 FTQELQDVVAKEKDTMATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF-LSI 2187

Query: 307  LYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
            L     D   Y C          +A +L V+   + F + LQD+E  E     LEC V  
Sbjct: 2188 LTIDTSDAEDYSCVLVEDENVKTTA-KLIVEGAVVEFVKELQDIEVPESYSGELECIVSP 2246

Query: 367  SRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTV 426
              I   W+  D  L    KY        + L +  +  +D G Y   + G+  T      
Sbjct: 2247 ENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCK---- 2302

Query: 427  KGPILKRLPRKLDVL---------EGENAVLLVETLEAGVEGRWSRDGEELP------VI 471
                LK  PR + +L         EG+   L V+     VEG W +DG+E+       ++
Sbjct: 2303 ----LKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIV 2358

Query: 472  CQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHK 531
                S   H L++  +T+EDAG  +F++     +T  RV         P     + +G K
Sbjct: 2359 IDKQS---HMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTK 2415

Query: 532  NTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFR 591
              +      P+    T   + L  +++  +D +Q         + +       EG Y+  
Sbjct: 2416 AVLECKVSVPDV---TSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLI 2472

Query: 592  ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
            +  V  +              V   +++ GL D+   + ++ VF ++LS         +G
Sbjct: 2473 VGRVETNCNLS----------VEKIKIIRGLRDLTCTETQNVVFEVELSH--------SG 2514

Query: 652  EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQ 711
             ++  N  + +++P + +Y+IE  G  ++L +  +   D G    ++   +  S  LT+ 
Sbjct: 2515 IDVLWNFKDKEIKPSS-KYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMT-SGKLTVA 2572

Query: 712  ESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKH 771
               +     +     T   S+  V  CE++  D    W +DG+ +  +  +  + DG K 
Sbjct: 2573 GGAIS----KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKR 2628

Query: 772  RLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVH-------IVDPREHVFVHAITSEC 824
            RLI+   K+ D GE+  +         + V+   +        + + ++ VF   +T   
Sbjct: 2629 RLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPN 2688

Query: 825  VMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDE 884
            V            V+W K+G  +E ++   +  +G    L +            C   DE
Sbjct: 2689 VK----------GVQWIKNGVVLESNEKYAISVKGTIYSLRIK----------NCAIVDE 2728

Query: 885  CAY-FTVTITDVSSWIVYPSGKVY-----VAAVRLERVVLTCELCRPWAEVRWTKDGEEV 938
              Y F +     S+ +   + K+      V A+    V     +      V+W     E+
Sbjct: 2729 SVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEI 2788

Query: 939  VESPALLLQKEDTVRRLVLPAVQLEDSGEYLC---EIDDESASF--TVTVTEPPVRIIYP 993
              S    L  E  V +L+L  +   D+GEY     +++ ++  F  T+ +T+    I  P
Sbjct: 2789 KPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVP 2848

Query: 994  RDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQP 1053
              +              CE+S  + P  W K+G+E+E SE   +   G   +L++     
Sbjct: 2849 ETKTASFE---------CEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTST 2899

Query: 1054 EDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVR 1113
            ED  E+    G+D    T+TVT      +   +   D++      +     V   G   +
Sbjct: 2900 EDSAEYTFVCGNDQVSATLTVTP-----IMITSMLKDINAEEKDTITFEVTVNYEGISYK 2954

Query: 1114 WYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQF 1173
            W K+G+E++++D  Q+  +  T +L + +    DA +Y         T  + +    ++F
Sbjct: 2955 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3014

Query: 1174 LALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQ 1233
                     + V   +  +  CE+S     V W  + + +Q  + +++  E     L I 
Sbjct: 3015 ---RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP 3071

Query: 1234 AAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHL 1293
            +   + AG YT  +G       L   V+  +  +R +  E    +V       +E  V+ 
Sbjct: 3072 STRMSDAGKYTVVAGGNVSTAKLF--VEGRDVRIRSIKKEV---QVIEKQRAVVEFEVNE 3126

Query: 1294 SGPGGPVRWYKDGERLASQGRVQLEQAGARQVLR--VQGARSGDAGEYLCDAPQDSRIFL 1351
                    WYKDG  +  Q + + +    R++ R  +   R  DAGEY   A ++     
Sbjct: 3127 DDVDA--HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVT 3184

Query: 1352 VSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSP-PDADVTWLRNGAVVTPGPQVEMAQN 1410
            + V  P   +++ EL P+TV  G  A F   +S  P   ++W +   +++ G + +   +
Sbjct: 3185 LYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHD 3244

Query: 1411 GSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELL------------FLRR 1454
            G    L L      DA   T  A    G   TSA L V   E++             +  
Sbjct: 3245 GQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITP 3304

Query: 1455 LQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVIL 1514
            LQD    EGQ    +      G    V W    + +       M Q    ++L I     
Sbjct: 3305 LQDTVTSEGQPARFQCRVS--GTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYP 3362

Query: 1515 ADQGTYGCESHHD----RTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQE---- 1566
             D+GTY   + +      + A LS+  + L      +DV  S    A      ++E    
Sbjct: 3363 EDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSSFTKEESKI 3422

Query: 1567 ------GVTGEWARGGVQLYPG-PKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCA 1619
                     G      VQ++    +  IH+        +    L  +  +S  A+S   +
Sbjct: 3423 SQKEIKSFQGSSYEYEVQVFESVSQSSIHTAAS-----VQDTQLCHTASLSQIAESTELS 3477

Query: 1620 ---ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQ-ALADVTWEKDGNALTPSPRLR 1675
               A+    E P   +    D+ V  GDTA F C L   +  DVTW  +G  +  S RL+
Sbjct: 3478 KECAKESTGEAPKIFLH-LQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLK 3536

Query: 1676 LQALGTRRLLQLRRCGPSDAGTYSCAVGT---ARAGPVRLTVRERTVAVLSELRSVSARE 1732
                G  + L +      D G YSC V      R     L+V     ++L E R     E
Sbjct: 3537 QSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESILHE-RIEQEIE 3595

Query: 1733 GDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA 1792
             +   F  +    E  G      +  +    + +  E   +    ++  +E  G      
Sbjct: 3596 MEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYP---TKFDSEKEG-----T 3647

Query: 1793 GPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTV-SRSGGHVCWLREGAELCPG 1851
            GP   + + EV    + M            G  A L VTV       + W   G  L P 
Sbjct: 3648 GP---IFIKEVSNADISM------------GDVATLSVTVIGIPKPKIQWFFNGVLLTPS 3692

Query: 1852 DKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQD 1885
              Y+    G  HSL+I   + ED+G Y C A  D
Sbjct: 3693 ADYKFVFDGDDHSLIILFTKLEDEGEYTCMASND 3726



 Score =  223 bits (568), Expect = 1e-57
 Identities = 293/1337 (21%), Positives = 521/1337 (38%), Gaps = 127/1337 (9%)

Query: 618  LVAGLEDVQVYDGEDAVFSLDLST-IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKG 676
            ++ GL D +V +G+     + +S   ++G W  +G+E++ ++          R  I    
Sbjct: 2312 ILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSD----------RVHIVIDK 2361

Query: 677  LQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVL 736
              H L++  +  +D+G    F+ P +  S +  +    V +++P   V++   T  + VL
Sbjct: 2362 QSHMLLIEDMTKEDAGNY-SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT--KAVL 2418

Query: 737  TCELSRVDFPAT-WYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSA 795
             C++S  D  +  WY + ++++  + +   + G K RL++      D G ++     V  
Sbjct: 2419 ECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVET 2478

Query: 796  FFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVL 855
               ++V+   + I   R+   +    ++ V+   E+      V W    +E++ S    +
Sbjct: 2479 NCNLSVEKIKI-IRGLRD---LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2534

Query: 856  ENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLER 915
            E  G   +L +      D G++   AG+      +T+   +  I  P     VA    + 
Sbjct: 2535 EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGA--ISKPLTDQTVA--ESQE 2590

Query: 916  VVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE 975
             V  CE+  P ++  W +DG+ +  +  +  + +   RRL++ A +L+D GEY  ++   
Sbjct: 2591 AVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATS 2650

Query: 976  SASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDGLEVEESEA 1034
              S  + V    ++    +    L     +  V   EL+  +   V+W K+G+ +E +E 
Sbjct: 2651 KTSAKLKVEAVKIK----KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEK 2706

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFG 1094
              +   G    L +      D   +    G   A   + V       V    +  D+   
Sbjct: 2707 YAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVET-----VKIIKKPKDVTAL 2761

Query: 1095 APGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCE 1154
                V     V+     V+W+   +E++ SD  +L +E     L L +  P DAGEY   
Sbjct: 2762 ENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAV 2821

Query: 1155 TRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQ 1214
                     +      V+ L +  T   + V   +     CE+S    P +W  NG  ++
Sbjct: 2822 VGQLECKAKLF-----VETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIE 2876

Query: 1215 EGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEA 1274
              E  ++  +G    L I       +  YT   G    + +L+ T  +    ++ +  E 
Sbjct: 2877 MSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEE 2936

Query: 1275 AQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSG 1334
              T         +   V ++  G   +W K+G  + S  + Q+        L ++    G
Sbjct: 2937 KDT---------ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFG 2987

Query: 1335 DAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLR 1394
            DA +Y   A + +    + VE    ++    +  + V E   A F CEVS PD  V W++
Sbjct: 2988 DAADYTFVAGKATSTATLYVEARH-IEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMK 3046

Query: 1395 NGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRR 1454
            +   +    ++++ +      L +   ++ DAG  T+ AG   ++A+L V   ++     
Sbjct: 3047 DDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSI 3106

Query: 1455 LQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHD--SRLSMAQDGHIHRLFIHGV 1512
             ++V+  E Q   +E E           W + G  +      R     +  IHR+FI   
Sbjct: 3107 KKEVQVIEKQRAVVEFEVNEDDVDA--HWYKDGIEINFQVQERHKYVVERRIHRMFISET 3164

Query: 1513 ILADQGTYGCESHHDRTLARLSVR-PRQLRVLRPLEDVTISEGGSATFQLELSQEGVTG- 1570
              +D G Y   +  +R+   L V  P   +VL+ L+ VT+  G  A F   +S       
Sbjct: 3165 RQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKI 3224

Query: 1571 EWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGC----------VSFTADSLRCAA 1620
             W +    L  G KC    DG  + L+L      D+            V+ T+ SL    
Sbjct: 3225 SWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV 3284

Query: 1621 RLIV---REVPV---TIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRL 1674
              +V   +E+PV    I+    D   +EG  A F+C +S     V+W      + PS   
Sbjct: 3285 PEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFF 3344

Query: 1675 RLQALGTRRLLQLRRCGPSDAGTY----SCAVGTARAGP-----------------VRLT 1713
            R+        L++    P D GTY    S AVG   +                   VR +
Sbjct: 3345 RMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDVRES 3404

Query: 1714 VRERTVAVLS---ELRSVSARE---GDGATFECTVSEVETTGRWELGGRPLRPGARVRIR 1767
             + + VA  S   E   +S +E     G+++E  V   E+  +       +   A V+  
Sbjct: 3405 AKSQAVADSSFTKEESKISQKEIKSFQGSSYEYEVQVFESVSQ-----SSIHTAASVQDT 3459

Query: 1768 Q----EGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVG 1823
            Q         I   +EL  E A E   +A P   L L +V               TV  G
Sbjct: 3460 QLCHTASLSQIAESTELSKECAKESTGEA-PKIFLHLQDV---------------TVKCG 3503

Query: 1824 RRA-VLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC-- 1880
              A  L V    S   V W  EGA++   ++ +   +G    L I +V+  DQG Y C  
Sbjct: 3504 DTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIV 3563

Query: 1881 --QAGQDSTHTRLLVEG 1895
                G+ +T   L VEG
Sbjct: 3564 HNDCGERTTSAVLSVEG 3580



 Score =  212 bits (540), Expect = 2e-54
 Identities = 423/1972 (21%), Positives = 721/1972 (36%), Gaps = 258/1972 (13%)

Query: 23   VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF--PADGAEHGLLLTAALPTDAG 80
            V  G++A  +  V+G+P P   W K G ++  S+R+ +  P D     L++      D+ 
Sbjct: 2043 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCE-LVIRDVTAEDSA 2101

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL 140
              + +A N AGE  + A + V                           +  T      V 
Sbjct: 2102 SIMVKAINIAGETSSHAFLLVQAKQL----------------------ITFTQELQDVVA 2139

Query: 141  RGAEVVLT--CRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILA 198
            +  + + T  C     P   + W KDGM   EV +   + +   R          L IL 
Sbjct: 2140 KEKDTMATFECETSE-PFVKVKWYKDGM---EVHEGDKYRMHSDRKVH------FLSILT 2189

Query: 199  ARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVN 258
                D+  Y C             L++      +     + A    V+ L+       V 
Sbjct: 2190 IDTSDAEDYSC------------VLVEDENVKTTAKLIVEGAVVEFVKELQ----DIEVP 2233

Query: 259  EGKHAKFRCYVMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLY 317
            E    +  C V   PE  IE  W    + L    +     R G   L V     +D+G Y
Sbjct: 2234 ESYSGELECIV--SPE-NIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2290

Query: 318  VCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFRED 377
                        +  +L +K   +   + L D +  E  I  LE KV    +   W ++ 
Sbjct: 2291 SFVIDGKK----TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDG 2346

Query: 378  QRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEM-------RGRVRTVANVTVKGPI 430
            Q + P  +   + +     L+I  +  +D G Y   +        GRV +V +V V  P+
Sbjct: 2347 QEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV-SVYSVDVITPL 2405

Query: 431  LKRLPRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPV---ICQSSSGHMHALVLPG 486
                 + ++V+EG  AVL  +     V   +W  + E++     +     G    LV+  
Sbjct: 2406 -----KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINR 2460

Query: 487  VTREDAGEVTFSLGNSRTTTLLRVKCVK--------HSPPGPPILAEMFKGHKNT-VLLT 537
                D G     +G   T   L V+ +K               ++ E+   H    VL  
Sbjct: 2461 THASDEGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWN 2520

Query: 538  WKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSG 597
            +K  E  P +   Y++E              I K   + +  D    EG Y F       
Sbjct: 2521 FKDKEIKPSSK--YKIEAHG----------KIYKLTVLNMMKD---DEGKYTFYAGENMT 2565

Query: 598  HGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKS 656
             G+   +   G A   P       L D  V + ++AVF  +++    +G W  +G+ L  
Sbjct: 2566 SGK---LTVAGGAISKP-------LTDQTVAESQEAVFECEVANPDSKGEWLRDGKHL-- 2613

Query: 657  NEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVH 716
                    P     R E  G + RLI+ A K  D G    +     + SA L ++   + 
Sbjct: 2614 --------PLTNNIRSESDGHKRRLIIAATKLDDIGEYT-YKVATSKTSAKLKVEAVKIK 2664

Query: 717  ILSPQDRVSLTFTTSERVVLTCELSRVDFPAT-WYKDGQKVEESELLVVKMDGRKHRLIL 775
                +   +LT T ++  V T EL+  +     W K+G  +E +E   + + G  + L +
Sbjct: 2665 ----KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRI 2720

Query: 776  PEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDRED 835
                + D   +  R   + A   + V+   + I  P++   V A+ +  V     V  + 
Sbjct: 2721 KNCAIVDESVYGFRLGRLGASARLHVETVKI-IKKPKD---VTALENATVAFEVSVSHDT 2776

Query: 836  APVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGD-ECA----YFTV 890
             PV+W+    E++ SD   L +E    +L+L    PSD GE+  V G  EC       T+
Sbjct: 2777 VPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETL 2836

Query: 891  TITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKED 950
             IT     I  P  K              CE+        W K+G E+  S    +  + 
Sbjct: 2837 HITKTMKNIEVPETKT---------ASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQG 2887

Query: 951  TVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLM 1010
             + +L++     EDS EY     ++  S T+TVT  P+ I     ++   A   + +   
Sbjct: 2888 KLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT--PIMITSMLKDIN--AEEKDTITFE 2943

Query: 1011 CELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFF 1070
              ++ E    +W K+G+E++ ++   +        L +      D  ++   AG  ++  
Sbjct: 2944 VTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTA 3003

Query: 1071 TVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLG 1130
            T+ V A   R +       D+      R    CEV+     V+W KD  E++ +D +++ 
Sbjct: 3004 TLYVEA---RHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQ 3060

Query: 1131 AEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEP 1190
             E     L +P  +  DAG+Y         T  + +    V+  +++     + V   + 
Sbjct: 3061 KEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIK---KEVQVIEKQR 3117

Query: 1191 VVLSCELSRAGAPVVWSHNGRPV--QEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSG 1248
             V+  E++       W  +G  +  Q  E  +   E     + I     + AG YT  +G
Sbjct: 3118 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3177

Query: 1249 AAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGE 1307
                  S++  V   EPP   V  E     V+S  G        +SG P   + WYK+ +
Sbjct: 3178 R--NRSSVTLYVNAPEPPQ--VLQELQPVTVQS--GKPARFCAVISGRPQPKISWYKEEQ 3231

Query: 1308 RLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFL----VSVEEPLLVKLV 1363
             L++  + +    G    L +  A   DA  Y C+A  D  +      +SVE P +V   
Sbjct: 3232 LLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPD 3291

Query: 1364 SEL--------TPL---TVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGS 1412
             E+        TPL      EG  A F+C VS  D  V+W      + P     M Q   
Sbjct: 3292 QEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFED 3351

Query: 1413 SRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELLFLRRLQDVRAEEGQDVCL 1468
            +  L +      D GT T  A    G  +++A L +    L      +DVR         
Sbjct: 3352 TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVA 3411

Query: 1469 EVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDR 1528
            +    +  +  + + ++  Q   ++  + + +   + +  IH    + Q T  C +    
Sbjct: 3412 DSSFTKEESKISQKEIKSFQGSSYEYEVQVFES--VSQSSIH-TAASVQDTQLCHTASLS 3468

Query: 1529 TLARLSVRPRQL---------RVLRPLEDVTISEGGSATFQLELSQEG-VTGEWARGGVQ 1578
             +A  +   ++          ++   L+DVT+  G +A F   L  +  +   W   G +
Sbjct: 3469 QIAESTELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAK 3528

Query: 1579 LYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDL 1638
            +    +     +G+   L +  + L D G  S    +  C  R       V  V G  + 
Sbjct: 3529 IEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHN-DCGERTTSA---VLSVEGAPES 3584

Query: 1639 EVTEGDTATFECELSQALAD-VTWEKDGNALTPSPRLRLQALG-TRRLLQLRRCGPSDAG 1696
             + E      E E+ +  +  ++ E++G     S  L+L  +  T  LL       S++ 
Sbjct: 3585 ILHERIEQEIEMEMKEFSSSFLSAEEEG---LHSAELQLSKINETLELL-------SESP 3634

Query: 1697 TYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RWELGG 1755
             Y     + + G   + ++E + A +S         GD AT   TV  +     +W   G
Sbjct: 3635 VYPTKFDSEKEGTGPIFIKEVSNADISM--------GDVATLSVTVIGIPKPKIQWFFNG 3686

Query: 1756 RPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAG---------------------- 1793
              L P A  +   +G  H L++   + ED GE    A                       
Sbjct: 3687 VLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHK 3746

Query: 1794 --PAQSLALLEVEALPLQMCRHPPREKTVL---VGRRAVLEVTV-SRSGGHVCWLREGAE 1847
                +S     +E L      H  +E   +    G  A+ E TV       V W +E  +
Sbjct: 3747 DTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQ 3806

Query: 1848 LCPGDKYEMRSHGPTHS--LVIHDVRPEDQGTYCCQA----GQDSTHTRLLV 1893
            LC    Y +  H P  S   +++D + ED G Y C+A    G+ +    LLV
Sbjct: 3807 LCTSVYYTI-IHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score =  212 bits (539), Expect = 3e-54
 Identities = 217/957 (22%), Positives = 410/957 (42%), Gaps = 63/957 (6%)

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
            K   V  G+ A F C +  +  P +EW+ +G+ L P  + ++ R       L +   + +
Sbjct: 5898 KDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDK-VVPRSEGKVHTLTLRDVKLE 5955

Query: 313  DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA 372
            D G     A++      +   L VKEP + FT+PL+D    E   AVLEC+V        
Sbjct: 5956 DAGEVQLTAKDFK----THANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVK 6011

Query: 373  WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILK 432
            WF+    +L  +KYE + +G VR+L+IH    +D   Y C+ +   +T  N+ V  P ++
Sbjct: 6012 WFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD-FKTSCNLNVVPPHVE 6070

Query: 433  --RLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SSSGHMHALVLPGV 487
              R    L V E E A    E      + +W +DG E+    +    S G +  LV+   
Sbjct: 6071 FLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKC 6130

Query: 488  TREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPET 547
              +D  E +  +  +RT+ +L V  ++        LA +     +T+ L  +  +P  E 
Sbjct: 6131 LLDDEAEYSCEVRTARTSGMLTV--LEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEV 6188

Query: 548  PFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFH 607
              I+    +E+      +  +  +   + +    +   G+Y  R+ +    G+   V  H
Sbjct: 6189 --IWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGK---VKVH 6243

Query: 608  GSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLS-TIIQGTWFLNGEELKSNEPEGQVEPG 666
              A     A  ++  +++++ +GE A F   +S       W  + + L+S +        
Sbjct: 6244 ELA-----AEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGD-------- 6290

Query: 667  ALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSL 726
              +Y +   G +  L++     QD G  V       + +A LT+ E    ++  +D    
Sbjct: 6291 --KYDVIADGKKRVLVVKDATLQDMGTYV-VMVGAARAAAHLTVIEKLRIVVPLKD---T 6344

Query: 727  TFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEF 786
                 + VV  CE++     A W+++ + + +S   ++      + L + +A + D   +
Sbjct: 6345 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6404

Query: 787  EC-----RTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWY 841
                   R E V +   + V++  + IV+P +   +  +  + V   C+V+R +  ++W 
Sbjct: 6405 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKD--IETMEKKSVTFWCKVNRLNVTLKWT 6462

Query: 842  KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
            K+G+EV   + V    +     L +      D GE+   AG + +   + I +  +  V 
Sbjct: 6463 KNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 6522

Query: 902  PSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQ 961
                  V     +  V +C+L R  A V+W ++G E+ E      +K+ ++ RL++   +
Sbjct: 6523 HLEDQTV--TEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCR 6580

Query: 962  LEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVR 1021
            L+D  EY C ++D  +   + V E PV II P  ++  +      VV + EL+++   V+
Sbjct: 6581 LDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDI--LEAPGADVVFLAELNKDKVEVQ 6638

Query: 1022 WYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERI 1081
            W ++ + V + +   +  +G   RL +   +P D GE+   A D  A   + + A P+  
Sbjct: 6639 WLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPK-- 6696

Query: 1082 VHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLP 1141
            +  A + L +  G P  + +  +  P  ++  W+K   E E      +       +  + 
Sbjct: 6697 IKTADQDLVVDVGKPLTMVVPYDAYPK-AEAEWFK---ENEPLSTKTIDTTAEQTSFRIL 6752

Query: 1142 HAQPEDAGEY--VCETRHEA----ITFNVILAEPPVQFLAL-ETTPSPLCVAPGEPV 1191
             A+  D G Y  V + +H      I   VI    PV+ L + ET    + +A  EP+
Sbjct: 6753 EAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPL 6809



 Score =  202 bits (514), Expect = 3e-51
 Identities = 155/558 (27%), Positives = 257/558 (46%), Gaps = 27/558 (4%)

Query: 1353 SVEEPLLVKLVSELTPLTVHEGDDATFRCEV-SPPDADVTWLRNGAVVTPGPQVEMAQNG 1411
            S+E P   K+   +   TV +G DA FR  V   PD +  W +NG  +    ++      
Sbjct: 2028 SMEAP---KIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPE 2084

Query: 1412 SSRI-LTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELL-FLRRLQDVRAEEGQD 1465
             +   L +R     D+ ++ ++A    G T++ A L V+  +L+ F + LQDV A+E   
Sbjct: 2085 DNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2144

Query: 1466 VC-LEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGC-- 1522
            +   E ET        V+W + G  +    +  M  D  +H L I  +  +D   Y C  
Sbjct: 2145 MATFECETSEPFVK--VKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL 2202

Query: 1523 -ESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYP 1581
             E  + +T A+L V    +  ++ L+D+ + E  S   +  +S E + G+W    V+L  
Sbjct: 2203 VEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKS 2262

Query: 1582 GPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVT 1641
              K  I S   R  L +  +   D G  SF  D  +   +L ++  P+ I++G  D +V 
Sbjct: 2263 NGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVC 2322

Query: 1642 EGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC- 1700
            EGD    E ++S    +  W KDG  + PS R+ +       +L +      DAG YS  
Sbjct: 2323 EGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFT 2382

Query: 1701 --AVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RWELGGRP 1757
              A+G + +G V +     +V V++ L+ V+  EG  A  EC VS  + T  +W L    
Sbjct: 2383 IPALGLSTSGRVSV----YSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQ 2438

Query: 1758 LRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPRE 1817
            ++P  RV+   +G K  LV++   A D G  +   G  ++   L VE + +       R+
Sbjct: 2439 IKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKI---IRGLRD 2495

Query: 1818 KTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGT 1877
             T    +  V EV +S SG  V W  +  E+ P  KY++ +HG  + L + ++  +D+G 
Sbjct: 2496 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2555

Query: 1878 YCCQAGQDSTHTRLLVEG 1895
            Y   AG++ T  +L V G
Sbjct: 2556 YTFYAGENMTSGKLTVAG 2573



 Score =  189 bits (480), Expect = 2e-47
 Identities = 271/1226 (22%), Positives = 469/1226 (38%), Gaps = 182/1226 (14%)

Query: 15   LRFPRPVRVVSGAEAE--LKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLT 72
            L+F  P++ V+  E E  +  V L      V W K  Q+L  +  +S   +G  H +   
Sbjct: 5624 LKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFK 5683

Query: 73   AALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLT 132
                 D       A   + EA     +TVLE                      G P F  
Sbjct: 5684 DLSIDDTSQIRVEAMGMSSEA----KLTVLE----------------------GDPYFTG 5717

Query: 133  GPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASL 192
              +    +   EV+L C       P + W KDG    E+  S +  ++     DG    L
Sbjct: 5718 KLQDYTGVEKDEVILQCEISKADAP-VKWFKDGK---EIKPSKNAVIKA----DGKKRML 5769

Query: 193  ALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAP 252
             L+   A   D G Y C                      S   D ++    +V PL    
Sbjct: 5770 ILK--KALKSDIGQYTCDCGT---------------DKTSGKLDIEDREIKLVRPLHSVE 5812

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
                V E + A+F   +    E +I  +W+ +               G  +L+   C+ K
Sbjct: 5813 ----VMETETARFETEIS---EDDIHANWKLK---------------GEALLQTPDCEIK 5850

Query: 313  DRG------LYVCAARNSAG------QTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL 360
            + G      L+ C    + G         S+  L VK   +   RPL+DV       A  
Sbjct: 5851 EEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATF 5910

Query: 361  ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT 420
            +C++    IP  W+ + ++L P  K     EG V  L +  +K +D G      +   +T
Sbjct: 5911 DCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD-FKT 5969

Query: 421  VANVTVKGPILKRLPRKLD--VLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SS 475
             AN+ VK P ++      D  V EG  AVL  E      + +W ++G E+    +    +
Sbjct: 5970 HANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVA 6029

Query: 476  SGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVL 535
             G +  LV+   T ED    T    + +T+  L V      PP    L  +         
Sbjct: 6030 DGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNV-----VPPHVEFLRPLTD------- 6077

Query: 536  LTWKPPEPAPETPFIYRLERQEVGSEDWIQC-----FSIEKAGAVE--VPGDC-VPSEGD 587
            L  +  E A     + R   +    +D  +      + I   GAV   V   C +  E +
Sbjct: 6078 LQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAE 6137

Query: 588  YRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGT 646
            Y   + T    G            L   A     L +++V + +      ++S    +  
Sbjct: 6138 YSCEVRTARTSGM--------LTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVI 6189

Query: 647  WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSC--PGVQD 704
            W+   EE+        +E G  RY I  +G +  L++     +D+G    ++C  P  + 
Sbjct: 6190 WYKGDEEI--------IETG--RYEILTEGRKRILVIQNAHLEDAG---NYNCRLPSSRT 6236

Query: 705  SAALTIQESPVHILS-PQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLV 763
               + + E     +S PQ   +L     E+    C +S+  FP  W +D + +E  +   
Sbjct: 6237 DGKVKVHELAAEFISKPQ---NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYD 6293

Query: 764  VKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSE 823
            V  DG+K  L++ +A +QD G +        A   +TV +  + IV P +   V     +
Sbjct: 6294 VIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVK--EQQ 6350

Query: 824  CVMLACEVDREDAPVRWYKDGQEV-EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAG 882
             V+  CEV+ E A  +W+++ + + + S +++L+ +  +   +  A              
Sbjct: 6351 EVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHL------------ 6398

Query: 883  DECAYFTVTITDVSSWIVYPSGKVYV--------------AAVRLERVVLTCELCRPWAE 928
            D+ A + V++T+     V  +  + V                +  + V   C++ R    
Sbjct: 6399 DDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVT 6458

Query: 929  VRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPV 988
            ++WTK+GEEV     +  + +     L +      D GEY+     + +   + + E P 
Sbjct: 6459 LKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPT 6518

Query: 989  RIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVL 1048
              +   ++ T+     +  V  C+LSRE A V+WY++G E++E +    E+DG   RL++
Sbjct: 6519 EFVEHLEDQTV--TEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLII 6576

Query: 1049 PAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGR-VELRCEVAP 1107
               + +D  E+ C   D  +   + V   P  I+ P    L+    APG  V    E+  
Sbjct: 6577 KDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILE----APGADVVFLAELNK 6632

Query: 1108 AGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILA 1167
               +V+W ++ + V   D  Q+ +EG    L +   +P D GEY    + +     + LA
Sbjct: 6633 DKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA 6692

Query: 1168 EPPVQFLALETTPSPLCVAPGEPVVL 1193
              P     ++T    L V  G+P+ +
Sbjct: 6693 AAP----KIKTADQDLVVDVGKPLTM 6714



 Score =  116 bits (290), Expect = 2e-25
 Identities = 219/1074 (20%), Positives = 389/1074 (36%), Gaps = 173/1074 (16%)

Query: 840  WYKDGQEV--EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSS 897
            W+ DGQ++  + +  VV++ +G    +++PAT PSD GE+  VA +     ++++     
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPAT-PSDSGEWTVVAQNRAGRSSISVILTVE 1502

Query: 898  WIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVL 957
             + +    ++V  ++   +    E  R   +VR T +    +    + L+  D +     
Sbjct: 1503 AVEHQVKPMFVEKLKNVNIK---EGSRLEMKVRATGNPNPDI----VWLKNSDIIVPHKY 1555

Query: 958  PAVQLEDS-GEYLCEID----DESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCE 1012
            P +++E + GE   +ID     +SA +T T      R      + T   V +E       
Sbjct: 1556 PKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR------DTTRCKVNVEV------ 1603

Query: 1013 LSREDAPVRWYKDGLEVEESEALVLERDGPRCR-LVLPAAQP---------EDGGEFVCD 1062
                        +  E E    L++ R   R + +  P  +P          + G+    
Sbjct: 1604 ------------EFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDK 1651

Query: 1063 AGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQ---VRWYKDGL 1119
                  FF   +T+   +   PA      HF         C + P G     V W  DG 
Sbjct: 1652 EKQQKPFFKKKLTSLRLKRFGPA------HF--------ECRLTPIGDPTMVVEWLHDGK 1697

Query: 1120 EVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETT 1179
             +EA++ L++  E    +L    A   D+G   C   ++  T               + T
Sbjct: 1698 PLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGT---------------DHT 1742

Query: 1180 PSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAH 1239
             + L V   + +V   +L            GR     +GL+   E  R          AH
Sbjct: 1743 SATLIVKDEKSLVEESQLP----------EGR-----KGLQRIEELERM---------AH 1778

Query: 1240 AGLYTCQSGAAPGAPSLSFTVQVAEP-PVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGG 1298
             G  T   G             V  P PVRV+  E A+ R R T             P  
Sbjct: 1779 EGALT---GVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVT-----------GYPQP 1824

Query: 1299 PVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPL 1358
             V WY +G+ +    R ++   G    L +   +S D GE             V+ E P 
Sbjct: 1825 KVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGE-----------VKVTAENP- 1871

Query: 1359 LVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTL 1418
               ++     L + + +D       +P               P P+  + + G  +    
Sbjct: 1872 -EGVIEHKVKLEIQQREDFRSVLRRAP--------------EPRPEFHVHEPGKLQF--- 1913

Query: 1419 RGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAA 1478
                  +   V     +T T   + ++  E +   ++ +   E         E G   A 
Sbjct: 1914 ------EVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAI 1967

Query: 1479 GAVRWVRGGQPLPHDSRLSMAQDGHIH----RLFIHGVILADQGTYGCESHHDRTLARLS 1534
             AV      +   ++  L   +D  +H            LA++G     +     +  LS
Sbjct: 1968 TAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKI-ELS 2026

Query: 1535 VRPRQLRVLRPLEDVTISEGGSATFQLE-LSQEGVTGEWARGGVQLYPGPKCHIH-SDGH 1592
                  ++   ++  T+ +G  A F++  + +     EW + GV++    + + +  + +
Sbjct: 2027 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2086

Query: 1593 RHRLVLNGLGLADSG-----CVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDT-A 1646
               LV+  +   DS       ++   ++   A  L+  +  +T  +   D+   E DT A
Sbjct: 2087 VCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMA 2146

Query: 1647 TFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTAR 1706
            TFECE S+    V W KDG  +    + R+ +      L +     SDA  YSC +    
Sbjct: 2147 TFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE 2206

Query: 1707 --AGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARV 1764
                  +L V    V  + EL+ +   E      EC VS     G+W      L+   + 
Sbjct: 2207 NVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKY 2266

Query: 1765 RIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGR 1824
             I     +  L + ++  ED GE  F     ++   L+++  P+ + +    +K V  G 
Sbjct: 2267 TITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQK-VCEGD 2325

Query: 1825 RAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTY 1878
               LEV VS       W+++G E+ P D+  +     +H L+I D+  ED G Y
Sbjct: 2326 IVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379



 Score =  100 bits (249), Expect = 1e-20
 Identities = 121/498 (24%), Positives = 198/498 (39%), Gaps = 82/498 (16%)

Query: 14   FLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTA 73
            F+  P+ + ++ G +AE  C +  E  PV  W++  + L + ++    ADG +  L++  
Sbjct: 6249 FISKPQNLEILEGEKAEFVCSISKESFPVQ-WKRDDKTLESGDKYDVIADGKKRVLVVKD 6307

Query: 74   ALPTDAGVYVCRARNAAGEAYAAAAVTVLEP-----PASDPELQPAERPLPSPGSGEGAP 128
            A   D G YV       G A AAA +TV+E      P  D  ++  +             
Sbjct: 6308 ATLQDMGTYVV----MVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQ------------- 6350

Query: 129  VFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP 188
                           EVV  C          ++  +    + ++DSS + +         
Sbjct: 6351 ---------------EVVFNCEVNTEGAKAKWFRNE----EAIFDSSKYIILQ------K 6385

Query: 189  GASLALRILAARLPDSGVYVCHARNAHG-HAQAGALLQVHQPPESPPADPDEAPAPVVEP 247
                 LRI  A L D   Y     N  G + ++ A L V           +E    +VEP
Sbjct: 6386 DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV-----------EEEDLRIVEP 6434

Query: 248  LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVL 307
            L    K     E K   F C V  +    ++W   G   +P   R+ YR      +L + 
Sbjct: 6435 L----KDIETMEKKSVTFWCKV-NRLNVTLKWTKNGEE-VPFDNRVSYRVDKYKHMLTIK 6488

Query: 308  YCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNS 367
             C   D G Y+     +AGQ  S  +L + E    F   L+D    E   AV  C++   
Sbjct: 6489 DCGFPDEGEYIV----TAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSRE 6544

Query: 368  RIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVK 427
            +    W+R  + +   +KY+  ++G++ RLII   + DD+  Y C +  R ++ A + V+
Sbjct: 6545 KANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDR-KSRARLFVE 6603

Query: 428  GPILKRLPRKLDVLE--GENAVLLVETLEAGVEGRWSRDGEELPVICQS------SSGHM 479
               ++ +    D+LE  G + V L E  +  VE +W R+     V+ Q       S G +
Sbjct: 6604 EIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNN---MVVVQGDKHQMMSEGKI 6660

Query: 480  HALVLPGVTREDAGEVTF 497
            H L +  +   D GE  F
Sbjct: 6661 HRLQICDIKPRDQGEYRF 6678



 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 118/534 (22%), Positives = 204/534 (38%), Gaps = 84/534 (15%)

Query: 14   FLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTA 73
            F +  + ++V+    A  +C V  EP   V W K  Q+L  ++R+    +   H LL+ +
Sbjct: 3014 FRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPS 3072

Query: 74   ALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTG 133
               +DAG Y       AG   + A + V                       EG  V +  
Sbjct: 3073 TRMSDAGKYTV----VAGGNVSTAKLFV-----------------------EGRDVRIRS 3105

Query: 134  PRSQ-WVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASL 192
             + +  V+     V+        +   +W KDG+ ++      H  +   R         
Sbjct: 3106 IKKEVQVIEKQRAVVEFEVNE-DDVDAHWYKDGIEINFQVQERHKYVVERRIH------- 3157

Query: 193  ALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAP 252
             + I   R  D+G Y   A    G  ++   L V+ P           P  V++ L+  P
Sbjct: 3158 RMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAP----------EPPQVLQELQ--P 3201

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
             T  V  GK A+F   + G+P+P+I W+ E   LL    +  +      + L ++    +
Sbjct: 3202 VT--VQSGKPARFCAVISGRPQPKISWYKE-EQLLSTGFKCKFLHDGQEYTLLLIEAFPE 3258

Query: 313  DRGLYVCAARNSAGQTLSAVQLHVKEPRL------------RFTRPLQDVEGREHGIAVL 360
            D  +Y C A+N  G   ++  L V+ P +                PLQD    E   A  
Sbjct: 3259 DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF 3318

Query: 361  ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIY---LCEMRGR 417
            +C+V  + +  +W+ +D+++ P R +   +     +L I     +D+G Y        G+
Sbjct: 3319 QCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3378

Query: 418  VRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSG 477
            V + AN++++   L R     DV E   +  + ++     E + S+  +E+    Q SS 
Sbjct: 3379 VSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSSFTKEESKISQ--KEIKSF-QGSSY 3435

Query: 478  HMHALVLPGVTRED---AGEV-------TFSLGNSRTTTLLRVKCVKHSPPGPP 521
                 V   V++     A  V       T SL     +T L  +C K S    P
Sbjct: 3436 EYEVQVFESVSQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGEAP 3489



 Score = 85.1 bits (209), Expect = 6e-16
 Identities = 98/389 (25%), Positives = 145/389 (37%), Gaps = 67/389 (17%)

Query: 2    KASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFP 61
            K S+G+  +P  FL   + V V  G  A+  CV+  +    V W   G ++  SERL   
Sbjct: 3482 KESTGE--APKIFLHL-QDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQS 3538

Query: 62   ADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP---------------- 105
             +G    L +      D G+Y C   N  GE   +A ++V   P                
Sbjct: 3539 QNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESILHERIEQEIEMEM 3598

Query: 106  ---------ASDPELQPAERPLP--------------------SPGSGEGAPVFLTGPRS 136
                     A +  L  AE  L                     S   G G P+F+    +
Sbjct: 3599 KEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFDSEKEGTG-PIFIKEVSN 3657

Query: 137  QWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRI 196
              +  G    L+    G+P+P + W  +G+ L    D            DG   SL   I
Sbjct: 3658 ADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVF-------DGDDHSLI--I 3708

Query: 197  LAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPES-PPADPDEAPAPVVEPL--KCAP- 252
            L  +L D G Y C A N +G     A L+++   E     + + A A  +E L   C P 
Sbjct: 3709 LFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPH 3768

Query: 253  -----KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVL 307
                 K     +G  A F   V+G+P P + W  E + L       +  + +G     V 
Sbjct: 3769 FLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVN 3828

Query: 308  YCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
              Q +D GLY+C A N  G++  A +L V
Sbjct: 3829 DPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 116/480 (24%), Positives = 188/480 (39%), Gaps = 54/480 (11%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
            PP  L+  +PV V SG  A    V+ G P P + W K  Q L+   +  F  DG E+ LL
Sbjct: 3192 PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLL 3251

Query: 71   LTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVF 130
            L  A P DA VY C A+N  G A  +A+++V  P    P+ +    P          P  
Sbjct: 3252 LIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP----------PAI 3301

Query: 131  LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGA 190
            +T  +      G      CR  G      ++ KD     ++  S  F +   + ED    
Sbjct: 3302 ITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKD----KKIKPSRFFRMT--QFED---- 3351

Query: 191  SLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLK- 249
            +  L I  A   D G Y   A NA G   + A L +    E    D   +   V E  K 
Sbjct: 3352 TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL----EVQALDRQSSGKDVRESAKS 3407

Query: 250  --CAPKTFWVNEGK--HAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLK 305
               A  +F   E K    + + +     E E++  +E             +D        
Sbjct: 3408 QAVADSSFTKEESKISQKEIKSFQGSSYEYEVQ-VFESVSQSSIHTAASVQDTQLCHTAS 3466

Query: 306  VLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKV- 364
            +    A+   L    A+ S G+    + LH           LQDV  +    A   C + 
Sbjct: 3467 LSQI-AESTELSKECAKESTGEA-PKIFLH-----------LQDVTVKCGDTAQFLCVLK 3513

Query: 365  PNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMR---GRVRTV 421
             +S I   W  E  ++    + +Q + G ++ L I  ++  D G+Y C +    G   T 
Sbjct: 3514 DDSFIDVTWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTS 3573

Query: 422  ANVTVKGP----ILKRLPRKLDVLEGENAVLLVETLEAGV---EGRWSRDGEELPVICQS 474
            A ++V+G     + +R+ +++++   E +   +   E G+   E + S+  E L ++ +S
Sbjct: 3574 AVLSVEGAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSES 3633



 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 191/1020 (18%), Positives = 346/1020 (33%), Gaps = 168/1020 (16%)

Query: 836   APVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVA----GDECAYFTVT 891
             A V+WY +G E++ES  +   N      L +      D G ++ V     G+   Y T+ 
Sbjct: 26098 AEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLD 26157

Query: 892   ITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDT 951
             +T    +  Y S +      R     LT      +A   + K  E    S    ++ + T
Sbjct: 26158 VTG-GDYTTYASQRRDEEVPRSVFPELT--RTEAYAVSSFKKTSEMEASSSVREVKSQMT 26214

Query: 952   VRRLVLPAVQLEDSGEYLC------EIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLE 1005
               R  L + +   S E          ++++S +  +  T     +  PR   ++     E
Sbjct: 26215 ETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPR---SMTVYEGE 26271

Query: 1006  CVVLMCELSREDAP-VRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC--- 1061
                  C+   E  P V W + G  +  S    +     +    + + Q  D G +     
Sbjct: 26272 SARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVE 26331

Query: 1062  -DAGDDSAFFTVT----------VTAPPE------RIVHPAA------------------ 1086
                G   A FT+T          VT+PP       R+  P A                  
Sbjct: 26332 NSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAV 26391

Query: 1087  -----------RSLDLHFGAPGRV-------------ELRCEVAPA---GSQVRWYKDGL 1119
                        +   L   AP ++             +L C V  +     +V WYKDG 
Sbjct: 26392 SPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGK 26451

Query: 1120  EVEASDALQL--GAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLAL- 1176
             +++ +   Q    A+G T  L + +    D GEYVCE   E  T    L      F ++ 
Sbjct: 26452 KLKENGHFQFHYSADG-TYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIH 26510

Query: 1177  -----------------ETT---------PSPLCVAP-----------GEPVVLSCELSR 1199
                              E+T         P P+   P               V    +  
Sbjct: 26511 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKA 26570

Query: 1200  AGAP---VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSL 1256
              G P    +W+ +G+ + +G   +L  +     L I     + +GLYTC    + G+ S 
Sbjct: 26571 TGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSS 26630

Query: 1257  SFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQ 1316
             S  + +           + Q     TP     +   +S         K  E   SQ ++ 
Sbjct: 26631 SCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEA-KSQEKLA 26689

Query: 1317  LEQAGARQVLRVQGARSGDAG-EYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGD 1375
             L++  ++ ++  +  +S     E      + ++    S E     ++ +  T ++++EG 
Sbjct: 26690 LKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQ 26749

Query: 1376  DATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGS 1435
                 +  ++    DV W+ NG  +T   +     +GS + LT++     D G +T     
Sbjct: 26750 RLVLKANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTC---I 26805

Query: 1436  TATSARLHVRETELLFLRRLQDVRA----------EEGQDVCLEVETGRVGAAGAVRWVR 1485
             + T   +   + +L   + L D  A           EGQ+V    E      +  + W +
Sbjct: 26806 SKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISG-EPSPEIEWFK 26864

Query: 1486  GGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDR----TLARLSVRPRQLR 1541
                P+   S +S+++  +++ L I    ++D G Y  ++ + R      A L V P    
Sbjct: 26865 NNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLP---L 26921

Query: 1542  VLRPLEDVTISEGGSATFQLELSQEGV--TGEWARGGVQLYPGPKCHIHSDGHRHRLVLN 1599
             V  P  +V +   G  + Q   S + V  +          +        ++     +   
Sbjct: 26922 VEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQ 26981

Query: 1600  GLGLADSGCVSFTADSLRCAARLI-------------VREVPVTIVRGPHDLEVTEGDTA 1646
              +       V  ++ S    + +              +R +P  I   P D+ + EG   
Sbjct: 26982 SMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVL 27041

Query: 1647  TFECELS-QALADVTWEKDGNALTPSPRLRLQALGTRRL--LQLRRCGPSDAGTYSCAVG 1703
             T  C  + +   +VTW   G  +    + R     T  L  L +      D G Y+ ++G
Sbjct: 27042 TVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLG 27101



 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 113/494 (22%), Positives = 184/494 (37%), Gaps = 82/494 (16%)

Query: 15   LRFPRPVRVVSGAEAELKCVV--LGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLT 72
            L+F  P+   +  E E    V  L      VVW K   +L  S  +   ++G  H L + 
Sbjct: 5269 LKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMK 5328

Query: 73   AALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLT 132
                 D    + + +    E  + A + VLE                        P F  
Sbjct: 5329 EVTLDD----ISQIKAQVKELSSTAQLKVLEAD----------------------PYFTV 5362

Query: 133  GPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASL 192
                +  +   E+ L C      +  + W KDG   +E+  S  ++++        G   
Sbjct: 5363 KLHDKTAVEKDEITLKCEVS--KDVPVKWFKDG---EEIVPSPKYSIK------ADGLRR 5411

Query: 193  ALRILAARLPDSGVYVCHARNAHGHAQA---GALLQVHQPPESPPADPDEAPAPVVEPLK 249
             L+I  A L D G YVC        A       L++V            E P   VE   
Sbjct: 5412 ILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKV------------EKPLYGVE--- 5456

Query: 250  CAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLL--PDRRRLMYRDRDGGFVLKVL 307
                  +V E  H +     + +P+   +W  +G+PL   PD   +     DG   + +L
Sbjct: 5457 -----VFVGETAHFEIE---LSEPDVHGQWKLKGQPLTASPDCEII----EDGKKHILIL 5504

Query: 308  Y-CQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
            + CQ    G     A N+     SA  L VKE  L F  PL DV+  E   A  EC+V  
Sbjct: 5505 HNCQLGMTGEVSFQAANAK----SAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSR 5560

Query: 367  SRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTV 426
                  W +  Q +    ++E I++GT   ++I     +D+  Y+ E   +  T   + +
Sbjct: 5561 EPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDK-HTSGKLII 5619

Query: 427  KGPILKRLPRKLDVL--EGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHA 481
            +G  LK L    DV   E E+AV  VE     +  +W ++ + L     +     G  H+
Sbjct: 5620 EGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHS 5679

Query: 482  LVLPGVTREDAGEV 495
            +    ++ +D  ++
Sbjct: 5680 ITFKDLSIDDTSQI 5693



 Score = 77.8 bits (190), Expect = 9e-14
 Identities = 63/239 (26%), Positives = 93/239 (38%), Gaps = 32/239 (13%)

Query: 10   SPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
            +PP  +   + V V+ G    L+C + G P P V W +   Q+ +S             L
Sbjct: 895  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 954

Query: 70   LLTAALPTDAGVYVCRARNAAG-------------EAYAAAAVTVLEPPASDPELQPAER 116
            ++  A   D+G + C A N AG             E +      V E   ++ +     R
Sbjct: 955  MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1014

Query: 117  PL---------PSPGSGE-GAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGM 166
             +            G GE  AP F+T P  Q ++ G  VV  C+ GG P+P +YW+K G+
Sbjct: 1015 DVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1074

Query: 167  ALDEVWD-SSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALL 224
             L   +     +  Q G  +        L I      D+G Y    RN HG   A A L
Sbjct: 1075 PLTTGYRYKVSYNKQTGECK--------LVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 77.8 bits (190), Expect = 9e-14
 Identities = 92/387 (23%), Positives = 137/387 (35%), Gaps = 78/387 (20%)

Query: 18    PRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPT 77
             PR + V  G  A   C   GEP P V W + GQ L+ S R        +    +++   +
Sbjct: 26262 PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQAS 26321

Query: 78    DAGVYVCRARNAAGEAYAAAAVTVL------------------EPPASDPELQPAERPLP 119
             D G Y     N+ G+  A   +T+                   EP    PE   + + + 
Sbjct: 26322 DEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVK 26381

Query: 120   SPGSG------------------EGAPVFLTGPRSQWVLRGAE---VVLTC--RAGGLPE 156
             SP                     +  PV      +Q++   A      LTC   +  L  
Sbjct: 26382 SPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRA 26441

Query: 157   PTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHG 216
               + W KDG  L E   + HF      + DG   +  L+I      D G YVC      G
Sbjct: 26442 KEVTWYKDGKKLKE---NGHFQFH--YSADG---TYELKINNLTESDQGEYVCEISGEGG 26493

Query: 217   HAQAG------ALLQVHQP--------------PESPPADPDEAPAPVVEPLKCAP---- 252
              ++        A   +H+                ES      E  AP  EP+   P    
Sbjct: 26494 TSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAP--EPISSKPVIVT 26551

Query: 253   --KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQ 310
               +   V+    AKF     G+P P   W  +G+ +    +  +  D+ GGF L++    
Sbjct: 26552 GLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDK-GGFFLEIHKTD 26610

Query: 311   AKDRGLYVCAARNSAGQTLSAVQLHVK 337
               D GLY C  +NSAG   S+ +L +K
Sbjct: 26611 TSDSGLYTCTVKNSAGSVSSSCKLTIK 26637



 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 95/398 (23%), Positives = 144/398 (36%), Gaps = 78/398 (19%)

Query: 22   RVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASER--LSFPADGAEHGLLLTAALPTDA 79
            R++ G      C + G P P + W K G+++   ER  + F  DG    L +   LP D 
Sbjct: 1255 RILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG-RASLRIPVVLPEDE 1313

Query: 80   GVYVCRARNAAGEAYAAAAVTV-----LEPPASDPELQPAER------------PL---- 118
            G+Y   A N  G A  +  + V     L  P   P L+P  R            P+    
Sbjct: 1314 GIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSP 1373

Query: 119  -----------------PSPG-----SGEG------APVFLTGPRSQWVLRGAEVVLTCR 150
                              SPG     + E        PVF+  P S   L G       +
Sbjct: 1374 ARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLK 1433

Query: 151  AGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCH 210
              G P P  +W  DG  +  V D +H  +     EDG   + +L I+ A   DSG +   
Sbjct: 1434 VVGRPMPETFWFHDGQQI--VNDYTHKVV---IKEDG---TQSLIIVPATPSDSGEWTVV 1485

Query: 211  ARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVM 270
            A+N  G +    +L V        A   +     VE L    K   + EG   + +    
Sbjct: 1486 AQNRAGRSSISVILTVE-------AVEHQVKPMFVEKL----KNVNIKEGSRLEMKVRAT 1534

Query: 271  GKPEPEIEWHWEGRPLLPDR-RRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTL 329
            G P P+I W      ++P +  ++      G   LK+    ++D   Y   A N AG+  
Sbjct: 1535 GNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDT 1594

Query: 330  SAVQLHVK------EPRLRFTRPLQDVEGREHGIAVLE 361
            +  +++V+      EP  +   P      +E     LE
Sbjct: 1595 TRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELE 1632



 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 123/502 (24%), Positives = 190/502 (37%), Gaps = 74/502 (14%)

Query: 26   GAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCR 85
            G+ A  +C+V      +  W K G  +  S +  F ADG +  L +     +DAG Y C 
Sbjct: 4828 GSSAIFECLV-SPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCV 4886

Query: 86   ARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEV 145
             R    E  + A + V E P                          T      V++G  +
Sbjct: 4887 LRLGNKEKTSTAKLVVEELPVR---------------------FVKTLEEEVTVVKGQPL 4925

Query: 146  VLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP-GASLALRILAARLPDS 204
             L+C      E  + W KDG  + E         +PGR   G  G   AL I  A   D+
Sbjct: 4926 YLSCELN--KERDVVWRKDGKIVVE---------KPGRIVPGVIGLMRALTINDADDTDA 4974

Query: 205  GVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAK 264
            G Y     NA+ + +  + ++V +               +V+P+    +   V     A 
Sbjct: 4975 GTYTVTVENAN-NLECSSCVKVVEVIRD----------WLVKPI----RDQHVKPKGTAI 5019

Query: 265  FRCYVMGKPEPEIEWH--WEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAAR 322
            F C +  K  P I+W   ++  P  P+ +  + RD      LK+     +D   Y   A 
Sbjct: 5020 FACDI-AKDTPNIKWFKGYDEIPAEPNDKTEILRD-GNHLYLKIKNAMPEDIAEY---AV 5074

Query: 323  NSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLP 382
               G+   A +L + E  +   +P++DV   E   A  + ++  + IP  W  + + L P
Sbjct: 5075 EIEGKRYPA-KLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRP 5133

Query: 383  CRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRKLDVLE 442
                E   EG  R L +H++K D  G  L +    + T A +TVK   L       DV  
Sbjct: 5134 SPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAI-TTAILTVKEIELDFAVPLKDVTV 5192

Query: 443  GENAVLLVE---TLEAGVEGRWSRDGEELPVICQSS-------SGHMHALVLPGVTREDA 492
             E      E   T EA V   WS+     P I +SS        G  H LV+     +D 
Sbjct: 5193 PERRQARFECVLTREANV--IWSKG----PDIIKSSDKFDIIADGKKHILVINDSQFDDE 5246

Query: 493  GEVTFSLGNSRTTTLLRVKCVK 514
            G  T  +   +T+  L V  ++
Sbjct: 5247 GVYTAEVEGKKTSARLFVTGIR 5268



 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 118/552 (21%), Positives = 194/552 (35%), Gaps = 105/552 (19%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASER--LSFPADGAEHGL 69
            P F+  P   ++V G      C V G P P V W+K G  L    R  +S+     E  L
Sbjct: 1036 PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKL 1095

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPL---------PS 120
            +++     DAG Y    RN  GE   +A+ ++LE    +  ++  +  L           
Sbjct: 1096 VISMTFADDAGEYTIVVRNKHGET--SASASLLEEADYELLMKSQQEMLYQTQVTAFVQE 1153

Query: 121  PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQ 180
            P  GE AP F+     +   +   ++    A        Y E      D+ +  S F   
Sbjct: 1154 PKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVE------DQEFHISSF--- 1204

Query: 181  PGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEA 240
                E+     +  RI+   L +                    L      E    D  E+
Sbjct: 1205 ----EERLIKEIEYRIIKTTLEE--------------------LLEEDGEEKMAVDISES 1240

Query: 241  PAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDG 300
             A V        K + + EG    F C + G P P+I W+ +G+ +    R  M   +DG
Sbjct: 1241 EA-VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG 1299

Query: 301  GFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK--------------EPRLRFTRP 346
               L++     +D G+Y   A N  G  + + +L+V+              EP  R  R 
Sbjct: 1300 RASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRI-RS 1358

Query: 347  LQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADD 406
            L         I +   ++  +R+  A      R+ P R+ E+ +E  + RL         
Sbjct: 1359 LSPRSVSRSPIRMSPARMSPARMSPARM-SPARMSPGRRLEETDESQLERLY-------- 1409

Query: 407  DGIYLCEMRGRVRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGV-EGRWSRDG 465
                                  P+    P     LEG+ A   ++ +   + E  W  DG
Sbjct: 1410 ---------------------KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDG 1448

Query: 466  EEL-----PVICQSSSGHMHALVLPGVTREDAGEVTF----SLGNSRTTTLLRVKCVKHS 516
            +++       +     G    +++P  T  D+GE T       G S  + +L V+ V+H 
Sbjct: 1449 QQIVNDYTHKVVIKEDGTQSLIIVP-ATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQ 1507

Query: 517  PPGPPILAEMFK 528
                P+  E  K
Sbjct: 1508 V--KPMFVEKLK 1517



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 91/395 (23%), Positives = 142/395 (35%), Gaps = 87/395 (22%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGA--EHGL 69
            P F+   + V +  G+  E+K    G P P +VW K    +   +      +G   E  L
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAAL 1569

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSP-------- 121
             + + +  D+  Y   A N AG       V V E   ++PE    ER L  P        
Sbjct: 1570 KIDSTVSQDSAWYTATAINKAGRDTTRCKVNV-EVEFAEPE---PERKLIIPRGTYRAKE 1625

Query: 122  -GSGEGAPVFLTGPRSQW------------------------VLRGAEVVLTCRAGGLPE 156
              + E  P+ L   + QW                        + R       CR   + +
Sbjct: 1626 IAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGD 1685

Query: 157  PTLY--WEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNA 214
            PT+   W  DG  L+        A +     +    SL   +  +R  DSG+  C A N 
Sbjct: 1686 PTMVVEWLHDGKPLEA-------ANRLRMINEFGYCSLDYGVAYSR--DSGIITCRATNK 1736

Query: 215  HGHAQAGA---------LLQVHQPPESPPA---------------------DPDEAPAPV 244
            +G     A         L++  Q PE                         D  E   P 
Sbjct: 1737 YGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKP- 1795

Query: 245  VEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRR-RLMYRDRDGGFV 303
               +   P+   V EG+ A+FRC V G P+P++ W+  G+ +   +R R+ Y   DG   
Sbjct: 1796 --DIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY---DGIHY 1850

Query: 304  LKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKE 338
            L ++ C++ D G     A N  G     V+L +++
Sbjct: 1851 LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQ 1885



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 113/549 (20%), Positives = 201/549 (36%), Gaps = 46/549 (8%)

Query: 931   WTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFT---------V 981
             WTKDG+ + +     L ++     L +      DSG Y C + + + S +         +
Sbjct: 26580 WTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAI 26639

Query: 982   TVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDG 1041
               TE          E+T      +  V+  E+S++       K   E +  E L L+ + 
Sbjct: 26640 KDTEAQKVSTQKTSEIT----PQKKAVVQEEISQKALRSEEIKMS-EAKSQEKLALKEEA 26694

Query: 1042  PRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAAR--SLDLHFGAPGRV 1099
              +   VL + + +       +        T T  A  E   H   +  S  +      R+
Sbjct: 26695 SK---VLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRL 26751

Query: 1100  ELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETR-HE 1158
              L+  +A A + V+W  +G+E+  S+  + G  G  +TLT+  A   D G   C ++  E
Sbjct: 26752 VLKANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 26810

Query: 1159  AIT---FNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP-VVWSHNGRPVQ 1214
              I    +++ L++      A  + P    +  G+ V+ +CE+S   +P + W  N  P+ 
Sbjct: 26811 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 26870

Query: 1215  EGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQS----GAAPGAPSLSFTVQVAEPPVRVV 1270
                 + +        L I+ A  + +G YT ++    G      SL     V EP   VV
Sbjct: 26871 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVV 26930

Query: 1271  APEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQ------GRVQLEQAGARQ 1324
                +  T   S  G      V +S       +       AS         +  +   + Q
Sbjct: 26931 LRTSGDT---SLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQ 26987

Query: 1325  VLRVQGARSGDAG-EYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCE- 1382
                V+ + S   G   +      +   L +    +  K+ +  + +++ EG   T  C  
Sbjct: 26988 ESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAF 27047

Query: 1383  VSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTL--RGCQLGDAGTVTL----RAGST 1436
                P  +VTW   G  +    Q       +  + TL     Q  D G  TL      GS 
Sbjct: 27048 TGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSD 27107

Query: 1437  ATSARLHVR 1445
             + +  +H+R
Sbjct: 27108 SATVNIHIR 27116



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 60/208 (28%), Positives = 78/208 (37%), Gaps = 29/208 (13%)

Query: 26    GAEAELKCVVLGEPPPVVVWEKGGQQLAASE---RLSFPADGAEHGLLLTAALPTDAGVY 82
             G        +   P P V W K GQ++   +   + +F +D   + L + +    D   Y
Sbjct: 25399 GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEY 25458

Query: 83    VCRARNAAGEAYAAAAVTV-LEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLR 141
                ARN  GE    A +TV L PP +D  L+P  + L            L     Q    
Sbjct: 25459 TVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRL------------LANAECQ---E 25503

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGAS-LALRILAAR 200
             G  V    R  G+P PTL WEKDG  L         +L P       G    AL I    
Sbjct: 25504 GQSVCFEIRVSGIPPPTLKWEKDGQPL---------SLGPNIEIIHEGLDYYALHIRDTL 25554

Query: 201   LPDSGVYVCHARNAHGHAQAGALLQVHQ 228
               D+G Y   A N  G     A LQV +
Sbjct: 25555 PEDTGYYRVTATNTAGSTSCQAHLQVER 25582



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 57/217 (26%), Positives = 83/217 (38%), Gaps = 30/217 (13%)

Query: 17    FPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALP 76
             F   + +  G    LK  + G     V W   G +L  SE   +   G++  L +  A  
Sbjct: 26739 FSTQMSINEGQRLVLKANIAGATD--VKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASH 26796

Query: 77    TDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRS 136
              D G+  C ++   G       +T L    SD                  AP F++ PRS
Sbjct: 26797 RDEGILTCISKTKEGIVKCQYDLT-LSKELSD------------------APAFISQPRS 26837

Query: 137   QWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRI 196
             Q +  G  V+ TC   G P P + W K+ + +     SS+ ++   R         +L I
Sbjct: 26838 QNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS---ISSNVSISRSR------NVYSLEI 26888

Query: 197   LAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESP 233
               A + DSG Y   A+N  G   A A L V    E P
Sbjct: 26889 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEP 26925



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 81/369 (21%), Positives = 132/369 (35%), Gaps = 67/369 (18%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLA--ASERLSFPADGAEHGL 69
            P F+  P   + + G  A     V+G P P   W   GQQ+    + ++    DG +  L
Sbjct: 1411 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ-SL 1469

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPV 129
            ++  A P+D+G +   A+N AG +  +  +TV          +  E  +         P+
Sbjct: 1470 IIVPATPSDSGEWTVVAQNRAGRSSISVILTV----------EAVEHQV--------KPM 1511

Query: 130  FLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPG 189
            F+   ++  +  G+ + +  RA G P P + W K+    D +    +    P    +G  
Sbjct: 1512 FVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNS---DIIVPHKY----PKIRIEGTK 1564

Query: 190  ASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPAD-----------PD 238
               AL+I +    DS  Y   A N  G       + V      P  +             
Sbjct: 1565 GEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAK 1624

Query: 239  EAPAPVVEPLKCAPKTFWVNEG---------------------------KHAKFRCYVMG 271
            E  AP +EPL          EG                            H + R   +G
Sbjct: 1625 EIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIG 1684

Query: 272  KPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSA 331
             P   +EW  +G+P L    RL   +  G   L      ++D G+  C A N  G   ++
Sbjct: 1685 DPTMVVEWLHDGKP-LEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTS 1743

Query: 332  VQLHVKEPR 340
              L VK+ +
Sbjct: 1744 ATLIVKDEK 1752



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 193/1091 (17%), Positives = 363/1091 (33%), Gaps = 146/1091 (13%)

Query: 260   GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
             G++ +F   V  KP  E++W+  G   L +  ++ Y +  G   L++L C   D G Y  
Sbjct: 26083 GQNTRFILNVQSKPTAEVKWYHNGVE-LQESSKIHYTNTSGVLTLEILDCHTDDSGTYRA 26141

Query: 320   AARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECK---VPNSRIPTAWFRE 376
                N  G+      L              DV G ++     + +   VP S  P     E
Sbjct: 26142 VCTNYKGEASDYATL--------------DVTGGDYTTYASQRRDEEVPRSVFPELTRTE 26187

Query: 377   DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGI--YLCEMRGRVRTVA------------ 422
                +   +K  ++E  +  R +  ++    + +  Y       +++ A            
Sbjct: 26188 AYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTT 26247

Query: 423   ---NVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQ---SS 475
                  T+   IL + PR + V EGE+A    +T    V    W R G+ L    +   ++
Sbjct: 26248 RKIKTTLAARILTK-PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTT 26306

Query: 476   SGHMHALVLPGVTREDAGEVTFSLGNSR-------TTTLLRVKCVKHSPPGPPIL----- 523
             + +     +  V   D G  +  + NS        T T+ + +  + +   PP +     
Sbjct: 26307 TKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEP 26366

Query: 524   ----AEMFKGHKNTVLLTWKPPEPA----------PETPFIYRLERQEVGSEDWIQCFSI 569
                  E  K  K       K PEP+            TP   +++   V +   I  F  
Sbjct: 26367 RVKSPEAVKSPKRV-----KSPEPSHPKAVSPTETKPTP-TEKVQHLPVSAPPKITQFLK 26420

Query: 570   EKAGAVEVPGDCVPSEGDYRFRICTVSGHGR----SPHVVFHGSAHLVPTARLVAGLEDV 625
              +A        CV      R +  T    G+    + H  FH SA               
Sbjct: 26421 AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSA--------------- 26465

Query: 626   QVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLI--L 683
                   D  + L ++ + +      GE +     EG      L++  +     H  +  +
Sbjct: 26466 ------DGTYELKINNLTESD---QGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKI 26516

Query: 684   HAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRV 743
                K  D            +  A   I   PV +   QD    + + ++  V      R 
Sbjct: 26517 SETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRP 26576

Query: 744   DFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQD 803
                A W KDG+ + +     +  D     L + +    DSG + C  +  +     + + 
Sbjct: 26577 --TAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKL 26634

Query: 804   PPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQ----EVEESDFVVLENEG 859
                 I D          TSE       V +E+   +  +  +    E +  + + L+ E 
Sbjct: 26635 TIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEA 26694

Query: 860   PHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLT 919
                 +     + +     + +  +E    +    +V +     +    ++    +R+VL 
Sbjct: 26695 SKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLK 26754

Query: 920   CELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESA-- 977
               +     +V+W  +G E+  S         + + L +      D G   C    +    
Sbjct: 26755 ANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIV 26813

Query: 978   ------SFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDGLEVE 1030
                   + +  +++ P  I  PR +        + V+  CE+S E +P + W+K+ L + 
Sbjct: 26814 KCQYDLTLSKELSDAPAFISQPRSQNINEG---QNVLFTCEISGEPSPEIEWFKNNLPIS 26870

Query: 1031  ESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLD 1090
              S  + + R      L +  A   D G++   A +     + T +     +V   +R + 
Sbjct: 26871 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVV 26930

Query: 1091  LHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGE 1150
             L     G   L+   +    Q+   K      +  +    +    +  ++         E
Sbjct: 26931 LR--TSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQE 26988

Query: 1151  YVCE------------TRHEAITFNVILAE----PPVQFLALETTPSPLCVAPGEPVVLS 1194
                E            T+ E+ T  ++ A     PP     +E  PS + +  G+ + ++
Sbjct: 26989 SFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPP----KIEALPSDISIDEGKVLTVA 27044

Query: 1195  CELSRAGAP-VVWSHNGRPVQEGEGLELHAEG--PRRVLCIQAAGPAHAGLYTCQSGAAP 1251
             C  +    P V WS  GR +   E    H E       L I        GLYT   G   
Sbjct: 27045 CAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEF 27104

Query: 1252  GAPSLSFTVQV 1262
             G+ S +  + +
Sbjct: 27105 GSDSATVNIHI 27115



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 60/241 (24%), Positives = 80/241 (33%), Gaps = 46/241 (19%)

Query: 128  PVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDG 187
            P  ++G ++  V+ G  V L C   G P PT+ W ++   ++   D      Q G A   
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQ-ITFQSGIAR-- 953

Query: 188  PGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPE---------------- 231
                  L I  A   DSG + C A N  G       L V    E                
Sbjct: 954  ------LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEE 1007

Query: 232  -----------------SPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPE 274
                                A P E  AP         K     EG    F C V G P+
Sbjct: 1008 KRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLV---EGGSVVFGCQVGGNPK 1064

Query: 275  PEIEWHWEGRPLLPD-RRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQ 333
            P + W   G PL    R ++ Y  + G   L +    A D G Y    RN  G+T ++  
Sbjct: 1065 PHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASAS 1124

Query: 334  L 334
            L
Sbjct: 1125 L 1125



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 69/279 (24%), Positives = 113/279 (40%), Gaps = 54/279 (19%)

Query: 12  PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASE----RLSFPADGAEH 67
           P F +  + V V+ G+ A  +  + G P P V W + GQ ++ S     ++SF    A+ 
Sbjct: 6   PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK- 64

Query: 68  GLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGA 127
            L + A    ++G Y  +A N +G+A + A + V    A                     
Sbjct: 65  -LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA--------------------P 103

Query: 128 PVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDG 187
           P F+   +S  V +G++V L  R  G+P P + + +DG    E+  S  F +        
Sbjct: 104 PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGA---EIQSSLDFQISQ------ 154

Query: 188 PGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEP 247
            G   +L I  A   DSG Y  +A N+ G A + A L V    E P            + 
Sbjct: 155 EGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVP-----------AKK 203

Query: 248 LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL 286
            K    T  ++E +  +         E +IE H++ R +
Sbjct: 204 TKTIVSTAQISESRQTRI--------EKKIEAHFDARSI 234



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 63/225 (28%), Positives = 91/225 (40%), Gaps = 30/225 (13%)

Query: 12    PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPAD---GAEHG 68
             P F    R + V   + A L C V G P P+V W + G+++ A + L +      G  H 
Sbjct: 24623 PHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA-DGLKYRIQEFKGGYHQ 24681

Query: 69    LLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAP 128
             L++ +    DA VY  RA N  G     A++ V           PA+  LP    G GA 
Sbjct: 24682 LIIASVTDDDATVYQVRATNQGGSVSGTASLEV---------EVPAKIHLPKTLEGMGA- 24731

Query: 129   VFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGP 188
                        LRG  V +     G P+P + W+K    +D   ++ H+ +   R+    
Sbjct: 24732 --------VHALRGEVVSIKIPFSGKPDPVITWQKGQDLID---NNGHYQVIVTRS---- 24776

Query: 189   GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESP 233
               SL       R  D+G YV  A+N  G  Q    L V   P+ P
Sbjct: 24777 FTSLVFPNGVER-KDAGFYVVCAKNRFGIDQKTVELDVADVPDPP 24820



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 11   PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHG-L 69
            PP FL+  +P+R   G  A  +  V+GEP P V W K  +QL  S   +   +    G  
Sbjct: 3766 PPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTF 3825

Query: 70   LLTAALPTDAGVYVCRARNAAGEAYAAAAVTVL 102
            ++      D+G+Y+C+A N  GE+  AA + VL
Sbjct: 3826 IVNDPQREDSGLYICKAENMLGESTCAAELLVL 3858



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 120/558 (21%), Positives = 202/558 (36%), Gaps = 73/558 (13%)

Query: 492   AGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI- 550
             A E    +G     ++    C    PPGPP   ++    +++V L W  P      P   
Sbjct: 18672 AAENAAGVGEPSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKG 18731

Query: 551   YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSA 610
             Y +E +E  +++W  C         +     +    +Y FRIC ++  G        GS 
Sbjct: 18732 YVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSV 18791

Query: 611   HLV-----PTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEP 665
                     P   L A L  V V     A  +L L   I+G       E+K  + EG +  
Sbjct: 18792 VAQERIEPPEIELDADLRKVVVLR---ASATLRLFVTIKGR---PEPEVKWEKAEGILTD 18845

Query: 666   GALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVS 725
                R +IE       L++  V   DSG    ++     +S + T   +   + SP   V+
Sbjct: 18846 ---RAQIEVTSSFTMLVIDNVTRFDSGR---YNLTLENNSGSKTAFVNVRVLDSPSAPVN 18899

Query: 726   LTF--TTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDG-RKHRLILPEAKVQD 782
             LT      + V L+ E   +D        G K+  +  +V K +  RK    +     + 
Sbjct: 18900 LTIREVKKDSVTLSWEPPLID-------GGAKI--TNYIVEKRETTRKAYATITNNCTKT 18950

Query: 783   SGEFECRTEGVSAFFGVTVQDP-----PVHIVDPREHVFVHAITSECVMLACEVDREDAP 837
             +   E   EG S +F V   +      P    +P + V    +    V L  +V R  A 
Sbjct: 18951 TFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVK-VSEPPLPPGRVTLV-DVTRNTAT 19008

Query: 838   VRWYK---DGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITD 894
             ++W K   DG        V ++ +G  +       +  +       AG+E  +    + +
Sbjct: 19009 IKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNE 19068

Query: 895   -------------------VSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDG 935
                                +   +  P     V A    ++ +  +  RP A V W KDG
Sbjct: 19069 KGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFK-GRPQATVNWRKDG 19127

Query: 936   EEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVT---------EP 986
             + + E+  + +    TV  L +     ED G Y   + + + S TV +T           
Sbjct: 19128 QTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPG 19187

Query: 987   PVRIIYPRDEVTLIAVTL 1004
             P+RI    DEV+  ++T+
Sbjct: 19188 PIRI----DEVSCDSITI 19201



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 75/318 (23%), Positives = 117/318 (36%), Gaps = 24/318 (7%)

Query: 43    VVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTV- 101
             V W  G +QL  SE+     +     L +      D G Y C+  N  GE  + A + V 
Sbjct: 25295 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVK 25354

Query: 102   ----LEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEP 157
                 +        ++  +R   +    E  P F     ++    G  V         PEP
Sbjct: 25355 GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEP 25414

Query: 158   TLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGH 217
              + W K G  +    +   +  +  +          L I +    D   Y   ARN +G 
Sbjct: 25415 HVTWYKSGQKIKPGDNDKKYTFESDKG------LYQLTINSVTTDDDAEYTVVARNKYGE 25468

Query: 218   AQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEI 277
                 A L V   P  PP D    P       K         EG+   F   V G P P +
Sbjct: 25469 DSCKAKLTVTLHP--PPTDSTLRPM-----FKRLLANAECQEGQSVCFEIRVSGIPPPTL 25521

Query: 278   EWHWEGRPL-LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
             +W  +G+PL L     +++   D  + L +     +D G Y   A N+AG T  + Q H+
Sbjct: 25522 KWEKDGQPLSLGPNIEIIHEGLD-YYALHIRDTLPEDTGYYRVTATNTAGST--SCQAHL 25578

Query: 337   KEPRLRFTRPLQDVEGRE 354
             +  RLR+ +  Q+ + +E
Sbjct: 25579 QVERLRYKK--QEFKSKE 25594



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 144/696 (20%), Positives = 245/696 (35%), Gaps = 128/696 (18%)

Query: 252   PKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQA 311
             P++  V EG+ A+F C   G+P P + W  +G+ L    R  +   +      ++   QA
Sbjct: 26262 PRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKS-TFEISSVQA 26320

Query: 312   KDRGLYVCAARNSAGQTLSAVQLHVKEPRL---------RFTRPLQDVEGREHGIAVLEC 362
              D G Y     NS G+  +   L +++ R+         R   P   V+  E   +    
Sbjct: 26321 SDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRV 26380

Query: 363   KVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVA 422
             K P    P A    + +  P  K + +      + I   LKA+             + +A
Sbjct: 26381 KSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPK-ITQFLKAEAS-----------KEIA 26428

Query: 423   NVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHM--- 479
              +T                  E++VL  +      E  W +DG++L       +GH    
Sbjct: 26429 KLT---------------CVVESSVLRAK------EVTWYKDGKKL-----KENGHFQFH 26462

Query: 480   ------HALVLPGVTREDAGEVTFSL----GNSRTTTLLRVKCVKHSPPGPPILAEMFKG 529
                   + L +  +T  D GE    +    G S+T      +  K        ++E  K 
Sbjct: 26463 YSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKS 26522

Query: 530   HKNTVLLTW------KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVE------V 577
              + T   T       K PEP    P I    +    S D +  F+++  G          
Sbjct: 26523 DQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTK 26582

Query: 578   PGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSL 637
              G  +   G Y+                F    H   T+   +GL    V +   +V S 
Sbjct: 26583 DGKAITQGGKYKL---------SEDKGGFFLEIHKTDTSD--SGLYTCTVKNSAGSVSSS 26631

Query: 638   DLSTI--IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILH---------AV 686
                TI  I+ T        K++E   Q +   ++  I QK L+   I           A+
Sbjct: 26632 CKLTIKAIKDTEAQKVSTQKTSEITPQ-KKAVVQEEISQKALRSEEIKMSEAKSQEKLAL 26690

Query: 687   KHQDSGALVGFSCPGVQDSAALTIQESPVH-------ILSPQDR---------VSLTFTT 730
             K + S  L+      V+ SAA ++++S VH         S + R           ++   
Sbjct: 26691 KEEASKVLIS---EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINE 26747

Query: 731   SERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFEC-- 788
              +R+VL   ++       W  +G ++  SE     + G    L + +A  +D G   C  
Sbjct: 26748 GQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCIS 26806

Query: 789   -RTEG-VSAFFGVT----VQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAP-VRWY 841
                EG V   + +T    + D P  I  PR     +    + V+  CE+  E +P + W+
Sbjct: 26807 KTKEGIVKCQYDLTLSKELSDAPAFISQPRSQ---NINEGQNVLFTCEISGEPSPEIEWF 26863

Query: 842   KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEF 877
             K+   +  S  V +        L +     SD G++
Sbjct: 26864 KNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKY 26899



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 32/115 (27%), Positives = 50/115 (43%)

Query: 9     GSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHG 68
             G  P   +  + V    G  A+L C ++G P P + W + G++L  S +    +DG  H 
Sbjct: 24225 GEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHT 24284

Query: 69    LLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGS 123
             L +      D GVY C A N  GE   ++ + +   P   P     E+   + GS
Sbjct: 24285 LTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGS 24339



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 81/379 (21%), Positives = 133/379 (35%), Gaps = 82/379 (21%)

Query: 131   LTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALD--------------------- 169
             LT PRS  V  G     +C   G P PT+ W + G  L                      
Sbjct: 26259 LTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSV 26318

Query: 170   EVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGV-YVCHARNAHGHAQAGALLQVHQ 228
             +  D  ++++    +E    A   L I  AR+ +  V      ++     ++   ++  +
Sbjct: 26319 QASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSPK 26378

Query: 229   PPESP-PADP------DEAPAPVVE----PLKCAPK--TFWVNEGKH--AKFRCYVMGK- 272
               +SP P+ P      +  P P  +    P+   PK   F   E     AK  C V    
Sbjct: 26379 RVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSV 26438

Query: 273   -PEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSA 331
                 E+ W+ +G+ L  +     +   DG + LK+      D+G YVC      G + + 
Sbjct: 26439 LRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTN 26498

Query: 332   VQ--------LHVKEPRL----------------RFTRP---------------LQDVEG 352
             +Q        +H K  ++                R T P               LQD   
Sbjct: 26499 LQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTV 26558

Query: 353   REHGIAVLECKVPNSRIPTA-WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYL 411
                 +A    K      PTA W ++ + +    KY+  E+     L IH+    D G+Y 
Sbjct: 26559 SSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYT 26618

Query: 412   CEMR---GRVRTVANVTVK 427
             C ++   G V +   +T+K
Sbjct: 26619 CTVKNSAGSVSSSCKLTIK 26637



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 44/164 (26%), Positives = 77/164 (46%), Gaps = 10/164 (6%)

Query: 1366 LTPLTVHEGDDATFRCEVSP-PDADVTWLRNGAVVTPG--PQVEMAQNGSSRILTLRGCQ 1422
            L  + V EG  ATF   +S  P  +V+W R+G V++    P V+++ +     LT+    
Sbjct: 12   LQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVT 71

Query: 1423 LGDAGTVTLRA----GSTATSARLHVRETELL--FLRRLQDVRAEEGQDVCLEVETGRVG 1476
              ++G  +L+A    G   ++A L V+       F++RLQ +   +G  V L+V    + 
Sbjct: 72   KANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIP 131

Query: 1477 AAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTY 1520
                V++ R G  +       ++Q+G ++ L I      D GTY
Sbjct: 132  TP-VVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 12/141 (8%)

Query: 1020 VRWYKDGLEVEESE--ALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTV--- 1074
            V W++DG  +  S    + +     R +L +PA    + G +   A + S   T T    
Sbjct: 37   VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELL 96

Query: 1075 ----TAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLG 1130
                TAPP  +     +S+ +  G+  R+++R    P    V++Y+DG E+++S   Q+ 
Sbjct: 97   VKAETAPPNFVQR--LQSMTVRQGSQVRLQVRVTGIPT-PVVKFYRDGAEIQSSLDFQIS 153

Query: 1131 AEGPTRTLTLPHAQPEDAGEY 1151
             EG   +L +  A PED+G Y
Sbjct: 154  QEGDLYSLLIAEAYPEDSGTY 174



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 71/338 (21%), Positives = 130/338 (38%), Gaps = 44/338 (13%)

Query: 189   GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
             G+   L I  A   D G+  C ++   G  +    L + +       +  +APA + +P 
Sbjct: 26784 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSK-------ELSDAPAFISQP- 26835

Query: 249   KCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLY 308
                 ++  +NEG++  F C + G+P PEIEW     P+       + R R+  + L++  
Sbjct: 26836 ----RSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRN-VYSLEIRN 26890

Query: 309   CQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSR 368
                 D G Y   A+N  GQ  +   L V         P ++V  R  G   L+    +  
Sbjct: 26891 ASVSDSGKYTIKAKNFRGQCSATASLMVLP---LVEEPSREVVLRTSGDTSLQGSFSSQS 26947

Query: 369   IPTAWFREDQRL----------LPCRKYEQIEE---GTVRRLIIHRLKADDDGI-YLCEM 414
             +  +  +++             +   K+  +      +++   +    +   GI  + ++
Sbjct: 26948 VQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQL 27007

Query: 415   RGRVRTVANVTVKG--PILKRLPRKLDVLEGE-NAVLLVETLEAGVEGRWSRDGEELPVI 471
                   +    ++G  P ++ LP  + + EG+   V    T E   E  WS  G +   I
Sbjct: 27008 ESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRK---I 27064

Query: 472   CQSSSGHMH--------ALVLPGVTREDAGEVTFSLGN 501
                  G  H         L++  V ++D G  T SLGN
Sbjct: 27065 HSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGN 27102



 Score = 55.1 bits (131), Expect = 7e-07
 Identities = 97/418 (23%), Positives = 155/418 (37%), Gaps = 52/418 (12%)

Query: 373  WFREDQRLLPCRKYEQIEEGTVR-RLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPIL 431
            W R + R +   K++ +EEG V  +  + R++A    +    +        NV  K P  
Sbjct: 8026 WMRVNSRPIKDLKFK-VEEGVVPDKEYVLRVRA----VNAIGVSEPSEISENVVAKDPDC 8080

Query: 432  KRL----PRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQSSSGHMHA---LV 483
            K         + V+EGE   + V      V    W +DG+E+    + +  + H    L 
Sbjct: 8081 KPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLE 8140

Query: 484  LPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEP 543
            +P   R DAG  T +L N   +    +       PGP    +     K++  LTW+PPE 
Sbjct: 8141 VPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF 8200

Query: 544  APETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSP 602
               TP + Y LER+E G   +I   S E   +  V  D +P+ G+Y FR+  V+  G   
Sbjct: 8201 DGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVK-DLIPN-GEYFFRVKAVNKVGGGE 8258

Query: 603  HVVFHGSAHLV----------------PTARLVAGLEDVQVYDGEDAVFSLDLSTIIQG- 645
            ++                         PTA  +       +YDG   +    +  I +G 
Sbjct: 8259 YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGE 8318

Query: 646  -TWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD 704
              W    E L             L Y    KGL+           ++ A +         
Sbjct: 8319 ERWKRCNEHLVP----------ILTY--TAKGLEEGKEYQFRVRAENAAGISEPSRATPP 8366

Query: 705  SAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPA-TWYKDGQKVEESEL 761
            + A+   ++P  IL    R SL     + + L   +S   +P  TW KD   +   E+
Sbjct: 8367 TKAVDPIDAPKVIL----RTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEI 8420



 Score = 55.1 bits (131), Expect = 7e-07
 Identities = 48/209 (22%), Positives = 92/209 (44%), Gaps = 24/209 (11%)

Query: 413   EMRGRVRTVANVTVKGP-------ILKRLPRKLDVLEGENAVLLVET-----LEAGVEGR 460
             + R   RT  N++           + + +P ++D+     ++L V+      L+A V G+
Sbjct: 12958 QFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGK 13017

Query: 461   ------WSRDGEELPV---ICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVK 511
                   W +DG  L     I  +   ++  L L  V R+D+G+ T +  NS  +    +K
Sbjct: 13018 PMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIK 13077

Query: 512   CVKHSPPGPPILAEMFKGHKNTVLLTWKPP-EPAPETPFIYRLERQEVGSEDWIQCFSIE 570
                   PGPP   ++ K + +  +L+W+PP E        Y ++++E    +W Q  +  
Sbjct: 13078 LKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPNWAQVSATV 13137

Query: 571   KAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
                +  V  + +    +Y+FRIC  + +G
Sbjct: 13138 PITSCSV--EKLIEGHEYQFRICAENKYG 13164



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 100/471 (21%), Positives = 191/471 (40%), Gaps = 59/471 (12%)

Query: 260   GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
             G+ A+  C ++G+P P+I+W+  G+ L+  R+  M  D      L V+  + +D G+Y C
Sbjct: 24242 GEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSD-GRTHTLTVMTEEQEDEGVYTC 24300

Query: 320   AARNSAGQTLSAVQLHVK-EPRLRFTRPLQD-VEGREHGIAVLECKVPNSRIPTAWFRED 377
              A N  G+  ++ +L ++  P+     PL++   G       L        +P   +   
Sbjct: 24301 IATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHG 24360

Query: 378   QRLLPCRKYEQIEE-----GTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKG-PIL 431
             Q+LL   +   IE        V + +  +  A    + L  + G V  + +V ++  P  
Sbjct: 24361 QKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDK 24420

Query: 432   KRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVT--- 488
                P  ++ L   +AV+  +   A   G W  +   +   C++  G    LV   ++   
Sbjct: 24421 PTGPIVIEALLKNSAVISWKP-PADDGGSWITN--YVVEKCEAKEGAEWQLVSSAISVTT 24477

Query: 489   ------REDAG-------EVTFSLGNS---RTTTLLRVKCVKHSPPGPPILAEMFKGHKN 532
                    E+AG       + TF + +     +  +++    K   PG P +  +    K+
Sbjct: 24478 CRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAV---TKD 24534

Query: 533   TVLLTWKPPEPAPETPF-IYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEG-DYRF 590
             + ++ WKPP          Y LE++E     WI   + E    V    + +  EG +Y F
Sbjct: 24535 SCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLI--EGLEYEF 24592

Query: 591   RICTVSGHGRS-----PHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLS----T 641
             R+   +  G S        +   S   +        L ++ V    +A     ++     
Sbjct: 24593 RVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKP 24652

Query: 642   IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQ-KGLQHRLILHAVKHQDS 691
             I++  W+  G+E+ ++          L+YRI++ KG  H+LI+ +V   D+
Sbjct: 24653 IVK--WYRQGKEIIAD---------GLKYRIQEFKGGYHQLIIASVTDDDA 24692



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 54/214 (25%), Positives = 86/214 (40%), Gaps = 27/214 (12%)

Query: 127 APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALD-EVWDSSHFALQPGRAE 185
           AP F    +S  VL G+         G P P + W +DG  +          +   GRA+
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 186 DGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVV 245
                   L I A    +SG Y   A N  G A + A L V           + AP   V
Sbjct: 65  --------LTIPAVTKANSGRYSLKATNGSGQATSTAELLV---------KAETAPPNFV 107

Query: 246 EPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLK 305
           + L    ++  V +G   + +  V G P P ++++ +G  +   +  L ++    G +  
Sbjct: 108 QRL----QSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI---QSSLDFQISQEGDLYS 160

Query: 306 VLYCQA--KDRGLYVCAARNSAGQTLSAVQLHVK 337
           +L  +A  +D G Y   A NS G+  S  +L V+
Sbjct: 161 LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 81/338 (23%), Positives = 134/338 (39%), Gaps = 47/338 (13%)

Query: 700  PGVQDSAALTIQESPVHILSPQDRVSLTF--TTSERVVLTCELSRVDFPA-TWYKDGQKV 756
            P +Q  A  ++QE        Q    +T     S+ ++ T E+S  +  +   Y D   V
Sbjct: 4322 PRIQQGAKTSLQEEMDSFSGSQKVEPITEPEVESKYLISTEEVSYFNVQSRVKYLDATPV 4381

Query: 757  EESELLVVKMDGRKHRLILP----EAKVQDSGEFECRTEGVSAFFGVTVQD--PPVH--I 808
             +     V  D ++   + P    E    +SG  E  T  +    G  +++  P +H  +
Sbjct: 4382 TKGVASAVVSDEKQDESLKPSEEKEESSSESGTEEVATVKIQEAEGGLIKEDGPMIHTPL 4441

Query: 809  VDP--REHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESD-FVVLENEGPHRRLV 865
            VD    E   VH  TS  +  A EV+       WY + + V   + F  L+++  +  ++
Sbjct: 4442 VDTVSEEGDIVHLTTS--ITNAKEVN-------WYFENKLVPSDEKFKCLQDQNTYTLVI 4492

Query: 866  LPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVL------T 919
                     GE+ C A ++      T T     +V  +  V    +    V L      T
Sbjct: 4493 DKVNTEDHQGEYVCEALNDSGK---TATSAKLTVVKRAAPVIKRKIEPLEVALGHLAKFT 4549

Query: 920  CEL-CRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDE--- 975
            CE+   P    +W K G E+ ES    ++    +  L +   Q+ D GEY C+  +E   
Sbjct: 4550 CEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGS 4609

Query: 976  -SASFTVTVTEP----------PVRIIYPRDEVTLIAV 1002
             S + T+TVT P          P R   P++EV L +V
Sbjct: 4610 VSCTATLTVTVPGGEKKVRKLLPERKPEPKEEVVLKSV 4647



 Score = 52.0 bits (123), Expect = 6e-06
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 9/119 (7%)

Query: 7     DQGSPPCFLRFPR---PVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPAD 63
             D+  PP     P+    + V +G   ++   + G+P P + W KG Q+L+ + RL   + 
Sbjct: 16231 DEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKST 16290

Query: 64    GAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
                  L +  A+  D+G Y+ +A+N AGE      V VL+ P       P E P+   G
Sbjct: 16291 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPG------PPEGPVVISG 16343



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 28/92 (30%), Positives = 48/92 (52%)

Query: 10  SPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
           +PP F++  + + V  G++  L+  V G P PVV + + G ++ +S       +G  + L
Sbjct: 102 APPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSL 161

Query: 70  LLTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
           L+  A P D+G Y   A N+ G A + A + V
Sbjct: 162 LIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 195/938 (20%), Positives = 327/938 (34%), Gaps = 198/938 (21%)

Query: 713  SPVHI-LSPQDRVS----LTFTTSERVVLTCELSRVDFPA-TWYKDGQKVEESELLVVKM 766
            +PV I ++P   VS    +T    E V L C +S    P  TWY++  ++E S    +  
Sbjct: 888  APVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF 947

Query: 767  DGRKHRLILPEA-------------------------KVQDSGEFECRTEGVSAFFGVT- 800
                 RL++ EA                          VQ S EFE  T  V+  F    
Sbjct: 948  QSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEE 1007

Query: 801  ---VQDPPVHIVD---------PREHVFVHAITSECV---------MLACEVDREDAP-V 838
               V+   V + D         P E    + IT   V         +  C+V     P V
Sbjct: 1008 KRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHV 1067

Query: 839  RWYKDGQEVEESDF--VVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTI---- 892
             W K G  +       V    +    +LV+  T   D GE+  V  ++    + +     
Sbjct: 1068 YWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE 1127

Query: 893  -----------------TDVSSWIVYPS------GKVYVAAVR---LERVVLTCELCRPW 926
                             T V++++  P       G VY    +    E+ ++  ++ +  
Sbjct: 1128 EADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDT 1187

Query: 927  AEVR-WTKDGEEVVESPALLLQKEDTVRRLVLPAVQL-EDSGEYLCEIDDESASFTVTVT 984
              VR + +D E  + S    L KE   R +     +L E+ GE    +D   +    +  
Sbjct: 1188 VVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGF 1247

Query: 985  EPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDGLEVEESEALVLE--RDG 1041
            +  ++     + +         V   C++S    P + WYKDG  ++  E   ++  +DG
Sbjct: 1248 DSRIKNYRILEGMG--------VTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDG 1299

Query: 1042 PRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVEL 1101
             R  L +P   PED G +   A +             +  V PAA       GAP  +  
Sbjct: 1300 -RASLRIPVVLPEDEGIYTAFASNIKG----NAICSGKLYVEPAA-----PLGAPTYIPT 1349

Query: 1102 RCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAIT 1161
               V+   S          +  S A    A      ++     P    E   E++ E + 
Sbjct: 1350 LEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERL- 1408

Query: 1162 FNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPV---VWSHNGRP-VQEGE 1217
            +  +    PV F  LE   +              +L   G P+    W H+G+  V +  
Sbjct: 1409 YKPVFVLKPVSFKCLEGQTARF------------DLKVVGRPMPETFWFHDGQQIVNDYT 1456

Query: 1218 GLELHAEGPRRVLCIQAAGPAHAGLYT--CQSGAAPGAPSLSFTVQVAEPPVRVVAPEAA 1275
               +  E   + L I  A P+ +G +T   Q+ A   + S+  TV+  E  V+ +  E  
Sbjct: 1457 HKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKL 1516

Query: 1276 QTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLA--SQGRVQLEQAGARQVLRVQGAR 1332
            +  V    G  LE+ V  +G P   + W K+ + +      ++++E       L++    
Sbjct: 1517 K-NVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTV 1575

Query: 1333 SGDAGEY----LCDAPQDSRIFLVSVE-----------------------------EPLL 1359
            S D+  Y    +  A +D+    V+VE                             EPL 
Sbjct: 1576 SQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLH 1635

Query: 1360 VKLVSE---------------------LTPLTVHEGDDATFRCEVSP---PDADVTWLRN 1395
            ++   E                     LT L +     A F C ++P   P   V WL +
Sbjct: 1636 LRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHD 1695

Query: 1396 GAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELLF 1451
            G  +    ++ M        L        D+G +T RA    G+  TSA L V++ + L 
Sbjct: 1696 GKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL- 1754

Query: 1452 LRRLQDVRAEEGQDVCLEV-ETGRVGAAGAVRWVRGGQ 1488
               +++ +  EG+     + E  R+   GA+  V   Q
Sbjct: 1755 ---VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQ 1789



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 67/309 (21%), Positives = 111/309 (35%), Gaps = 55/309 (17%)

Query: 139  VLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRA----------EDGP 188
            +L G  V   C+  G P P + W KDG  +          LQ GRA          ++G 
Sbjct: 1256 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1315

Query: 189  GASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQ----PPESPPADPDEAPAPV 244
              + A  I    +    +YV  A           L  V +     P S    P       
Sbjct: 1316 YTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPAR 1375

Query: 245  VEPLKCAPK----------------------------------TFWVNEGKHAKFRCYVM 270
            + P + +P                                   +F   EG+ A+F   V+
Sbjct: 1376 MSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVV 1435

Query: 271  GKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLS 330
            G+P PE  W  +G+ ++ D    +    DG   L ++     D G +   A+N AG++  
Sbjct: 1436 GRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSI 1495

Query: 331  AVQLHVK----EPRLRFTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFREDQRLLPCRK 385
            +V L V+    + +  F   L++V  +E     ++ +   +  P   W +    ++P  K
Sbjct: 1496 SVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVP-HK 1554

Query: 386  YEQIE-EGT 393
            Y +I  EGT
Sbjct: 1555 YPKIRIEGT 1563



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 1/93 (1%)

Query: 21   VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
            +++++G    +  VV G P P  VW K   +L   +R+     G +  L++  AL  D G
Sbjct: 8809 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELD-KDRVVIDNVGTKSELIIKDALRKDHG 8867

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQP 113
             YV  A N+ G  +AAA V V + P    +L+P
Sbjct: 8868 RYVITATNSCGSKFAAARVEVFDVPGPVLDLKP 8900



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 29/105 (27%), Positives = 47/105 (44%), Gaps = 1/105 (0%)

Query: 5     SGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG 64
             S +    P F+  PR   +  G      C + GEP P + W K    ++ S  +S     
Sbjct: 26822 SKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSR 26881

Query: 65    AEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDP 109
               + L +  A  +D+G Y  +A+N  G+  A A++ VL P   +P
Sbjct: 26882 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVL-PLVEEP 26925



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 45/157 (28%), Positives = 63/157 (40%), Gaps = 16/157 (10%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             + V + +GA   L   V G PPPV+ W K G  LA+  R       +   L++      D
Sbjct: 23149 KTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLAS--RAIIDTTESYSLLIVDKVNRYD 23206

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS-------PGSGEGAPV-- 129
             AG Y   A N +G+  A   V V + P   P ++  E    S       P    GAPV  
Sbjct: 23207 AGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNN 23266

Query: 130   FLTGPRSQWVLRGAEVVLTC-----RAGGLPEPTLYW 161
             ++   R   +     V   C     R  GL E T+Y+
Sbjct: 23267 YIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYY 23303



 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 48/178 (26%), Positives = 84/178 (47%), Gaps = 13/178 (7%)

Query: 1640 VTEGDTATFECELSQ-ALADVTWEKDGNALTPS--PRLRLQALGTRRLLQLRRCGPSDAG 1696
            V EG TATFE  +S   + +V+W +DG  ++ S  P +++     R  L +     +++G
Sbjct: 17   VLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSG 76

Query: 1697 TYSCAV--GTARA-GPVRLTVRERTVA--VLSELRSVSAREGDGATFECTVSEVET-TGR 1750
             YS     G+ +A     L V+  T     +  L+S++ R+G     +  V+ + T   +
Sbjct: 77   RYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVK 136

Query: 1751 WELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA----GPAQSLALLEVE 1804
            +   G  ++     +I QEG  + L+++E   ED+G     A    G A S A L V+
Sbjct: 137  FYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 32/97 (32%), Positives = 46/97 (47%), Gaps = 4/97 (4%)

Query: 11    PPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLL 70
             PP F        V++G + ++    +G P P V W K    L  + R++  A+  E+  L
Sbjct: 15842 PPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVN--AESTENNSL 15899

Query: 71    LTA--ALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
             LT   A   D G YV +  N+AGEA     V VL+ P
Sbjct: 15900 LTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKP 15936



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 58/264 (21%), Positives = 108/264 (40%), Gaps = 22/264 (8%)

Query: 1631  IVRGPHDLEVTEGDTATFECELS-QALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRR 1689
             IV G  D  V+    A F  + + +      W KDG A+T   + +L        L++ +
Sbjct: 26549 IVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHK 26608

Query: 1690  CGPSDAGTYSCAVGTARAGPVRLTVRERTVAVL-SELRSVSAREGDGATFECTVSEVETT 1748
                SD+G Y+C V  + AG V  + +    A+  +E + VS ++    T E T  + +  
Sbjct: 26609 TDTSDSGLYTCTVKNS-AGSVSSSCKLTIKAIKDTEAQKVSTQK----TSEIT-PQKKAV 26662

Query: 1749  GRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE--DAGEVRFQAGPAQSLALLEVEAL 1806
              + E+  + LR    +++ +   +  L L E  ++   + EV+  A  +   +++  E  
Sbjct: 26663 VQEEISQKALR-SEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEIT 26721

Query: 1807  PLQMCRHPPR----------EKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEM 1856
                      R          + ++  G+R VL+  ++     V W+  G EL   ++Y  
Sbjct: 26722 KTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIA-GATDVKWVLNGVELTNSEEYRY 26780

Query: 1857  RSHGPTHSLVIHDVRPEDQGTYCC 1880
                G   +L I      D+G   C
Sbjct: 26781 GVSGSDQTLTIKQASHRDEGILTC 26804



 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 180/863 (20%), Positives = 317/863 (36%), Gaps = 125/863 (14%)

Query: 228   QPPESPPADP--DEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRP 285
             +P ES  A    DE   P +        T  V+ G+  K    + GKP P I+W  +G  
Sbjct: 16219 EPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWI-KGDQ 16277

Query: 286   LLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV--------- 336
              L +  RL  +  D    L V      D G Y+  A+N AG+    V + V         
Sbjct: 16278 ELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 16337

Query: 337   ---------KEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYE 387
                      ++  L +  PLQD  G    I  +  +   SR+       + + L C+  +
Sbjct: 16338 PVVISGVTAEKCTLAWKPPLQD--GGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTK 16395

Query: 388   QIE--EGTVRRLIIHRLKADDD---------GIYLCEMRGRVRTVANVTVKGPILKRLPR 436
              +E  E T R + +++    +            ++     +   V  VT    I+     
Sbjct: 16396 LLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVW--- 16452

Query: 437   KLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQSSSGHMHALVLPGVTRED---- 491
             +    +G + +L     +   EG RW+R  + L        G +   V   +   D    
Sbjct: 16453 ERPASDGGSEILGYVLEKRDKEGIRWTRCHKRL-------IGELRLRVTGLIENHDYEFR 16505

Query: 492   -AGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP--EPAPETP 548
              + E    L      +  +  C     PGPP   ++    +++V L+W  P  +   E  
Sbjct: 16506 VSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDGGCEIQ 16565

Query: 549   FIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHG 608
               Y +E+ +V   +W  C          +  + +  + +Y FRIC ++  G   H    G
Sbjct: 16566 G-YIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPG 16624

Query: 609   SAHLVPTARLVAGLEDVQV----YDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
                ++   +L A   D+ +         A  SL L   I+G       E+K  + +G++ 
Sbjct: 16625 P--IIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGR---PTPEVKWGKVDGEIR 16679

Query: 665   PGALRYRIEQKGLQHRLILHAVKHQDSG--ALVGFSCPGVQDSAALTIQ--ESPVHILSP 720
               A+   I+       L+L  V   DSG   L   +  G + SA +T++  ++P    SP
Sbjct: 16680 DAAI---IDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTK-SAFVTVRVLDTP----SP 16731

Query: 721   QDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDG-RKHRLILPEAK 779
                + +T  T + V +T E   +D        G K++    +V K +  RK    +    
Sbjct: 16732 PVNLKVTEITKDSVSITWEPPLLD-------GGSKIK--NYIVEKREATRKSYAAVVTNC 16782

Query: 780   VQDSGEFECRTEGVSAFFGVTVQDP-----PVHIVDPREHVFVHAITSECVMLACEVDRE 834
              ++S + +   EG S +F VT ++      P    DP +   V     +  +   +V R 
Sbjct: 16783 HKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGK--ITVDDVTRN 16840

Query: 835   DAPVRWYK----DGQEVEESDFVVLENEGPH----------RRLVLPATQPSDGGE--FQ 878
                + W K     G ++ +    ++E +  H          + L    T  + G E  F+
Sbjct: 16841 SVSLSWTKPEHDGGSKIIQ---YIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFR 16897

Query: 879   CVAGDE--------CAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVR 930
              VA +E         A   V    V    V P+   Y   V  +  +      RP   + 
Sbjct: 16898 VVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTIT 16957

Query: 931   WTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEY----LCEIDDESASFTVTVTEP 986
             WTKDG  + ++  + +     +  L +     +D G+Y       +  ++AS  +   + 
Sbjct: 16958 WTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDK 17017

Query: 987   PVRIIYPRDEVTLIAVTLECVVL 1009
             P     P+  V    V+ E + L
Sbjct: 17018 PDP---PKGPVKFDDVSAESITL 17037



 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 44/198 (22%), Positives = 77/198 (38%), Gaps = 24/198 (12%)

Query: 1100  ELRCEVAPAG-SQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHE 1158
             +L C++       ++WY+ G E+  S   ++ ++G T TLT+   + ED G Y C     
Sbjct: 24246 QLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC----- 24300

Query: 1159  AITFNVILAEPPVQFLALETTPSPLCVAPGEPV----------VLSCELSRAGAPV---V 1205
              I  N +        L L+ TP      PG P+           L   +   G PV    
Sbjct: 24301 -IATNEVGEVETSSKLLLQATPQ---FHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMT 24356

Query: 1206  WSHNGRPVQEGEGLEL-HAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE 1264
             W H  + +Q  E + + + E    ++        HAG Y  Q     G       V++ +
Sbjct: 24357 WFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQD 24416

Query: 1265  PPVRVVAPEAAQTRVRST 1282
              P +   P   +  ++++
Sbjct: 24417 KPDKPTGPIVIEALLKNS 24434



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 40/149 (26%), Positives = 68/149 (45%), Gaps = 13/149 (8%)

Query: 925  PWAEVRWTKDGEEVVES--PALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVT 982
            P  EV W +DG+ +  S  P + +   D   +L +PAV   +SG Y  +  + S   T T
Sbjct: 33   PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATST 92

Query: 983  V-------TEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV-RWYKDGLEVEESEA 1034
                    T PP   +     +T+   +   V L   ++    PV ++Y+DG E++ S  
Sbjct: 93   AELLVKAETAPP-NFVQRLQSMTVRQGSQ--VRLQVRVTGIPTPVVKFYRDGAEIQSSLD 149

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDA 1063
              + ++G    L++  A PED G +  +A
Sbjct: 150  FQISQEGDLYSLLIAEAYPEDSGTYSVNA 178



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 75/330 (22%), Positives = 128/330 (38%), Gaps = 32/330 (9%)

Query: 516  SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIE-KAG 573
            SPP PP+   +    +  + + WKPPE    +P I Y +E   VG+E W++  S   K  
Sbjct: 7978 SPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDL 8037

Query: 574  AVEVPGDCVPSEGDYRFRICTVSGHGRS-PHVVFHGSAHLVPTARLVAGLE--DVQVYDG 630
              +V    VP + +Y  R+  V+  G S P  +        P  +    LE  D+ V +G
Sbjct: 8038 KFKVEEGVVPDK-EYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEG 8096

Query: 631  EDAVFSLDLSTIIQGT--WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKH 688
            E     +    +   T  W  +G+E+K+++          R  ++   +   L +     
Sbjct: 8097 EKLSIPVPFRAVPVPTVSWHKDGKEVKASD----------RLTMKNDHISAHLEVPKSVR 8146

Query: 689  QDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVD--FP 746
             D+G +   +      SA  +I    + +  P   +  +  T     LT E    D   P
Sbjct: 8147 ADAG-IYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTP 8205

Query: 747  ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFG-------- 798
               Y   ++       +  M G +++L      +  +GE+  R + V+   G        
Sbjct: 8206 ILHYVLERREAGRRTYIPVMSG-ENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKN 8264

Query: 799  -VTVQDPPVHIVDPREHVFVHAITSECVML 827
             V  QDP     DP   V VH  T+E + +
Sbjct: 8265 PVIAQDPK-QPPDPPVDVEVHNPTAEAMTI 8293



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 25/81 (30%), Positives = 40/81 (49%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G   +++  VLG P P V W+KG Q L  ++R++F        L +   + +D+G Y  
Sbjct: 14774 AGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPL 14833

Query: 85    RARNAAGEAYAAAAVTVLEPP 105
              ARN  GE      + V + P
Sbjct: 14834 TARNIVGEVGDVITIQVHDIP 14854



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 127/603 (21%), Positives = 215/603 (35%), Gaps = 98/603 (16%)

Query: 37    GEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAA 96
             G P   V W K GQ L  + R++  +      L +  A   D G Y     N+AG     
Sbjct: 19115 GRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVP 19174

Query: 97    AAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPR-SQWVLRGAEVVLTCRAGGLP 155
               + VL+ P     ++  E    S       P +  G + S +++   E   T       
Sbjct: 19175 ITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT------ 19228

Query: 156   EPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVY---VCHAR 212
                  W     A+                     A  +++I+  RL     Y   VC A 
Sbjct: 19229 -----WHIVSQAV---------------------ARTSIKIV--RLTTGSEYQFRVC-AE 19259

Query: 213   NAHG---HAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFW---VNEGKHAKFR 266
             N +G   ++++ A+  V + P SPP  P      VV   K      W   VN+G      
Sbjct: 19260 NRYGKSSYSESSAV--VAEYPFSPPGPP--GTPKVVHATKSTMLVTWQVPVNDGGSRVIG 19315

Query: 267   CYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCA------ 320
              ++  K    I W    + L+ D + +     D G + +         G+  C+      
Sbjct: 19316 YHLEYKERSSILWSKANKILIADTQ-MKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPV 19374

Query: 321   -ARNSA---GQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFRE 376
              AR+     GQ      +  K   L++++P  D   +  G  V   ++P           
Sbjct: 19375 PARDPCDPPGQP-EVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELP----------- 19422

Query: 377   DQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVK-GPILKR-- 433
             D R L C  Y  I+E       +  L  D    +    R    +V+  +   GPI+ +  
Sbjct: 19423 DGRWLKCN-YTNIQETYFE---VTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDD 19478

Query: 434   --LPRKLDVLEGENAVLL----VETLEAGVEGR------WSRDGEELPVICQS---SSGH 478
                PR +  ++  + +++    V  + A + GR      W++DG E+    ++   S+ +
Sbjct: 19479 VEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDN 19538

Query: 479   MHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKG-HKNTVLLT 537
                L +    R D G+   +L N   T  + V C     PGPP       G       L+
Sbjct: 19539 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLS 19598

Query: 538   W-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVS 596
             W +P E        Y +E++E     W  C    +  + +V    +    +Y FR+  V+
Sbjct: 19599 WGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTK--LLKGNEYIFRVTGVN 19656

Query: 597   GHG 599
              +G
Sbjct: 19657 KYG 19659



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 24/85 (28%), Positives = 43/85 (50%)

Query: 21    VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
             V + +G++  L   V G+P P ++W KG ++L   E++S    G     ++     +D+G
Sbjct: 22752 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 22811

Query: 81    VYVCRARNAAGEAYAAAAVTVLEPP 105
              Y    +NA+G    +  V VL+ P
Sbjct: 22812 KYTLTVKNASGTKAVSVMVKVLDSP 22836



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 87/433 (20%), Positives = 168/433 (38%), Gaps = 45/433 (10%)

Query: 516   SPPGPPILA-EMFKGHKNTVLLTW-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAG 573
             +PP PP    E+    K++V L+W +P +        Y +ER+E  ++ W++    +   
Sbjct: 24022 NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITT 24081

Query: 574   AVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLE--DVQVYDGE 631
              +      VP + +Y+FRI   +  G S            P +  V   +  D     GE
Sbjct: 24082 TMYTVTGLVP-DAEYQFRIIAQNDVGLS---------ETSPASEPVVCKDPFDKPSQPGE 24131

Query: 632   DAVFSLDLSTII--------QGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLIL 683
               + S+   ++          G   + G  ++  +        + + RI+ K      +L
Sbjct: 24132 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 24191

Query: 684   HAVKHQD---SGALVGFSCP---GVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLT 737
              A +++    +    G S P    +     LT  E+P      +D   +T    E   L+
Sbjct: 24192 EATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKD---VTTKLGEAAQLS 24248

Query: 738   CELSRVDFP-ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFEC----RTEG 792
             C++     P   WY+ G+++ +S    +  DGR H L +   + +D G + C        
Sbjct: 24249 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 24308

Query: 793   VSAFFGVTVQ-DPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESD 851
             V     + +Q  P  H   P +  +  A+ S   +    + R    + W+   + ++ S+
Sbjct: 24309 VETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSE 24368

Query: 852   FVVLENEGPHRRLVLPATQ-PSDGGEFQC----VAGDECAYFTVTITDVSSWIVYPSGKV 906
              + +EN   +  LV+   Q  +  G+++     V G   A   V I D       P+G +
Sbjct: 24369 NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD---KPTGPI 24425

Query: 907   YVAAVRLERVVLT 919
              + A+     V++
Sbjct: 24426 VIEALLKNSAVIS 24438



 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 42/188 (22%), Positives = 74/188 (39%), Gaps = 10/188 (5%)

Query: 1638  LEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGT 1697
             + + EG     +  ++ A  DV W  +G  LT S   R    G+ + L +++    D G 
Sbjct: 26743 MSINEGQRLVLKANIAGA-TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGI 26801

Query: 1698  YSCAVGTARAGPVR----LTVRER---TVAVLSELRSVSAREGDGATFECTVS-EVETTG 1749
              +C +   + G V+    LT+ +      A +S+ RS +  EG    F C +S E     
Sbjct: 26802 LTC-ISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEI 26860

Query: 1750  RWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQ 1809
              W     P+   + V I +    + L +      D+G+   +A   +         + L 
Sbjct: 26861 EWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLP 26920

Query: 1810  MCRHPPRE 1817
             +   P RE
Sbjct: 26921 LVEEPSRE 26928



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 2/100 (2%)

Query: 8    QGSPPCFL--RFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGA 65
            Q +P  FL  +    + V +G + EL   V G+P P + W K    L   +R++      
Sbjct: 7380 QEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPK 7439

Query: 66   EHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
            +  + +  +  +D G Y+  A N  G A A   V VL+ P
Sbjct: 7440 KSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKP 7479



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 34/147 (23%), Positives = 67/147 (45%), Gaps = 6/147 (4%)

Query: 461   WSRDGEELPVICQ---SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSP 517
             W +DG+ L    +   SSS  + +L +   ++ED G     + NS  +  + +  +    
Sbjct: 19123 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19182

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             PGPP    + +   +++ ++W PPE         Y +E++E  S  W          +++
Sbjct: 19183 PGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIK 19242

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSPH 603
             +      SE  Y+FR+C  + +G+S +
Sbjct: 19243 IVRLTTGSE--YQFRVCAENRYGKSSY 19267



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 60/268 (22%), Positives = 101/268 (37%), Gaps = 48/268 (17%)

Query: 1300  VRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQD-------SRIFLV 1352
             V WY    +L +  + ++       +L V+     D G Y C    D       + +F+ 
Sbjct: 25295 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVK 25354

Query: 1353  SVEEPL-------------------LVKLVSELT-PL---TVHEGDDATFRCEVSP-PDA 1388
              V E                     L++   E T PL   T + G++  F   ++  P+ 
Sbjct: 25355 GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEP 25414

Query: 1389  DVTWLRNGAVVTPGPQVEMAQNGSSR---ILTLRGCQLGDAGTVTLRA----GSTATSAR 1441
              VTW ++G  + PG   +     S +    LT+      D    T+ A    G  +  A+
Sbjct: 25415 HVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAK 25474

Query: 1442  L----HVRETEL----LFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHD 1493
             L    H   T+     +F R L +   +EGQ VC E+    +     ++W + GQPL   
Sbjct: 25475 LTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGI-PPPTLKWEKDGQPLSLG 25533

Query: 1494  SRLSMAQDG-HIHRLFIHGVILADQGTY 1520
               + +  +G   + L I   +  D G Y
Sbjct: 25534 PNIEIIHEGLDYYALHIRDTLPEDTGYY 25561



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 52/187 (27%), Positives = 87/187 (46%), Gaps = 19/187 (10%)

Query: 1725 LRSVSAREGDGATFECTVS-----EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSE 1779
            L+SV   EG  ATFE  +S     EV      ++      PG ++    +G+  + + + 
Sbjct: 12   LQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISF-SDGRAKLTIPAV 70

Query: 1780 LRAEDAGEVRFQA----GPAQSLA--LLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVS 1833
             +A ++G    +A    G A S A  L++ E  P    +   +  TV  G +  L+V V+
Sbjct: 71   TKA-NSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRL-QSMTVRQGSQVRLQVRVT 128

Query: 1834 RSGGHVC-WLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA----GQDSTH 1888
                 V  + R+GAE+     +++   G  +SL+I +  PED GTY   A    G+ ++ 
Sbjct: 129  GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST 188

Query: 1889 TRLLVEG 1895
              LLV+G
Sbjct: 189  AELLVQG 195



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 1812  RHPPREKTVLVGRRAVLEVT-VSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDV 1870
             R   ++ T  +G  A L    V R    + W R G EL    KY+M S G TH+L +   
Sbjct: 24231 RKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTE 24290

Query: 1871  RPEDQGTYCC----QAGQDSTHTRLLVE 1894
               ED+G Y C    + G+  T ++LL++
Sbjct: 24291 EQEDEGVYTCIATNEVGEVETSSKLLLQ 24318



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 44/93 (47%)

Query: 23   VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
            V+ G +  +       P P V W K G+++ AS+RL+   D     L +  ++  DAG+Y
Sbjct: 8093 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 8152

Query: 83   VCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
                 N  G A A+  V V+  P    +++ ++
Sbjct: 8153 TITLENKLGSATASINVKVIGLPGPCKDIKASD 8185



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 26/85 (30%), Positives = 40/85 (47%)

Query: 21    VRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAG 80
             + V  G    +   V G P P + W K G+ L   +R+    D     L +  A+  D G
Sbjct: 11613 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 11672

Query: 81    VYVCRARNAAGEAYAAAAVTVLEPP 105
              Y+  A+N++G A  +A V VL+ P
Sbjct: 11673 KYIISAKNSSGHAQGSAIVNVLDRP 11697



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 33/101 (32%), Positives = 42/101 (41%), Gaps = 2/101 (1%)

Query: 7     DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVW--EKGGQQLAASERLSFPADG 64
             D   P   L+    + V +G    L+  V G+P P V W  +K    L  S R+      
Sbjct: 11892 DLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRA 11951

Query: 65    AEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
                   LT A  +D G YV  A N AG   A A V VL+ P
Sbjct: 11952 DSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP 11992



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 8/149 (5%)

Query: 461   WSRDGEEL---PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSP 517
             WS+ G+++    +   +S+     L +   TR+DAGE T +  N   T +  VK      
Sbjct: 14108 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDV 14167

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPF-IYRLERQEVGSEDW-IQCFSIEKAGAV 575
             PGPP   E+         LTW PP     +P   Y LE++E     W +    I+    V
Sbjct: 14168 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHV 14227

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRSPHV 604
                   +    +Y FR+  V+ +G+   V
Sbjct: 14228 ATK---LIQGNEYIFRVSAVNHYGKGEPV 14253



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 248   LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVLKV 306
             ++  P    ++EGK     C   G+P PE+ W   GR +   ++ R    + D    L +
Sbjct: 27026 IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLII 27085

Query: 307   LYCQAKDRGLYVCAARNSAGQTLSAVQLHVK 337
             +  Q +D GLY  +  N  G   + V +H++
Sbjct: 27086 MDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 27116



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 83/382 (21%), Positives = 142/382 (37%), Gaps = 51/382 (13%)

Query: 482  LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP 541
            LV+    R D G  T  L N   T    +     + P  P   +     K++V LTW+PP
Sbjct: 7147 LVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPP 7206

Query: 542  EPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVS--GH 598
            +    +P   Y +E++EV  + W +           VP D V  + +Y F++C  +  G 
Sbjct: 7207 DDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVP-DLVQGK-EYLFKVCARNKCGP 7264

Query: 599  GRSPHV---VFHGSAHLVP-----------TARLVAGLEDVQVYDGEDAVFSLDLSTIIQ 644
            G   +V   V   +   VP           TA  +    D    DG   +    +    +
Sbjct: 7265 GEPAYVDEPVNMSTPATVPDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPR 7324

Query: 645  GT--WFLNGEELKSNEPE--GQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCP 700
            G+  W   GE +   + E  G  E     YR++    Q                 G S P
Sbjct: 7325 GSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQ-----------------GASKP 7367

Query: 701  G--VQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFP-ATWYKDGQKVE 757
                ++  A+  QE+P   L  +    LT     ++ L   ++    P  TW K    ++
Sbjct: 7368 SRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILK 7427

Query: 758  ESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGV----SAFFGVTVQDPPVHIVDPRE 813
            + + + ++   +K  + + ++K  D+G +      V    +A   V V D P     P  
Sbjct: 7428 QDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKP----GPPA 7483

Query: 814  HVFVHAITSECVMLACEVDRED 835
               +  +T+E  +L     R+D
Sbjct: 7484 AFDITDVTNESCLLTWNPPRDD 7505



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 38/163 (23%), Positives = 62/163 (38%), Gaps = 16/163 (9%)

Query: 7     DQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE 66
             +Q  PP  L  P  + + +G +  ++  V G+P P   W+KG  ++  S  L+     + 
Sbjct: 12590 EQLLPPKIL-MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSS 12648

Query: 67    HGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPAS----------DPELQPAER 116
               L++      D+G Y   A N++G       V V++ P            D +      
Sbjct: 12649 SILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSW 12708

Query: 117   PLPSPGSGEGAPVFLTG----PRSQWVLRGAEVVLT-CRAGGL 154
              +P    G     ++       R  WV   A V  T CR G L
Sbjct: 12709 HIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKL 12751



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 117/570 (20%), Positives = 217/570 (38%), Gaps = 77/570 (13%)

Query: 345   RPLQDVEGREHGIAVLECKVPNSRIPTA-WFREDQRLLPCRKYEQIEEGTVRRLIIHRLK 403
             + ++DV  +    A L C++    +P   W+R  + L+  RKY+   +G    L +   +
Sbjct: 24232 KEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEE 24291

Query: 404   ADDDGIYLCEMRGRVRTVANVTVKGPILKRLPR---------KLDVLEGENAVLLVETLE 454
              +D+G+Y C     V  V   T    +L+  P+         K     G    L V  + 
Sbjct: 24292 QEDEGVYTCIATNEVGEVE--TSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIG 24349

Query: 455   AGVEGRWSRDGEEL----PVICQSSSGHMHALVLPGVTRED-AGEVTFSLGNSRTTTL-- 507
               V       G++L      I   ++ H   LV+  V R+  AG+    L N   T    
Sbjct: 24350 RPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAI 24409

Query: 508   --LRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE-----TPFIYRLERQEVGS 560
               + ++     P GP ++  + K   N+ +++WKP  PA +     T ++      + G+
Sbjct: 24410 LDVEIQDKPDKPTGPIVIEALLK---NSAVISWKP--PADDGGSWITNYVVEKCEAKEGA 24464

Query: 561   EDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSP-----HVVFHGSAHLVPT 615
             E W    S        +    +     Y FR+   +  G S       VV   S    P 
Sbjct: 24465 E-WQLVSSAISVTTCRIVN--LTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPG 24521

Query: 616   ARLVAGLEDVQVYDGEDAVFSLDLSTIIQGT----WFLNGEELKSNE----PEGQVEPGA 667
             A    G   +     +  V +        G     ++L   E K N+       ++    
Sbjct: 24522 A---PGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETV 24578

Query: 668   LRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSP---QDRV 724
                +   +GL++      VK ++ G    +S    + S  +T  +S V I +P   ++  
Sbjct: 24579 FSVKNLIEGLEYEF---RVKCENLGGESEWS----EISEPIT-PKSDVPIQAPHFKEELR 24630

Query: 725   SLTFTTSERVVLTCELSRVDFPAT-WYKDGQKVEESELL--VVKMDGRKHRLILPEAKVQ 781
             +L         L C+++    P   WY+ G+++    L   + +  G  H+LI+      
Sbjct: 24631 NLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDD 24690

Query: 782   DSGEFECRTEG----VSAFFGVTVQDPP-VHIVDPREHV-FVHAITSECVMLACEVDRED 835
             D+  ++ R       VS    + V+ P  +H+    E +  VHA+  E V +      + 
Sbjct: 24691 DATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 24750

Query: 836   APVRWYKDGQEVEESDFVVLENEGPHRRLV 865
              PV  ++ GQ+       +++N G ++ +V
Sbjct: 24751 DPVITWQKGQD-------LIDNNGHYQVIV 24773



 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 60/287 (20%), Positives = 101/287 (35%), Gaps = 49/287 (17%)

Query: 1461  EEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTY 1520
             EEG  V    +      +  V W  G + L +  +  +  +  +  L++  +   D GTY
Sbjct: 25275 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 25334

Query: 1521  GCESHHD------------------------RTLARLSVRPRQLRVLRPLEDVTISEGGS 1556
              C+  +D                        RT+ ++  R   +R+L    + T+     
Sbjct: 25335 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 25394

Query: 1557  ATFQLELSQEGVT--------GEWARGGVQLYPG---PKCHIHSDGHRHRLVLNGLGLAD 1605
               +  E  + GVT          W + G ++ PG    K    SD   ++L +N +   D
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25454

Query: 1606  SGCVSFTA------DSLRCAARLIVREVPVTIVRGP------HDLEVTEGDTATFECELS 1653
                 +  A      DS +    + +   P      P       + E  EG +  FE  +S
Sbjct: 25455 DAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVS 25514

Query: 1654  Q-ALADVTWEKDGNALTPSPRLRLQALG-TRRLLQLRRCGPSDAGTY 1698
                   + WEKDG  L+  P + +   G     L +R   P D G Y
Sbjct: 25515 GIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 25561



 Score = 44.7 bits (104), Expect = 9e-04
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 6/107 (5%)

Query: 16    RFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAAL 75
             +F   + V +G    L+  V G+P P + W +G +++  S R        +  L++  A+
Sbjct: 17325 KFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAI 17384

Query: 76    PTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
               D G Y+ RA N AG       V VL+ P       P E P+   G
Sbjct: 17385 RIDGGQYILRASNVAGSKSFPVNVKVLDRPG------PPEGPVQVTG 17425



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 45/180 (25%), Positives = 75/180 (41%), Gaps = 17/180 (9%)

Query: 1284 GGDLELVVHLSG-PGGPVRWYKDGERLASQGR--VQLEQAGARQVLRVQGARSGDAGEYL 1340
            G       H+SG P   V W++DG+ +++     VQ+  +  R  L +      ++G Y 
Sbjct: 20   GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYS 79

Query: 1341 CDAPQDSRIFLVSVEEPLLVK-------LVSELTPLTVHEGDDATFRCEVSP-PDADVTW 1392
              A   S     + E  LLVK        V  L  +TV +G     +  V+  P   V +
Sbjct: 80   LKATNGSGQATSTAE--LLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKF 137

Query: 1393 LRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETE 1448
             R+GA +      +++Q G    L +      D+GT ++ A    G   ++A L V+  E
Sbjct: 138  YRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEE 197



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 29/110 (26%), Positives = 43/110 (39%), Gaps = 2/110 (1%)

Query: 12   PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLL 71
            P   R   P+ V  G  A+  C +   P     W K G+++  S++ S  +      L +
Sbjct: 4529 PVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEI 4588

Query: 72   TAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDP--ELQPAERPLP 119
                  D G Y C+A N  G     A +TV  P       +L P  +P P
Sbjct: 4589 LRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKPEP 4638



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 23/75 (30%), Positives = 35/75 (46%)

Query: 31    LKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAA 90
             LK  + G+P P V W+KG   LA   R+S  +      L++     +DAG Y    +N A
Sbjct: 13697 LKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVA 13756

Query: 91    GEAYAAAAVTVLEPP 105
             G      ++ V+  P
Sbjct: 13757 GTKEGTISIKVVGKP 13771



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 30/104 (28%), Positives = 44/104 (42%), Gaps = 6/104 (5%)

Query: 15    LRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
             ++F   V + +G    L+  V G PPP + W K G++L  + +L          L+   +
Sbjct: 15160 VKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS 15219

Query: 75    LPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPL 118
                D+G Y   A N  G A     V VL+ P       P E PL
Sbjct: 15220 TRRDSGAYTLTATNPGGFAKHIFNVKVLDRPG------PPEGPL 15257



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G + ++     G PPP V W K  + L +  R S     +   L +      D G Y+ 
Sbjct: 20980 AGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYIL 21039

Query: 85    RARNAAGEAYAA-AAVTVLEPPASDPELQ 112
                N  GE  ++  +V VL+ PA+  +LQ
Sbjct: 21040 TIENGVGEPKSSTVSVKVLDTPAACQKLQ 21068



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 50/213 (23%), Positives = 75/213 (35%), Gaps = 40/213 (18%)

Query: 1721  VLSELRSVSAREGDGATFECTVSEVE--TTGRWELGGRPLRPGARVRIRQEGKKHILVLS 1778
             V  ++      EG    + C +   +  T   W  G R L    +  I  E    IL + 
Sbjct: 25265 VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVK 25324

Query: 1779  ELRAEDAGEVRFQA----GPAQSLALLEVEAL--------------------PLQMCRHP 1814
             ++   D G  R +     G   S A L V+ +                     +++   P
Sbjct: 25325 DITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERP 25384

Query: 1815  PR------EKTVLVGRRAVLEVTVS-RSGGHVCWLREGAELCPGD---KYEMRSHGPTHS 1864
             P        KT  VG      VT++     HV W + G ++ PGD   KY   S    + 
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25444

Query: 1865  LVIHDVRPEDQGTYCCQA----GQDSTHTRLLV 1893
             L I+ V  +D   Y   A    G+DS   +L V
Sbjct: 25445 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 28/91 (30%), Positives = 37/91 (40%), Gaps = 1/91 (1%)

Query: 12    PCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAE-HGLL 70
             P F R         G     +  V G PPP + WEK GQ L+    +    +G + + L 
Sbjct: 25490 PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 25549

Query: 71    LTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
             +   LP D G Y   A N AG     A + V
Sbjct: 25550 IRDTLPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP 541
             L +     ED G  + ++ N   +  + VK +    PGPP   E+ +  K++  LTWK P
Sbjct: 10969 LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEP 11028

Query: 542   -EPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR 600
              +        Y +ER++V S  W    +  K  +       +     Y FR+   + +GR
Sbjct: 11029 LDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKH--LNEGNQYLFRVAAENQYGR 11086

Query: 601   SPHV 604
              P V
Sbjct: 11087 GPFV 11090



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 29/90 (32%), Positives = 43/90 (47%), Gaps = 8/90 (8%)

Query: 517  PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
            PPGPP   E+    K+++ L WKPP     +P   Y +E QE G+ DW +   + +   +
Sbjct: 9399 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKR---VNEPDKL 9455

Query: 576  EVPGDCVPSE----GDYRFRICTVSGHGRS 601
                +CV         YRFR+  V+  G S
Sbjct: 9456 ITTCECVVPNLKELRKYRFRVKAVNEAGES 9485



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 23/83 (27%), Positives = 32/83 (38%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +G       ++ G P P   W   G ++   E  +   D     L +   L  D G Y
Sbjct: 11217 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 11276

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                  NAAG    A  +TVL+ P
Sbjct: 11277 QITVSNAAGSKTVAVHLTVLDVP 11299



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 100/465 (21%), Positives = 172/465 (36%), Gaps = 60/465 (12%)

Query: 1021  RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER 1080
             +W  DG E++  E   +E D     L +      D GE+     + +   TV V      
Sbjct: 11238 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 11297

Query: 1081  IVHPAARSLDLHFGAPGRVELRCEVAP--AGSQVRWYKDGLEVEASDALQLGAEGPTRT- 1137
             +  P    +++    P  + +  +      GS V  Y    +    D   + + G ++T 
Sbjct: 11298 VPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTK 11357

Query: 1138  LTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALE-----TTPSPLCVAPGEPVV 1192
             L +PH Q     EYV   R E    N I   PP+           + PSP    PG+PVV
Sbjct: 11358 LKIPHLQK--GCEYVFRVRAE----NKIGVGPPLDSTPTVAKHKFSPPSP----PGKPVV 11407

Query: 1193  LSCELSRAGAPVVW----SHNGRPVQ---------EGEGLELHAEGPRRVLCIQAAGPAH 1239
                +++   A V W    S  G P+           G+ + ++ + P   L  +  G   
Sbjct: 11408 T--DITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVN-KTPIADLKFRVTGLYE 11464

Query: 1240  AGLYTCQ------SGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHL 1293
                Y  +      +G +  +PS S  ++   P      P   + + +S    DL     L
Sbjct: 11465 GNTYEFRVFAENLAGLSKPSPS-SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPL 11523

Query: 1294  SGPGGPVRWY-----KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDA----- 1343
             S  G P+  Y     K G   A   R+  ++   +   RV G   G+   +   A     
Sbjct: 11524 SDGGSPILGYVVECQKPGT--AQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVG 11581

Query: 1344  ---PQD--SRIFLVSVEEPLLVKL-VSELTPLTVHEGDDATFRCEVSP-PDADVTWLRNG 1396
                P++    +    +  P  V+L V+    +TV  G        V   P+ D+TW + G
Sbjct: 11582 EGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG 11641

Query: 1397  AVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSAR 1441
              V+    +V++ Q+     L ++     D G   + A +++  A+
Sbjct: 11642 KVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQ 11686



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 72/378 (19%), Positives = 127/378 (33%), Gaps = 62/378 (16%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             R + V +G    +   + G P P V W K    L    R +     +   L++      D
Sbjct: 14479 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL--KNRANIENTESFTLLIIPECNRYD 14536

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPR-SQ 137
              G +V    N AG+      V VL+ P     L+P +    S       P+   G R + 
Sbjct: 14537 TGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITN 14596

Query: 138   WVLRGAEV-------------------------------VLTCRAGGLPEPTLYWEK--- 163
             +++   E                                V+     G+ EPT   E    
Sbjct: 14597 YIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKA 14656

Query: 164   -------DGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYV-------- 208
                    D + + ++  S+     P    DG G+ +   ++ A+   S  +         
Sbjct: 14657 SEAPSPPDSLNIMDITKSTVSLAWPKPKHDG-GSKITGYVIEAQRKGSDQWTHITTVKGL 14715

Query: 209   -CHARN-AHGHAQAGALLQVHQPPESPPADP------DEAPAPVVEPLKCAPKTFWVNEG 260
              C  RN   G      ++ V+    S P +       ++   P ++      K      G
Sbjct: 14716 ECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQKLVIAKAG 14775

Query: 261   KHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCA 320
              + K    V+G+P+P + W  +G  +L   +R+ +       +L +  C   D G Y   
Sbjct: 14776 DNIKVEIPVLGRPKPTVTWK-KGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLT 14834

Query: 321   ARNSAGQTLSAVQLHVKE 338
             ARN  G+    + + V +
Sbjct: 14835 ARNIVGEVGDVITIQVHD 14852



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 24/83 (28%), Positives = 39/83 (46%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             + +G + +++  V+G P P + W K G+ L  + R++         L +      D G Y
Sbjct: 18018 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 18077

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                A N+AG A    +V VLE P
Sbjct: 18078 TVTATNSAGTATENLSVIVLEKP 18100



 Score = 43.1 bits (100), Expect = 0.003
 Identities = 22/92 (23%), Positives = 40/92 (43%)

Query: 10    SPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
             S P  +   +   V S + A+      GEP P  +W K G+ +    +     D     L
Sbjct: 26545 SKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFL 26604

Query: 70    LLTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
              +     +D+G+Y C  +N+AG   ++  +T+
Sbjct: 26605 EIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 26636



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 52/216 (24%), Positives = 87/216 (40%), Gaps = 29/216 (13%)

Query: 727 TFTTSERVVLTCELSRVDFPA----------TWYKDGQKVEESELLVVKM---DGRKHRL 773
           TFT   + V+  E S   F A          +W++DGQ +  S L  V++   DGR  +L
Sbjct: 7   TFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA-KL 65

Query: 774 ILPEAKVQDSGEFECRTEGVS------AFFGVTVQDPPVHIVDPREHVFVHAITSECVML 827
            +P     +SG +  +    S      A   V  +  P + V   + + V   +   V L
Sbjct: 66  TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ--VRL 123

Query: 828 ACEVDREDAPV-RWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECA 886
              V     PV ++Y+DG E++ S    +  EG    L++    P D G +   A +   
Sbjct: 124 QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183

Query: 887 YFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCEL 922
             T T        +   G+  V A + + +V T ++
Sbjct: 184 RATSTAE------LLVQGEEEVPAKKTKTIVSTAQI 213



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 38/122 (31%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 219   QAGALLQVHQPPESPPADPDEAPAPVVEP---LKCAPKTFW-VNEGKHAKFRCYVMGKPE 274
             +A A   V+  P S P+DP    A  V P   L  A K+   V  G +      V GKP 
Sbjct: 12960 RAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPM 13019

Query: 275   PEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             P + W  +G  L P     M   R+    L++     KD G Y   A NS+G   + ++L
Sbjct: 13020 PTVSWKKDGTLLKPAEGIKMAMQRN-LCTLELFSVNRKDSGDYTITAENSSGSKSATIKL 13078

Query: 335   HV 336
              V
Sbjct: 13079 KV 13080



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 23/87 (26%), Positives = 34/87 (39%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             + + V +G   EL   + G PPP   W   G +L  SER++         L +      D
Sbjct: 23441 KTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRD 23500

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPP 105
              G Y    +N  G       V +L+ P
Sbjct: 23501 TGEYTLELKNVTGTTSETIKVIILDKP 23527



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 48/225 (21%), Positives = 86/225 (38%), Gaps = 25/225 (11%)

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
             G    L+C+  G P P + W + G    E+  S  + +         G +  L ++    
Sbjct: 24242 GEAAQLSCQIVGRPLPDIKWYRFGK---ELIQSRKYKMS------SDGRTHTLTVMTEEQ 24292

Query: 202   PDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGK 261
              D GVY C A N  G  +  + L +   P+  P            PLK   + ++   G 
Sbjct: 24293 EDEGVYTCIATNEVGEVETSSKLLLQATPQFHPG----------YPLK---EKYYGAVGS 24339

Query: 262   HAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDR-GLYVCA 320
               +     +G+P P + W + G+ LL +   +   + +    L +   Q K   G Y   
Sbjct: 24340 TLRLHVMYIGRPVPAMTW-FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQ 24398

Query: 321   ARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVP 365
               N  G   + + + +++   + T P+  +E      AV+  K P
Sbjct: 24399 LSNVFGTVDAILDVEIQDKPDKPTGPIV-IEALLKNSAVISWKPP 24442



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 24/99 (24%), Positives = 41/99 (41%), Gaps = 2/99 (2%)

Query: 5     SGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADG 64
             +G +G PP     P  + +  G    + C   GEP P V W  GG+++ + E+  F  + 
Sbjct: 27017 AGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIEN 27076

Query: 65    AEH--GLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTV 101
              +    L++      D G+Y     N  G   A   + +
Sbjct: 27077 TDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/83 (30%), Positives = 35/83 (42%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             + SG    +K +V G P P V W K G ++     +          L +  A     GVY
Sbjct: 21665 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 21724

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                A+NA+G A A   V V + P
Sbjct: 21725 TVEAKNASGSAKAEIKVKVQDTP 21747



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 119/577 (20%), Positives = 207/577 (35%), Gaps = 118/577 (20%)

Query: 1111 QVRWYKDGLEVEASDALQLG-AEGPTRTLTLPHAQPEDAGEYVC---ETRHEAITFNVIL 1166
            ++ WYKDG  ++  +  Q+   +    +L +P   PED G Y       +  AI    + 
Sbjct: 1275 KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY 1334

Query: 1167 AEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGP 1226
             EP     A      P  +   EPV      SR  +    S +  P++           P
Sbjct: 1335 VEPAAPLGA------PTYIPTLEPV------SRIRSLSPRSVSRSPIRMSPA----RMSP 1378

Query: 1227 RRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGD 1286
             R+       PA         G        S   ++ +P V V+ P + +     T   D
Sbjct: 1379 ARM------SPARMSPARMSPGRRLEETDESQLERLYKP-VFVLKPVSFKCLEGQTARFD 1431

Query: 1287 LELVVHLSGPGGPVRWYKDGERLASQ--GRVQLEQAGARQVLRVQGARSGDAGEYLCDAP 1344
            L++V     P     W+ DG+++ +    +V +++ G + ++ V    S D+GE+   A 
Sbjct: 1432 LKVV---GRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPS-DSGEWTVVAQ 1487

Query: 1345 QDSRIFLVSV-------EEPLLVKLVSELTPLTVHEGDDATFRCEVSP-PDADVTWLRNG 1396
              +    +SV       E  +    V +L  + + EG     +   +  P+ D+ WL+N 
Sbjct: 1488 NRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNS 1547

Query: 1397 AVVTPG--PQVEMAQNGSSRILTLRGCQLGDA----GTVTLRAGSTATSARLHVR----- 1445
             ++ P   P++ +        L +      D+     T   +AG   T  +++V      
Sbjct: 1548 DIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAE 1607

Query: 1446 ---ETELLFLR---RLQDVRAEE--------GQDVCLE--------------------VE 1471
               E +L+  R   R +++ A E        GQ+   E                    + 
Sbjct: 1608 PEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLR 1667

Query: 1472 TGRVGAAG-------------AVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQG 1518
              R G A               V W+  G+PL   +RL M  +     L        D G
Sbjct: 1668 LKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSG 1727

Query: 1519 TYGCESHH----DRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLE----LSQEG-VT 1569
               C + +    D T A L V+  +  V    E+  + EG     ++E    ++ EG +T
Sbjct: 1728 IITCRATNKYGTDHTSATLIVKDEKSLV----EESQLPEGRKGLQRIEELERMAHEGALT 1783

Query: 1570 G------EWARGGVQLYPGPKCHIHSDGHRHRLVLNG 1600
            G      E  +  + LYP P   +  +  R R  + G
Sbjct: 1784 GVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTG 1820



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 40/139 (28%), Positives = 50/139 (35%), Gaps = 23/139 (16%)

Query: 205  GVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVV----EPLKCAPKTFWVNEG 260
            G YVC A N  G     A L V +             APV+    EPL+ A        G
Sbjct: 4502 GEYVCEALNDSGKTATSAKLTVVK-----------RAAPVIKRKIEPLEVAL-------G 4543

Query: 261  KHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCA 320
              AKF C +   P    +W   GR +  +  +   R       L++L  Q  D G Y C 
Sbjct: 4544 HLAKFTCEIQSAPNVRFQWFKAGREIY-ESDKCSIRSSKYISSLEILRTQVVDCGEYTCK 4602

Query: 321  ARNSAGQTLSAVQLHVKEP 339
            A N  G       L V  P
Sbjct: 4603 ASNEYGSVSCTATLTVTVP 4621



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 79/341 (23%), Positives = 128/341 (37%), Gaps = 51/341 (14%)

Query: 105   PASDPELQPAERPLPSPG----------SGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGL 154
             P+SDP    A RP+  PG          S E A +  T P S         V+ C+  G 
Sbjct: 11485 PSSDPI--KACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPG- 11541

Query: 155   PEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNA 214
                T  W +  +  DE+     F + PG  E   G     RI AA +   G         
Sbjct: 11542 ---TAQWNR--INKDELIRQCAFRV-PGLIE---GNEYRFRIKAANIVGEG-------EP 11585

Query: 215   HGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPE 274
                A++     +  PPE             VE          V  G+  +    V G+PE
Sbjct: 11586 RELAESVIAKDILHPPE-------------VELDVTCRDVITVRVGQTIRILARVKGRPE 11632

Query: 275   PEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             P+I W  EG+ L+ ++R  + +D      L++      D G Y+ +A+NS+G    +  +
Sbjct: 11633 PDITWTKEGKVLVREKRVDLIQDLP-RVELQIKEAVRADHGKYIISAKNSSGHAQGSAIV 11691

Query: 335   HVKEPRLRFTRPLQDVE----GREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIE 390
             +V    L    P Q+++     +E+     E  + N       F  + R    + +  + 
Sbjct: 11692 NV----LDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVA 11747

Query: 391   EGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPIL 431
                 +RLI   L A+++  +      +V     +  K PIL
Sbjct: 11748 SDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPIL 11788



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 25/100 (25%), Positives = 41/100 (41%), Gaps = 1/100 (1%)

Query: 239   EAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDR 298
             EA   ++ P    P+   +  GK  +   +V GKP P  +W  +G   +     L     
Sbjct: 12587 EAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWK-KGEDEVVTSSHLAVHKA 12645

Query: 299   DGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKE 338
             D   +L +     KD G Y   A NS+G     +++ V +
Sbjct: 12646 DSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMD 12685



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 1/85 (1%)

Query: 458   EGRWSRD-GEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHS 516
             E +W+RD GE L      S+     L++  V R D+G+   ++ NS  +    V      
Sbjct: 15586 EVKWARDHGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLD 15645

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPP 541
              PGPP   ++ +  K +V LTW PP
Sbjct: 15646 TPGPPQDLKVKEVTKTSVTLTWDPP 15670



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 34/119 (28%), Positives = 47/119 (39%), Gaps = 11/119 (9%)

Query: 231   ESPPADPDEAPAPVVEP-------LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEG 283
             E   +DP     PV+         LK    T+ +  G+  K    V+G+P P I W  +G
Sbjct: 17985 EKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDG 18044

Query: 284   RPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAG---QTLSAVQLHVKEP 339
              P L    R+   +     VL +      D G Y   A NSAG   + LS + L    P
Sbjct: 18045 EP-LKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGP 18102



 Score = 42.0 bits (97), Expect = 0.006
 Identities = 23/91 (25%), Positives = 42/91 (46%)

Query: 15    LRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
             L +   V+  +G   +L+  + G+P P + W K  ++L  +  +          +L+  A
Sbjct: 20571 LEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDA 20630

Query: 75    LPTDAGVYVCRARNAAGEAYAAAAVTVLEPP 105
                ++G Y  + RNA G A A   V +L+ P
Sbjct: 20631 DRLNSGCYELKLRNAMGSASATIRVQILDKP 20661



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 21/182 (11%)

Query: 1178 TTPSPLCVAPGEPVVL------SCELSRAGAPVV---WSHNGRPVQEGE--GLELHAEGP 1226
            TT +P    P + VV+      + E   +G PV    W  +G+ +      G+++     
Sbjct: 2    TTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDG 61

Query: 1227 RRVLCIQAAGPAHAGLYTCQ----SGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRST 1282
            R  L I A   A++G Y+ +    SG A     L    + A PP  V   ++   R    
Sbjct: 62   RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA-PPNFVQRLQSMTVR---- 116

Query: 1283 PGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
             G  + L V ++G P   V++Y+DG  + S    Q+ Q G    L +  A   D+G Y  
Sbjct: 117  QGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSV 176

Query: 1342 DA 1343
            +A
Sbjct: 177  NA 178



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/101 (28%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQL-AASERLSFPADGAEHGLLLTAALPTDAGV 81
             V +G    L+  + G+P P VVW K G++L   + R+   +   +  L++   + TD G 
Sbjct: 18414 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18473

Query: 82    YVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
             Y+ +  N  G       V VL+ P       P E PL   G
Sbjct: 18474 YILKLSNVGGTKSIPITVKVLDRPG------PPEGPLKVTG 18508



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 68/300 (22%), Positives = 118/300 (39%), Gaps = 39/300 (13%)

Query: 516   SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC-FSIEKAG 573
             SP  PP   +     + T+ L W PP     +  + Y +E+++ G+E W++C F+     
Sbjct: 21548 SPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQ-GNERWVRCNFTDVSEC 21606

Query: 574   AVEVPGDCVPSEGD-YRFRIC------TVSGHGRSPHVVFHGSAHLVPTARLVAGLED-V 625
                V G    S GD Y FRI       T+S   +S  ++     ++ P         D +
Sbjct: 21607 QYTVTG---LSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGL 21663

Query: 626   QVYDGEDAVFSLDLSTIIQG------TWFLNGEEL-KSNEPEGQVEPGALRYRIEQKGLQ 678
              +  GE    SL +  ++QG      TWF +G E+ K    E     G+    +      
Sbjct: 21664 IIKSGE----SLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRD 21719

Query: 679   HRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTC 738
             HR +        SG+         +    + +Q++P  ++ P   +  T  T E++ L  
Sbjct: 21720 HRGVYTVEAKNASGS--------AKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWW 21768

Query: 739   ELSRVD--FPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF 796
             +    D   P T Y   +K E S L    ++ +         K+ +  E++ R   V+ F
Sbjct: 21769 DAPLNDGCAPITHYII-EKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKF 21827



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 38/150 (25%), Positives = 57/150 (38%), Gaps = 30/150 (20%)

Query: 80   GVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWV 139
            G YVC A N +G+   +A +TV++  A  P ++    PL                    V
Sbjct: 4502 GEYVCEALNDSGKTATSAKLTVVKRAA--PVIKRKIEPLE-------------------V 4540

Query: 140  LRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAA 199
              G     TC     P     W K G    E+++S   +++  +         +L IL  
Sbjct: 4541 ALGHLAKFTCEIQSAPNVRFQWFKAGR---EIYESDKCSIRSSKYIS------SLEILRT 4591

Query: 200  RLPDSGVYVCHARNAHGHAQAGALLQVHQP 229
            ++ D G Y C A N +G     A L V  P
Sbjct: 4592 QVVDCGEYTCKASNEYGSVSCTATLTVTVP 4621



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 54/252 (21%), Positives = 102/252 (40%), Gaps = 38/252 (15%)

Query: 373  WFREDQRLLPCRKY--EQIEEGTVRRLIIHRLKADDDG-------IYLCEMRGRVRTVAN 423
            W R  ++++  R+Y  ++I EG   +L +  + A  +G       + + E +       +
Sbjct: 8743 WSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGEGPPGETQPVTVAEPQEPPAVELD 8802

Query: 424  VTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGR------WSRDGEELPV--ICQSS 475
            V+VKG I         ++ G+        + A V GR      W+++  EL    +   +
Sbjct: 8803 VSVKGGI--------QIMAGKTL-----RIPAVVTGRPVPTKVWTKEEGELDKDRVVIDN 8849

Query: 476  SGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVL 535
             G    L++    R+D G    +  NS  +     +      PGP +  +    ++   L
Sbjct: 8850 VGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCL 8909

Query: 536  LTWKPPEP---APETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRI 592
            L W  PE    +  T FI  +ER++     W Q    E++   ++ G  +    +Y+FR+
Sbjct: 8910 LNWSDPEDDGGSEITGFI--IERKDAKMHTWRQPIETERS-KCDITG--LLEGQEYKFRV 8964

Query: 593  CTVSGHGRSPHV 604
               +  G  P V
Sbjct: 8965 IAKNKFGCGPPV 8976



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 34/112 (30%), Positives = 46/112 (41%), Gaps = 11/112 (9%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +G    L   V G+P P V W+K G  L  +E +          L L +    D+G Y
Sbjct: 13002 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 13061

Query: 83    VCRARNAAGEAYAAAAVTVLE---PPA--------SDPELQPAERPLPSPGS 123
                A N++G   A   + VL+   PPA        SD  +   E PL   GS
Sbjct: 13062 TITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGS 13113



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PPGPP   +++   +++V L+W  P     +P I Y +E +   S++W++C   +     
Sbjct: 13283 PPGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 13342

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS 601
                   +  +  Y+FR+  V+  G S
Sbjct: 13343 RFEVTGLMEDTQYQFRVYAVNKIGYS 13368



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 108/551 (19%), Positives = 196/551 (35%), Gaps = 81/551 (14%)

Query: 418   VRTVANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPVICQ--- 473
             V  +A   V  P  K L     VL GE+  + V  +        W +D   L    +   
Sbjct: 15832 VPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNA 15891

Query: 474   SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPI-LAEMFKGHKN 532
              S+ +   L +    RED G     L NS    +  +  +    PGPP    +M +   +
Sbjct: 15892 ESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTAD 15951

Query: 533   TVLLTWKPPE-PAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFR 591
             ++ L+W PP+     +   Y +E+++  +  W Q  S   A    +    + +  +Y+FR
Sbjct: 15952 SITLSWGPPKYDGGSSINNYIVEKRDTSTTTW-QIVSATVA-RTTIKACRLKTGCEYQFR 16009

Query: 592   ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
             I   + +G+S ++    +    P               G      + LS+        + 
Sbjct: 16010 IAAENRYGKSTYLNSEPTVAQYPFK-----------VPGPPGTPVVTLSS-------RDS 16051

Query: 652   EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQ 711
              E++ NEP        + Y +E+K  +   IL    ++       F   G+++      +
Sbjct: 16052 MEVQWNEPISDGGSRVIGYHLERK--ERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFR 16109

Query: 712   ESPVHI--LSPQDRVSLTFTT---------SERVVLTCELSRVDFPATWYKDGQK----- 755
              S  +I  +    +VS  +            E +++T     + +    Y  G K     
Sbjct: 16110 VSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYI 16169

Query: 756   VEESELLVVKMDGR---------------------KHRLILPEAKVQDSGEFECRTEGVS 794
             VE+ EL     +GR                      HR          +G F   +E   
Sbjct: 16170 VEKKEL----PEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTG 16225

Query: 795   AFFGVTVQDPPVHIVDP--REHVFVHAITSECVMLACEVDREDAP-VRWYKDGQEVEESD 851
             A       DPP   +DP  ++ + VHA   E   +  ++  +  P ++W K  QE+  + 
Sbjct: 16226 AITARDEVDPPRISMDPKYKDTIVVHA--GESFKVDADIYGKPIPTIQWIKGDQELSNTA 16283

Query: 852   FVVLENEGPHRRLVLPATQPSDGGEF----QCVAGDECAYFTVTITDVSSWIVYPSGKVY 907
              + +++      L +      D G +    + VAG+      V + D       P G V 
Sbjct: 16284 RLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPG---PPEGPVV 16340

Query: 908   VAAVRLERVVL 918
             ++ V  E+  L
Sbjct: 16341 ISGVTAEKCTL 16351



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 94/441 (21%), Positives = 167/441 (37%), Gaps = 67/441 (15%)

Query: 461   WSRDGEELP--VICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPP 518
             WS+ G +L    I  ++  +   L++  V R DAG+ T    N        V    +  P
Sbjct: 23175 WSKQGIDLASRAIIDTTESYS-LLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTP 23233

Query: 519   GPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEV 577
             GP    ++ +  +++V +TW+ P      P   Y +E++E     +    +        +
Sbjct: 23234 GPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRI 23293

Query: 578   PGDCVPSEGD-YRFRICTVSGHG-----RSPHVVFHGSAHLVP--------TARLVAGLE 623
              G     EG  Y FR+   + +G      +   V      LVP        T   V    
Sbjct: 23294 SGLV---EGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVDVTKSTVTLAW 23350

Query: 624   DVQVYDGEDAVFSLDLSTIIQGT--WFLNGEELKSNEPEGQVEPGALRYRIEQ--KGLQH 679
             +  +YDG   +    L     GT  W               ++P  L + +    +G Q+
Sbjct: 23351 EKPLYDGGSRLTGYVLEACKAGTERWM----------KVVTLKPTVLEHTVTSLNEGEQY 23400

Query: 680   RLILHAVKHQDSGALVGFSCPGVQDSAALTIQES---PVHILSPQDRVSLTFTTSERVVL 736
                + A   +      G S P  +   A+T+Q+    P   LS   + ++       V L
Sbjct: 23401 LFRIRAQNEK------GVSEPR-ETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVEL 23453

Query: 737   TCELSRVDFPA-TWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSA 795
                ++    PA +W+  G K+ ESE + V+   +  +L + E  ++D+GE+    + V+ 
Sbjct: 23454 VIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVT- 23512

Query: 796   FFGVTVQDPPVHIVD----PREHVFVHAITSECVMLACEVDRED--APVRWYKDGQEVEE 849
               G T +   V I+D    P   + +  I +  + ++ E    D  AP+  Y        
Sbjct: 23513 --GTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPLSGY-------- 23562

Query: 850   SDFVVLENEGPHRRLVLPATQ 870
                 V+E    HR   LP ++
Sbjct: 23563 ----VVEQRDAHRPGWLPVSE 23579



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 54/219 (24%), Positives = 82/219 (37%), Gaps = 32/219 (14%)

Query: 127   APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
             AP F    R+  V   +   L C+  G P+P + W + G  +  + D   +     R ++
Sbjct: 24622 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEI--IADGLKY-----RIQE 24674

Query: 187   GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
               G    L I +    D+ VY   A N  G     A L+V            E PA +  
Sbjct: 24675 FKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEV------------EVPAKI-- 24720

Query: 247   PLKCAPKTFWVNEGKHA------KFRCYVMGKPEPEIEWHWEGRPLLPDRRRL-MYRDRD 299
                  PKT       HA        +    GKP+P I W  +G+ L+ +     +   R 
Sbjct: 24721 ---HLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQ-KGQDLIDNNGHYQVIVTRS 24776

Query: 300   GGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKE 338
                ++     + KD G YV  A+N  G     V+L V +
Sbjct: 24777 FTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVAD 24815



 Score = 41.2 bits (95), Expect = 0.010
 Identities = 58/260 (22%), Positives = 101/260 (38%), Gaps = 55/260 (21%)

Query: 259   EGKHAKFRCYVMGKPEP-EIEWHWEGRPLL-PDRRRLMYRDRDGGFVLKVLYCQAKDRGL 316
             EG H K+ C +    +  ++ W++  R L   ++  + Y D  G  +L V      D G 
Sbjct: 25276 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYED--GVAILYVKDITKLDDGT 25333

Query: 317   YVCAARNSAGQTLSAVQLHVKEPRLRF----TRPLQDVEGREHGIAVLECKVPNSRIP-- 370
             Y C   N  G+  S  +L VK  R  +     R ++ ++ R   + +LE + P   +P  
Sbjct: 25334 YRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLE-RPPEFTLPLY 25392

Query: 371   -----------------------TAWFREDQRLLP---CRKYEQIEEGTVRRLIIHRLKA 404
                                      W++  Q++ P    +KY    +  + +L I+ +  
Sbjct: 25393 NKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTT 25452

Query: 405   DDDGIYLCEMR---GRVRTVANVTVK----------GPILKRLPRKLDVLEGENAVLLVE 451
             DDD  Y    R   G     A +TV            P+ KRL    +  EG++  +  E
Sbjct: 25453 DDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQS--VCFE 25510

Query: 452   TLEAGVEG---RWSRDGEEL 468
                +G+     +W +DG+ L
Sbjct: 25511 IRVSGIPPPTLKWEKDGQPL 25530



 Score = 40.8 bits (94), Expect = 0.013
 Identities = 45/169 (26%), Positives = 63/169 (37%), Gaps = 38/169 (22%)

Query: 85   RARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAE 144
            RA NAAG         + EP  + P  +  + P+ +P       V L    S  V RG E
Sbjct: 8350 RAENAAG---------ISEPSRATPPTKAVD-PIDAP------KVILR--TSLEVKRGDE 8391

Query: 145  VVLTCRAGGLPEPTLYWEKDGMAL-----------------DEVWDSSHFAL---QPGRA 184
            + L     G P PT+ W KD   +                  EV +   F L   Q    
Sbjct: 8392 IALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSI 8451

Query: 185  EDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESP 233
            ++       LR+  +  PD G+Y+    N HG A+A   + V   P  P
Sbjct: 8452 DNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPP 8500



 Score = 40.8 bits (94), Expect = 0.013
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 6/145 (4%)

Query: 914   ERVVLTCELC-RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLC-- 970
             E   L+C++  RP  +++W + G+E+++S    +  +     L +   + ED G Y C  
Sbjct: 24243 EAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 24302

Query: 971   --EIDD-ESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGL 1027
               E+ + E++S  +    P     YP  E    AV     + +  + R    + W+    
Sbjct: 24303 TNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK 24362

Query: 1028  EVEESEALVLERDGPRCRLVLPAAQ 1052
              ++ SE + +E       LV+   Q
Sbjct: 24363 LLQNSENITIENTEHYTHLVMKNVQ 24387



 Score = 40.4 bits (93), Expect = 0.017
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 14/168 (8%)

Query: 1544 RPLEDVTISEGGSATFQLELSQEGVTG-EWARGG----VQLYPGPKCHIHSDGHRHRLVL 1598
            +PL+ V + EG +ATF+  +S   V    W R G        PG +    SDG R +L +
Sbjct: 10   QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISF-SDG-RAKLTI 67

Query: 1599 NGLGLADSGCVSFTADS----LRCAARLIVR--EVPVTIVRGPHDLEVTEGDTATFECEL 1652
              +  A+SG  S  A +        A L+V+    P   V+    + V +G     +  +
Sbjct: 68   PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRV 127

Query: 1653 SQALADVT-WEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYS 1699
            +     V  + +DG  +  S   ++   G    L +    P D+GTYS
Sbjct: 128  TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175



 Score = 40.4 bits (93), Expect = 0.017
 Identities = 61/249 (24%), Positives = 93/249 (37%), Gaps = 58/249 (23%)

Query: 1614 DSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELS-QALADVTWEKDGNALTPSP 1672
            ++ R  A + +   P T+V G  ++ V EG++ T EC +S      VTW ++   +  S 
Sbjct: 882  ETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSI 941

Query: 1673 RLRLQALGTRRLLQLRRCGPSDAGTYSCA----VGTAR-----AGPVRLTVRERTVAV-- 1721
              ++        L +R     D+G ++C+     GT       A  V     + T AV  
Sbjct: 942  DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTE 1001

Query: 1722 ---LSELRSVSAR----------------------------------EGDGATFECTV-S 1743
                 E R V +R                                  EG    F C V  
Sbjct: 1002 KFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGG 1061

Query: 1744 EVETTGRWELGGRPLRPGARVRI---RQEGKKHILVLSELRAEDAGE----VRFQAGPAQ 1796
              +    W+  G PL  G R ++   +Q G+   LV+S   A+DAGE    VR + G   
Sbjct: 1062 NPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK-LVISMTFADDAGEYTIVVRNKHGETS 1120

Query: 1797 SLALLEVEA 1805
            + A L  EA
Sbjct: 1121 ASASLLEEA 1129



 Score = 40.4 bits (93), Expect = 0.017
 Identities = 35/144 (24%), Positives = 63/144 (43%), Gaps = 7/144 (4%)

Query: 232   SPPADPDEAPAPVVEP-LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDR 290
             S P  P ++  P+  P  K   +   V    +A   C V G P+P ++W+ +G+ ++ D 
Sbjct: 24609 SEPITP-KSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADG 24667

Query: 291   RRLMYRDRDGGF-VLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEP-RLRFTRPLQ 348
              +   ++  GG+  L +      D  +Y   A N  G       L V+ P ++   + L+
Sbjct: 24668 LKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLE 24727

Query: 349   DVEGREHGI--AVLECKVPNSRIP 370
              + G  H +   V+  K+P S  P
Sbjct: 24728 GM-GAVHALRGEVVSIKIPFSGKP 24750



 Score = 40.0 bits (92), Expect = 0.022
 Identities = 25/97 (25%), Positives = 40/97 (41%), Gaps = 2/97 (2%)

Query: 19    RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
             R   +  G    L  ++ G P P V W+K  +      R+     G++  L +  A   D
Sbjct: 10921 REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK--LEIRNAAHED 10978

Query: 79    AGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
              G+Y     N AG    +  V VL+ P    +L+ +E
Sbjct: 10979 GGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSE 11015



 Score = 40.0 bits (92), Expect = 0.022
 Identities = 75/311 (24%), Positives = 119/311 (38%), Gaps = 33/311 (10%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             PGPP + E+ K  KN++ + W  P     +    Y LE+++  S  W +    E      
Sbjct: 20761 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLK-ETIRDTR 20819

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSPH---VVFHGSAHLV----PTARL---------VA 620
                  +    DY++R+C V+  G+ P      F+ +A  +    P A++         + 
Sbjct: 20820 QKVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSIT 20879

Query: 621   GLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHR 680
                   VYDG  AV    +  I QG      EE  +   +G+V          + G+ + 
Sbjct: 20880 LGWSKPVYDGGSAVTGY-VVEIRQG----EEEEWTTVSTKGEVRTTEYVVSNLKPGVNYY 20934

Query: 681   LILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERV-VLTCE 739
               + AV     G  +  + P VQ   A  I E+P   L    R S+     E V VL   
Sbjct: 20935 FRVSAVNCAGQGEPIEMNEP-VQ---AKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPF 20990

Query: 740   LSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE-GV----S 794
               R     TW KD + +       ++       L +P+    D+G++    E GV    S
Sbjct: 20991 KGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKS 21050

Query: 795   AFFGVTVQDPP 805
             +   V V D P
Sbjct: 21051 STVSVKVLDTP 21061



 Score = 39.7 bits (91), Expect = 0.028
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 5/103 (4%)

Query: 492  AGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI- 550
            A E  + +G     + +  K  +  PPGPP   E     K+ V LTW  P+    +P   
Sbjct: 7553 AAENMYGVGEPVQASPITAK-YQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITG 7611

Query: 551  YRLERQEVGSEDWIQCFSIE-KAGAVEVPGDCVPSEGDYRFRI 592
            Y +ER +  ++ W++C  +  K     V G  + ++  YRFR+
Sbjct: 7612 YWVERLDPDTDKWVRCNKMPVKDTTYRVKG--LTNKKKYRFRV 7652



 Score = 39.7 bits (91), Expect = 0.028
 Identities = 34/164 (20%), Positives = 71/164 (43%), Gaps = 17/164 (10%)

Query: 823   ECVMLACEVDREDAP-VRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVA 881
             E   L+C++     P ++WY+ G+E+ +S    + ++G    L +   +  D G + C+A
Sbjct: 24243 EAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 24302

Query: 882   GDECAYFTVTITDVSSWIV----------YPSGKVYVAAVRLERVVLTCELCRPWAEVRW 931
              +E     V   + SS ++          YP  + Y  AV     +    + RP   + W
Sbjct: 24303 TNE-----VGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTW 24357

Query: 932   TKDGEEVVESPALLLQKEDTVRRLVLPAVQLE-DSGEYLCEIDD 974
                 + +  S  + ++  +    LV+  VQ +  +G+Y  ++ +
Sbjct: 24358 FHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSN 24401



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 29/89 (32%), Positives = 42/89 (47%), Gaps = 5/89 (5%)

Query: 516  SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGA 574
            SPPGPPI   +      T+ L W+PP        + Y +++Q VG+ +W +C   EK   
Sbjct: 8696 SPPGPPI-PRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRC--TEKMIK 8752

Query: 575  VEVPGDCVPSEG-DYRFRICTVSGHGRSP 602
            V         EG DY+ R+  V+  G  P
Sbjct: 8753 VRQYTVKEIREGADYKLRVSAVNAAGEGP 8781



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 32/91 (35%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 517  PPGPPILAEMFKGHKNTVLLTWKPPE---PAPETPFIYR-LERQEVGS--EDWIQCFSIE 570
            PP PPI  ++    KNTV L+WKPP+    +P T +I   L     G+  E W QC   +
Sbjct: 9706 PPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD 9765

Query: 571  KAGAVEVPGDCVPSEGDYRFRICTVSGHGRS 601
                     D V   G+Y FR+  V+  G S
Sbjct: 9766 VEELQFTVEDLVEG-GEYEFRVKAVNAAGVS 9795



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 43/144 (29%), Positives = 52/144 (36%), Gaps = 17/144 (11%)

Query: 93    AYAAAAVTVLEPPA-SDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRA 151
             A A  AV +  P   SDP    AE   P           LT      V  G  V L    
Sbjct: 12961 AIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLT------VKAGTNVCLDATV 13014

Query: 152   GGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHA 211
              G P PT+ W+KDG  L    +    A+Q             L + +    DSG Y   A
Sbjct: 13015 FGKPMPTVSWKKDGTLLKPA-EGIKMAMQRNLC--------TLELFSVNRKDSGDYTITA 13065

Query: 212   RNAHGHAQAGALLQVHQPPESPPA 235
              N+ G   A   L+V   P  PPA
Sbjct: 13066 ENSSGSKSATIKLKVLDKP-GPPA 13088



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 8/109 (7%)

Query: 235   ADPDEAPAPVVEPLKCAP-------KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLL 287
             +DP +   PV+      P        TF V  G+  K     +G+P P + WH +  P L
Sbjct: 15825 SDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVP-L 15883

Query: 288   PDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
                 R+     +   +L +     +D G YV    NSAG+ +  + + V
Sbjct: 15884 KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIV 15932



 Score = 39.3 bits (90), Expect = 0.037
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 3/100 (3%)

Query: 15    LRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAA 74
             ++F   + V +G   ++   + G P PV+ W K G ++    R    +      L +   
Sbjct: 19488 VKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDC 19547

Query: 75    LPTDAGVYVCRARNAAGEAYAAAAVTVLE---PPASDPEL 111
             +  D G YV   +N AG    A    VL+   PPA   E+
Sbjct: 19548 IRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEI 19587



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 25/112 (22%), Positives = 48/112 (42%), Gaps = 11/112 (9%)

Query: 460   RWSRDGEELPV---ICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHS 516
             +W+ DG E+         +      L +    R D GE   ++ N+  +  + V      
Sbjct: 11238 KWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD 11297

Query: 517   PPGPPI----LAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW 563
              PGPP     + ++   H   + ++W+PP+    +P I Y +E+Q+   + W
Sbjct: 11298 VPGPPTGPINILDVTPEH---MTISWQPPKDDGGSPVINYIVEKQDTRKDTW 11346



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 3/122 (2%)

Query: 479   MHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTW 538
             M  LV+P  TR+D+G+ + +L N      + V       PGP    ++    K +  ++W
Sbjct: 12355 MAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSW 12414

Query: 539   KPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSG 597
              PPE    +    Y +E++E   + W       K  +  V  + VP   +Y FR+  V+ 
Sbjct: 12415 APPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVT-NLVPG-NEYYFRVTAVNE 12472

Query: 598   HG 599
             +G
Sbjct: 12473 YG 12474



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 108/521 (20%), Positives = 190/521 (36%), Gaps = 75/521 (14%)

Query: 475   SSGHMHALVLPGVTREDAGEVTFSL----GNSRTTTLLRVKCVKHSPPGPPILAEMFKGH 530
             SS     L++    + DAG+ T +L    G    T  ++V      P GP    E+    
Sbjct: 13728 SSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTA-- 13785

Query: 531   KNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEG-DY 588
                + L W PP+    +    Y LE+++  +  W+ C S  +     V       EG +Y
Sbjct: 13786 -EAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR---LHEGMEY 13841

Query: 589   RFRICTVS----GHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQ 644
              FR+   +    G G     +       VP A     + DV+ +D     ++    T   
Sbjct: 13842 TFRVSAENKYGVGEGLKSEPIVARHPFDVPDAPPPPNIVDVR-HDSVSLTWTDPKKT--- 13897

Query: 645   GTWFLNGEELKSNEPEGQVEPGALRYRIEQK---------GLQHRLILHAVKHQDSGALV 695
             G   + G  L+  E    +   A +  I  +         GL++   + A+       L 
Sbjct: 13898 GGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYEFRVMAIN------LA 13951

Query: 696   GFSCPGVQDSAALTIQE-----SPVHILSPQDRVSLTFTTSE----RVVLTCELSRVDFP 746
             G   P +     + +        P  I   ++ V+L +T  +      +    + + D P
Sbjct: 13952 GVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLP 14011

Query: 747   A-TWYKDGQ-KVEESELLVVKM-DGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQD 803
             + +W K     V E    V  + +G K+   +  AK   +G     +E           +
Sbjct: 14012 SKSWMKANHVNVPECAFTVTDLVEGGKYEFRI-RAK-NTAGAISAPSESTETIICKDEYE 14069

Query: 804   PPVHIVDPREHVFVHAITSECVML-ACEVDREDAPVR-WYKDGQEVEESDFVVLENEGPH 861
              P  ++DP     +     + ++L A  +  +  P   W K G+++  SD   + +    
Sbjct: 14070 APTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTS 14129

Query: 862   RRLVLPATQPSDGGEFQCVA----GDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVV 917
               L +      D GE+   A    G +  +  VT+ DV      P G V ++ V  E+  
Sbjct: 14130 SMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPG----PPGPVEISNVSAEKAT 14185

Query: 918   LTCELCRPWAEVRWT---KDGEEVVESPALLLQKEDTVRRL 955
             LT           WT   +DG   ++S   +L+K +T R L
Sbjct: 14186 LT-----------WTPPLEDGGSPIKS--YILEKRETSRLL 14213



 Score = 38.9 bits (89), Expect = 0.048
 Identities = 43/170 (25%), Positives = 66/170 (38%), Gaps = 14/170 (8%)

Query: 253   KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLP--DRRRLMYRDRDGGFVLKVLYCQ 310
             KT +V  G++ +F   +   PEP + W+  G+ + P  + ++  +    G + L +    
Sbjct: 25394 KTAYV--GENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVT 25451

Query: 311   AKDRGLYVCAARNSAGQTLSAVQLHV--------KEPRLRFTRPLQDVEGREHGIAVLEC 362
               D   Y   ARN  G+     +L V           R  F R L + E +E      E 
Sbjct: 25452 TDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEI 25511

Query: 363   KVPNSRIPT-AWFREDQRLLPCRKYEQIEEG-TVRRLIIHRLKADDDGIY 410
             +V     PT  W ++ Q L      E I EG     L I     +D G Y
Sbjct: 25512 RVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 25561



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 34/128 (26%), Positives = 51/128 (39%), Gaps = 12/128 (9%)

Query: 119  PSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAG----------GLPEPTLYWEKDGMAL 168
            PS  +GE     +      ++  GA+  L C+AG          G P P   WE DG A 
Sbjct: 9487 PSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAK 9546

Query: 169  DEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQ 228
              + D  H   +  + E    +S+ + I   +   +G Y   A+N  G   A   ++V  
Sbjct: 9547 KAMKDGVHDIPEDAQLETAENSSVII-IPECKRSHTGKYSITAKNKAGQKTANCRVKVMD 9605

Query: 229  PPESPPAD 236
             P  PP D
Sbjct: 9606 VP-GPPKD 9612



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 38/131 (29%), Positives = 51/131 (38%), Gaps = 27/131 (20%)

Query: 124   GEGAPVFLTGP----------------RSQWVLR-GAEVVLTCRAGGLPEPTLYWEKDGM 166
             G+G P F T P                R +  +R G    LT R  G P+P + W KD  
Sbjct: 10493 GQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEA 10552

Query: 167   ALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQV 226
              + E  D +H    P        A+LAL  + A+  DSG Y     N+ G  +    + V
Sbjct: 10553 DVLED-DRTHIKTTP--------ATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 10603

Query: 227   HQPPESPPADP 237
                P  PP  P
Sbjct: 10604 VDRP-GPPVGP 10613



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC-FSIEKAGAV 575
             P PP+  E      N+V LTW+PP     +  + Y +E Q+VG E+W +   + E     
Sbjct: 10808 PSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPESCPET 10867

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS 601
             +     +     Y+FR+  V+  G S
Sbjct: 10868 KYKVTGLRDGQTYKFRVLAVNAAGES 10893



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 43/154 (27%), Positives = 67/154 (43%), Gaps = 19/154 (12%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PPGPP         K  V L W  P+    +P   Y +E QE G++DWI+  ++     V
Sbjct: 11104 PPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECV 11163

Query: 576   EVPGDCVPSEGDYRFRIC--TVSGHGRSPHVV-FHGSAHLVPTARLVAGLEDVQVYDG-- 630
              V G  +     YRFR+    + G G     +       LVP +  +    DV++ +G  
Sbjct: 11164 -VTG--LQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVEL----DVKLIEGLV 11216

Query: 631   EDAVFSLDLSTIIQGT------WFLNGEELKSNE 658
               A  ++    II+G       W  +G E+K++E
Sbjct: 11217 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDE 11250



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILA-EMFKGHKNTVLLTWK- 539
             L++  VTR+D+G  + +  NS  T   ++K V    PGPP    ++     +   L+W  
Sbjct: 12651 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHI 12710

Query: 540   PPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRI 592
             P E        Y +E+ +V   DW+   +     +  V G  +P + +Y FR+
Sbjct: 12711 PLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRV-GKLIPGQ-EYIFRV 12761



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 42/163 (25%), Positives = 63/163 (38%), Gaps = 22/163 (13%)

Query: 453   LEAGVEGR------WSRDGEELPVICQ----SSSGHMHALVLPGVTREDAGEVTFSLGNS 502
             LEA + G+      WS+DG+EL          S+     LV+    R D G+    L N 
Sbjct: 18422 LEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNV 18481

Query: 503   RTTTLLRVKCVKHSPPGPPILAEMFKG-HKNTVLLTWKPP-EPAPETPFIYRLERQEVGS 560
               T  + +       PGPP       G       L W PP +        Y +E++E   
Sbjct: 18482 GGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSR 18541

Query: 561   EDWIQCFSIEKAGAVEV----PGDCVPSEGDYRFRICTVSGHG 599
               W Q  +  +A   +V    PG+      +Y FR+  V+ +G
Sbjct: 18542 LSWTQVSTEVQALNYKVTKLLPGN------EYIFRVMAVNKYG 18578



 Score = 38.5 bits (88), Expect = 0.063
 Identities = 39/171 (22%), Positives = 71/171 (41%), Gaps = 12/171 (7%)

Query: 1005  ECVVLMCELSREDAP-VRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVC-- 1061
             E   L C++     P ++WY+ G E+ +S    +  DG    L +   + ED G + C  
Sbjct: 24243 EAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIA 24302

Query: 1062  --DAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQV---RWYK 1116
               + G+      + + A P+   HP     + ++GA G   LR  V   G  V    W+ 
Sbjct: 24303 TNEVGEVETSSKLLLQATPQ--FHPGYPLKEKYYGAVGST-LRLHVMYIGRPVPAMTWFH 24359

Query: 1117  DGLEVEASDALQLGAEGPTRTLTLPHAQPE-DAGEYVCETRHEAITFNVIL 1166
                 ++ S+ + +        L + + Q +  AG+Y  +  +   T + IL
Sbjct: 24360 GQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAIL 24410



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 29/112 (25%), Positives = 45/112 (40%), Gaps = 6/112 (5%)

Query: 231 ESPPADPDEAPAPVVEP-----LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRP 285
           E+   +    PAPV  P     L    K   V EG+     C++ G P P + W+ E   
Sbjct: 877 EAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 936

Query: 286 LLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK 337
            +          + G   L +    A+D G + C+A N AG   ++  L V+
Sbjct: 937 -IESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ 987



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 482  LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKG-HKNTVLLTWKP 540
            LV+P   R D G  T +  N+  T    ++      PGPP+    F+    + + L+W P
Sbjct: 9876 LVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFP 9935

Query: 541  PEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
            P+    +    Y +E++E   + W+   S  K     +P   +    +Y FRI   + +G
Sbjct: 9936 PKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPK--LLEGHEYVFRIMAQNKYG 9993



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 3/91 (3%)

Query: 512   CVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW--IQCFS 568
             C    PPGPPI  ++    + T  L W  P     +P + Y +E Q+ G+  W  I    
Sbjct: 11493 CRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDE 11552

Query: 569   IEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
             + +  A  VPG    +E  +R +   + G G
Sbjct: 11553 LIRQCAFRVPGLIEGNEYRFRIKAANIVGEG 11583



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 71/336 (21%), Positives = 122/336 (36%), Gaps = 30/336 (8%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             P  P  A + K +K+ + + W  P+    +P I Y +ER+E  S  W++  +     + E
Sbjct: 12787 PSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKA-NDTLVRSTE 12845

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSP------------HVVFHGSAHLVPTARLVAGLED 624
              P   +    +Y FRI  ++  G SP             V   G   ++   +    L  
Sbjct: 12846 YPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIW 12905

Query: 625   VQ-VYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLI 682
              +  +DG   +    +    + G  ++         P+ +     L    E+   Q R I
Sbjct: 12906 ARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATGLE---EKAQYQFRAI 12962

Query: 683   LHAVKHQDSGALVGFSCPG-VQDSAALTIQESPVHI-LSPQDRVSLTFTTSERVVLTCEL 740
                         V  S P    D   +  +  P  I LS   +  LT      V L   +
Sbjct: 12963 ARTA--------VNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATV 13014

Query: 741   SRVDFP-ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGV 799
                  P  +W KDG  ++ +E + + M      L L     +DSG++    E  S     
Sbjct: 13015 FGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSA 13074

Query: 800   TVQDPPVHIVDPREHVFVHAITSECVMLACEVDRED 835
             T++   +    P   V ++ + S+  ML+ E   ED
Sbjct: 13075 TIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLED 13110



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 22/71 (30%), Positives = 30/71 (42%)

Query: 35    VLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAY 94
             +LG+P P   W K G+ +  S+     +      L +  A   DAG Y   A N  G   
Sbjct: 14098 ILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKV 14157

Query: 95    AAAAVTVLEPP 105
                 VTVL+ P
Sbjct: 14158 EHVKVTVLDVP 14168



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 21/85 (24%), Positives = 38/85 (44%), Gaps = 1/85 (1%)

Query: 481   ALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKP 540
             +L +    R D+G+ T ++ N  +   L +       PGPP    +    K + +L+W  
Sbjct: 19936 SLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDV 19995

Query: 541   PEPAPETPF-IYRLERQEVGSEDWI 564
             PE     P   Y +E++E   + W+
Sbjct: 19996 PENDGGAPVKNYHIEKREASKKAWV 20020



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 7/114 (6%)

Query: 238   DEAPAPVVEPLKCAPKTF---WVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLM 294
             DE   P+VE     P+ F    +  G+  + +  V G+P P + W  +G   +  R  + 
Sbjct: 21646 DENVPPIVE---FGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVE-IEKRMNME 21701

Query: 295   YRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQ 348
               D  G   L V       RG+Y   A+N++G   + +++ V++   +   P++
Sbjct: 21702 ITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIR 21755



 Score = 38.1 bits (87), Expect = 0.082
 Identities = 50/248 (20%), Positives = 90/248 (36%), Gaps = 25/248 (10%)

Query: 1384  SPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGT----VTLRAGSTATS 1439
             S P A+V W  NG  +    ++          L +  C   D+GT     T   G  +  
Sbjct: 26094 SKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDY 26153

Query: 1440  ARLHV-----------RETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQ 1488
             A L V           R  E +      ++   E   V    +T  + A+ +VR V+   
Sbjct: 26154 ATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQM 26213

Query: 1489  PLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLED 1548
                 ++R S++   H     +    L +      +S  +++  R        R+L     
Sbjct: 26214 T---ETRESLSSYEHSASAEMKSAALEE------KSLEEKSTTRKIKTTLAARILTKPRS 26264

Query: 1549  VTISEGGSATFQLELSQEGV-TGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSG 1607
             +T+ EG SA F  +   E V T  W R G  L    +  + +  ++    ++ +  +D G
Sbjct: 26265 MTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEG 26324

Query: 1608  CVSFTADS 1615
               S   ++
Sbjct: 26325 NYSVVVEN 26332



 Score = 37.7 bits (86), Expect = 0.11
 Identities = 26/108 (24%), Positives = 39/108 (36%), Gaps = 1/108 (0%)

Query: 229   PPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLP 288
             P E      D+  AP ++        +   E  + + +  + GKP P + W     PL  
Sbjct: 13661 PSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLAT 13720

Query: 289   DRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
             D  R+          L V  CQ  D G Y    +N AG     + + V
Sbjct: 13721 D-TRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKV 13767



 Score = 37.7 bits (86), Expect = 0.11
 Identities = 61/268 (22%), Positives = 96/268 (35%), Gaps = 52/268 (19%)

Query: 312   KDRGLYVCAARNSAGQTLSAVQ----LHVKEPRLRF---TRPLQDVEGREHGIAVLECKV 364
             KD  + V AAR S G  + + +      VK   +     +  +    G E G     CK+
Sbjct: 25227 KDLNMVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKI 25286

Query: 365   PNSRIPT--AWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEM---RGRVR 419
              N    T   W+   ++L    KYE   E  V  L +  +   DDG Y C++    G   
Sbjct: 25287 ENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDS 25346

Query: 420   TVANVTVKG----------PILKRLPRKLDVLE-------------------GENAVLLV 450
             + A + VKG            +K++ R+ D +                    GEN    V
Sbjct: 25347 SYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGV 25406

Query: 451   E-TLEAGVEGRWSRDGEEL-------PVICQSSSGHMHALVLPGVTREDAGEVTFSLGN- 501
               T+       W + G+++           +S  G ++ L +  VT +D  E T    N 
Sbjct: 25407 TITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG-LYQLTINSVTTDDDAEYTVVARNK 25465

Query: 502   -SRTTTLLRVKCVKHSPPGPPILAEMFK 528
                 +   ++    H PP    L  MFK
Sbjct: 25466 YGEDSCKAKLTVTLHPPPTDSTLRPMFK 25493



 Score = 37.4 bits (85), Expect = 0.14
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 223   LLQVHQPPESPP---ADPDEAPAPVVEP-LKCAPKTFWVNEGKHAKFRCYVMGKPEPEIE 278
             ++ V++   S P   A P  A   V+EP +K A  ++ V  G+  K    + G+P+P I 
Sbjct: 16898 VVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTIT 16957

Query: 279   WHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             W  +G P L    R+   D      L +      D G Y     N  GQ  +++++
Sbjct: 16958 WTKDGLP-LKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEI 17012



 Score = 37.4 bits (85), Expect = 0.14
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 1284  GGDLELVVHLSGPGGP-VRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCD 1342
             G DL++ + + G   P + W KDGE L    RV +E+     VL ++     D G+Y   
Sbjct: 18021 GEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVT 18080

Query: 1343  A 1343
             A
Sbjct: 18081 A 18081



 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 3/80 (3%)

Query: 257   VNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGL 316
             V+ G   +   YV GKP P + W+   R  LP    +         V+K   CQ   +G+
Sbjct: 10231 VHAGGVIRIIAYVSGKPPPTVTWNMNER-TLPQEATIETTAISSSMVIK--NCQRSHQGV 10287

Query: 317   YVCAARNSAGQTLSAVQLHV 336
             Y   A+N AG+    + + V
Sbjct: 10288 YSLLAKNEAGERKKTIIVDV 10307



 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 1/80 (1%)

Query: 257   VNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGL 316
             V  G   +F   + G P P  +W  +G  +  D    +  D     VL +  C  +D G 
Sbjct: 11217 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSS-VLTIKNCLRRDTGE 11275

Query: 317   YVCAARNSAGQTLSAVQLHV 336
             Y     N+AG    AV L V
Sbjct: 11276 YQITVSNAAGSKTVAVHLTV 11295



 Score = 37.0 bits (84), Expect = 0.18
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 1/68 (1%)

Query: 1274  AAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGAR 1332
             A +T V +  G D+++++   G P   V W KD + L S  R  +E   +  +L +    
Sbjct: 20971 ALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVT 21030

Query: 1333  SGDAGEYL 1340
               D G+Y+
Sbjct: 21031 RNDTGKYI 21038



 Score = 36.6 bits (83), Expect = 0.24
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 518  PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC 566
            P PP+        +++V L W+PP     +P + Y +ER E G ++WI+C
Sbjct: 6987 PSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRC 7036



 Score = 36.6 bits (83), Expect = 0.24
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 516   SPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGA 574
             +PPG P    +    + +V L W  PE    +    Y +E Q+V   +W +C +      
Sbjct: 23726 APPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKC-NTTPTKI 23784

Query: 575   VEVPGDCVPSEGDYRFRI--CTVSGHGRSPHV 604
              E     +P   +YRFR+  C   G G    V
Sbjct: 23785 REYTLTHLPQGAEYRFRVLACNAGGPGEPAEV 23816



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 19   RPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTD 78
            + V V    +A  +CV+  E    V+W KG   + +S++    ADG +H L++  +   D
Sbjct: 5188 KDVTVPERRQARFECVLTREAN--VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDD 5245

Query: 79   AGVY 82
             GVY
Sbjct: 5246 EGVY 5249



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 3/106 (2%)

Query: 231  ESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDR 290
            E    D  EAP   ++    A  T  V  G   +    V GKPEP+I W  +   +L   
Sbjct: 7373 EIQAVDTQEAPEIFLDVKLLAGLT--VKAGTKIELPATVTGKPEPKITW-TKADMILKQD 7429

Query: 291  RRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
            +R+   +      + ++  +  D G Y+  A N  G+  + V+++V
Sbjct: 7430 KRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQ 565
             PGPP   ++F   ++ + LTW PPE    +    Y +ER+EV ++ W++
Sbjct: 23627 PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVR 23675



 Score = 36.2 bits (82), Expect = 0.31
 Identities = 29/88 (32%), Positives = 39/88 (44%), Gaps = 6/88 (6%)

Query: 1725  LRSVSAREGDGATFECTVSEVET-TGRWELGGRPLRPGARVRIRQEG-KKHILVLSELRA 1782
             L +   +EG    FE  VS +   T +WE  G+PL  G  + I  EG   + L + +   
Sbjct: 25496 LANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLP 25555

Query: 1783  EDAGEVRF----QAGPAQSLALLEVEAL 1806
             ED G  R      AG     A L+VE L
Sbjct: 25556 EDTGYYRVTATNTAGSTSCQAHLQVERL 25583



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 30/91 (32%), Positives = 44/91 (48%), Gaps = 7/91 (7%)

Query: 518  PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW--IQCFSIEKAGA 574
            PGPP   ++    K ++L++W PP     +P   Y LE++E GS  W  +    I K G 
Sbjct: 9294 PGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVGL 9353

Query: 575  VEVPGDCVPS--EG-DYRFRICTVSGHGRSP 602
              V  + VP   EG  Y+FR   ++  G  P
Sbjct: 9354 KGVEFN-VPRLLEGVKYQFRAMAINAAGIGP 9383



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 129/621 (20%), Positives = 223/621 (35%), Gaps = 84/621 (13%)

Query: 517   PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PP PP    +    + +  L W+ PE    +  + Y +E Q  G+E W      +   AV
Sbjct: 17907 PPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAV 17966

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS-PHV----VFHGSAHLVPTARLVAGLEDVQVYDG 630
              V G  + S  +Y+FR+   +  G+S P V    V      + P+ +L      +Q   G
Sbjct: 17967 -VTG--LSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQA--G 18021

Query: 631   EDAVFSLDLSTIIQG----TWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAV 686
             ED    +++  I +     +W  +GE LK             R  +E+      L +   
Sbjct: 18022 ED--LKIEIPVIGRPRPNISWVKDGEPLKQ----------TTRVNVEETATSTVLHIKEG 18069

Query: 687   KHQDSG---ALVGFSCPGVQDSAALTIQESPVHILSPQ--DRVSLTFT--TSERVVLT-- 737
                D G        S     ++ ++ + E P   + P   D VS  F   + E    T  
Sbjct: 18070 NKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGG 18129

Query: 738   CELS------RVDFPATWYKDGQKVEESELLVVKM-DGRKHRL-ILPEAKVQDSGEFECR 789
             C++S      R     TW+     V  + + + K+  G +++  I  E +   S   + +
Sbjct: 18130 CQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSK 18189

Query: 790   TEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVR--WYKDGQEV 847
                        +   P     P    FV +I+ + +++       D   +   Y   Q+ 
Sbjct: 18190 ---------AVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKE 18240

Query: 848   EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY-----P 902
             + S   V  N+ P +      T   +G E++     E        + VS   V      P
Sbjct: 18241 KNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDP 18300

Query: 903   SGKVYVAAVRLERVVLT---------CELCRPWAEVRWTKDGEEVVESPALLLQKEDTVR 953
              G+     +    V L           ++     E +   DG  +  S   +L+ E TV 
Sbjct: 18301 PGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVS 18360

Query: 954   RLV------LPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECV 1007
              LV         +    +G +    D   A       + P   + P+ +  ++    E  
Sbjct: 18361 GLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETF 18420

Query: 1008  VLMCELSREDAP-VRWYKDGLEVEESEA-LVLERDGPRCRLVLPAAQPEDGGEFVCD--- 1062
             VL  ++  +  P V W KDG E+EE+ A + ++    +  LV+      DGG+++     
Sbjct: 18421 VLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSN 18480

Query: 1063  -AGDDSAFFTVTV---TAPPE 1079
               G  S   TV V     PPE
Sbjct: 18481 VGGTKSIPITVKVLDRPGPPE 18501



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 30/146 (20%), Positives = 63/146 (43%), Gaps = 7/146 (4%)

Query: 461   WSRDGEELPVICQ---SSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSP 517
             W +DGE L    +     +     L +    ++D G+ T +  NS  T    +  +    
Sbjct: 18040 WVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEK 18099

Query: 518   PGPPILAEMF-KGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAV 575
             PGPP+    F +   + V+++W+PP          Y +E+++  +  W    +      +
Sbjct: 18100 PGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTI 18159

Query: 576   EVPGDCVPSEGDYRFRICTVSGHGRS 601
             ++    + +  +Y+FRI   + +G+S
Sbjct: 18160 KITK--LKTGTEYQFRIFAENRYGKS 18183



 Score = 35.8 bits (81), Expect = 0.41
 Identities = 190/979 (19%), Positives = 339/979 (34%), Gaps = 168/979 (17%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQ---EVGSEDWIQC-FSIEKA 572
             PG P + ++ +   +TV L W  P     +  + Y +ER+   EVG   W++C ++I   
Sbjct: 22637 PGRPEVTDVTR---STVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSD 22693

Query: 573   GAVEVPGDCVPSEGD-YRFRICTVSGHG------RSPHVVFHGSAHLVPTARLVAGLED- 624
                 V      SEGD Y FR+   +  G       S   V     +  P A L A L   
Sbjct: 22694 NFFTVTA---LSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGD 22750

Query: 625   -VQVYDGEDAVFSLDLSTIIQGT------WFLNGEELKSNEPEGQVEPGALRYRIEQKGL 677
              V +  G D V    L   + G       W    +EL   E          +  ++  G 
Sbjct: 22751 LVTIRAGSDLV----LDAAVGGKPEPKIIWTKGDKELDLCE----------KVSLQYTGK 22796

Query: 678   QHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLT 737
             +   ++      DSG     +      + A+++    +    P  +++++  T E+  L 
Sbjct: 22797 RATAVIKFCDRSDSGKYT-LTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLA 22855

Query: 738   CELSRVDFPAT-WYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAF 796
               L + D  A   +   ++ E S L  V ++G    L     ++  + E+  R   V+ +
Sbjct: 22856 WSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKY 22915

Query: 797   F-GVTVQDPPV----------------HIVDPREHVFVHAITSEC-----VMLACEVDRE 834
               GV V+  P+                 +   +EH+ +     E      +       RE
Sbjct: 22916 GPGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKRE 22975

Query: 835   DAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITD 894
                +RW +  +     D+VV +         L  T   +G ++Q       A      ++
Sbjct: 22976 KKSLRWTRVNK-----DYVVYDTR-------LKVTSLMEGCDYQFRVTAVNAAGNSEPSE 23023

Query: 895   VSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTK---DGEEVVESPALLLQKEDT 951
              S++I               RVV T +       + WTK   DG   +    L +Q++DT
Sbjct: 23024 ASNFISCREPSYTPGPPSAPRVVDTTKHS---ISLAWTKPMYDGGTDIVGYVLEMQEKDT 23080

Query: 952   -----------VRRLVLPAVQLEDSGEYLCEIDDESA------SFTVTVTEPPVRIIYPR 994
                        +R        L+   +Y   +   +       S ++   EP  RI  P 
Sbjct: 23081 DQWYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD 23140

Query: 995   DEVT---LIAVTLEC---VVLMCELSREDAPV-RWYKDGLEVEESEALVLERDGPRCRLV 1047
              E+       VT+     + LM  +S    PV  W K G+++  +   +++       L+
Sbjct: 23141 LELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDL--ASRAIIDTTESYSLLI 23198

Query: 1048  LPAAQPEDGGEFVCDAGDDSAFFTVTVTA---------PPERIVHPAARSLDLHFGAP-- 1096
             +      D G++  +A + S   + TV           P  ++   +  S+ + +  P  
Sbjct: 23199 VDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTI 23258

Query: 1097  --GRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDA---GEY 1151
               G       V    + +R +K  +  + S  L   +     T+      PE+    GE 
Sbjct: 23259 DGGAPVNNYIVEKREAAMRAFKT-VTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGE- 23316

Query: 1152  VCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVV--------LSCELSRAGA- 1202
              CET    +   V L   P +   ++ T S + +A  +P+            E  +AG  
Sbjct: 23317 PCETSDAVLVSEVPLV--PAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTE 23374

Query: 1203  ---------PVVWSHNGRPVQEGEG--LELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAP 1251
                      P V  H    + EGE     + A+  + V                   + P
Sbjct: 23375 RWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGV-------------------SEP 23415

Query: 1252  GAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGERLA 1310
                  + TVQ       +      Q  +    G  +ELV+ ++G P     W+  G +L 
Sbjct: 23416 RETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR 23475

Query: 1311  SQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLT 1370
                RV +E       L ++     D GEY  +    +     +++  +L K      P+ 
Sbjct: 23476 ESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIK 23535

Query: 1371  VHEGDDATFRCEVSPPDAD 1389
             + E D  +      PP+ D
Sbjct: 23536 IDEIDATSITISWEPPELD 23554



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 50/188 (26%), Positives = 78/188 (41%), Gaps = 22/188 (11%)

Query: 705 SAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVV 764
           SA  + Q+    + +P  + S T   +E   L  +    D P T YK    VE  + + V
Sbjct: 801 SATSSAQKITKSVKAPTVKPSETRVRAEPTPLP-QFPFADTPDT-YKSEAGVEVKKEVGV 858

Query: 765 KMDG---RKHRLIL---PEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVH 818
            + G   R+ R  +    EAKV ++       E         +   P  +V   ++V V 
Sbjct: 859 SITGTTVREERFEVLHGREAKVTETARVPAPVE---------IPVTPPTLVSGLKNVTV- 908

Query: 819 AITSECVMLACEVDREDAP-VRWYKDGQEVEES-DFVVLENEGPHRRLVLPATQPSDGGE 876
            I  E V L C +    +P V WY++  ++E S DF +    G   RL++      D G 
Sbjct: 909 -IEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSG-IARLMIREAFAEDSGR 966

Query: 877 FQCVAGDE 884
           F C A +E
Sbjct: 967 FTCSAVNE 974



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 3/92 (3%)

Query: 332 VQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA-WFREDQRLLPCRKYEQIE 390
           V++ V  P L     L++V   E     LEC +     PT  W+RED ++     ++   
Sbjct: 890 VEIPVTPPTL--VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF 947

Query: 391 EGTVRRLIIHRLKADDDGIYLCEMRGRVRTVA 422
           +  + RL+I    A+D G + C       TV+
Sbjct: 948 QSGIARLMIREAFAEDSGRFTCSAVNEAGTVS 979



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 7/111 (6%)

Query: 229  PPESPP---ADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRP 285
            P E+ P   A+P E PA  VE          +  GK  +    V G+P P   W  E   
Sbjct: 8782 PGETQPVTVAEPQEPPA--VELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGE 8839

Query: 286  LLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
            L  D+ R++  +      L +     KD G YV  A NS G   +A ++ V
Sbjct: 8840 L--DKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 8888



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 2/83 (2%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +G    +   V G+PPP V W    + L     +   A  +   +++     +  GVY
Sbjct: 10231 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSS--MVIKNCQRSHQGVY 10288

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                A+N AGE      V VL+ P
Sbjct: 10289 SLLAKNEAGERKKTIIVDVLDVP 10311



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 21/90 (23%), Positives = 36/90 (40%), Gaps = 2/90 (2%)

Query: 26    GAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCR 85
             G + +++  + G P P + W K G  L  + R++         L +      D G Y   
Sbjct: 16939 GQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGIT 16998

Query: 86    ARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
               N  G+  A+  +  L+ P  DP   P +
Sbjct: 16999 VANVVGQKTASIEIVTLDKP--DPPKGPVK 17026



 Score = 35.4 bits (80), Expect = 0.53
 Identities = 93/414 (22%), Positives = 145/414 (35%), Gaps = 55/414 (13%)

Query: 226   VHQPPES--PPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEG 283
             + +P +S  P    DE   P +        T  VN G+  +    V GKP P IEW   G
Sbjct: 17299 ISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEW-LRG 17357

Query: 284   RPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV------- 336
                + +  R   ++ D   +L V      D G Y+  A N AG     V + V       
Sbjct: 17358 DKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPP 17417

Query: 337   -----------KEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAW-FREDQRLLPCR 384
                        ++  L ++ PLQD  G +    V+E K   SR+  AW     + +    
Sbjct: 17418 EGPVQVTGVTSEKCSLTWSPPLQD-GGSDISHYVVE-KRETSRL--AWTVVASEVVTNSL 17473

Query: 385   KYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGP-ILKRLPRKLDVLEG 443
             K  ++ EG     +   +  +  G+      G     A V +K P +L   P+ L+V   
Sbjct: 17474 KVTKLLEG--NEYVFRIMAVNKYGV------GEPLESAPVLMKNPFVLPGPPKSLEVTNI 17525

Query: 444   ENAVLLV-----------ETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLPGVTREDA 492
                 + V           E +   VE R  R G    + C         L + G+T +  
Sbjct: 17526 AKDSMTVCWNRPDSDGGSEIIGYIVEKR-DRSGIRW-IKCNKRRITDLRLRVTGLTEDHE 17583

Query: 493   GEVTFS------LGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTW-KPPEPAP 545
              E   S      +G     T+    C     PGPP  A +    KN++ L W KP     
Sbjct: 17584 YEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGG 17643

Query: 546   ETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
                  Y +E  +   E+W                  +    +Y+ R+C ++  G
Sbjct: 17644 SEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVG 17697



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 487   VTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE 546
             V + DAG+   +L NS       +       PGPP+   + +  K++  +TW+PP     
Sbjct: 13451 VNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGG 13510

Query: 547   TPFI-YRLERQEVGSEDW 563
             +P I Y +++++   + W
Sbjct: 13511 SPIINYVVQKRDAERKSW 13528



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 4/91 (4%)

Query: 514   KHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKA 572
             +  PPGPP   E+    KNT  ++WK P     +    Y +ER+E  S  W++      +
Sbjct: 14263 RFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVS 14322

Query: 573   G-AVEVPGDCVPSEGDYRFRICTVSGHGRSP 602
                 +V G  +     Y FR+   +  G  P
Sbjct: 14323 DLRCKVTG--LQEGSTYEFRVSAENRAGIGP 14351



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 24/82 (29%), Positives = 34/82 (41%), Gaps = 1/82 (1%)

Query: 461   WSRDGEELPVICQSSSGHMHA-LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPG 519
             WSR+  E     Q   G  +  L +    R DAG+    L NS  +    V       PG
Sbjct: 17753 WSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPG 17812

Query: 520   PPILAEMFKGHKNTVLLTWKPP 541
             PP    + +  K++  L W+PP
Sbjct: 17813 PPQNLAVKEVRKDSAFLVWEPP 17834



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 3/64 (4%)

Query: 1657  ADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAG---PVRLT 1713
             A V W KDG  L  + R+ + +  T   L ++     D GTY   V  +      P+ + 
Sbjct: 19119 ATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITII 19178

Query: 1714  VRER 1717
             V +R
Sbjct: 19179 VLDR 19182



 Score = 35.0 bits (79), Expect = 0.70
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 3/69 (4%)

Query: 269   VMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQ 327
             V GKPEP+I W    + L L ++  L Y  +    V+K  +C   D G Y    +N++G 
Sbjct: 22766 VGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIK--FCDRSDSGKYTLTVKNASGT 22823

Query: 328   TLSAVQLHV 336
                +V + V
Sbjct: 22824 KAVSVMVKV 22832



 Score = 34.7 bits (78), Expect = 0.91
 Identities = 22/81 (27%), Positives = 30/81 (37%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G    L   V G PPP + W K    L     L   +   +  L        DAG Y+ 
Sbjct: 13402 AGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYIL 13461

Query: 85    RARNAAGEAYAAAAVTVLEPP 105
                N+ G+      V VL+ P
Sbjct: 13462 TLENSCGKKEYTIVVKVLDTP 13482



 Score = 34.7 bits (78), Expect = 0.91
 Identities = 29/102 (28%), Positives = 47/102 (46%), Gaps = 8/102 (7%)

Query: 1351  LVSVEEPLLVKLVSELTPLTVHEGDDATFRCE-VSPPDADVTWLRNGAVVTPGPQVEMAQ 1409
             L S E P + K   E+  +T   G+ A   C+ V  P  D+ W R G  +    + +M+ 
Sbjct: 24222 LTSGEAPGIRK---EMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSS 24278

Query: 1410  NGSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRET 1447
             +G +  LT+   +  D G  T  A    G   TS++L ++ T
Sbjct: 24279 DGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQAT 24320



 Score = 34.7 bits (78), Expect = 0.91
 Identities = 33/128 (25%), Positives = 57/128 (44%), Gaps = 10/128 (7%)

Query: 1775  LVLSELRAEDAGEVRFQAGPAQS---LALLEVEALPLQMCRHPPREKTVLVGRRAVLEVT 1831
             +V+S  R    G +R Q G + +   +A +E+  +  Q+  H   E+   V  + V ++ 
Sbjct: 25231 MVVSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIM-HAVGEEGGHV--KYVCKIE 25287

Query: 1832  VSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA----GQDST 1887
                    V W     +L   +KYE+        L + D+   D GTY C+     G+DS+
Sbjct: 25288 NYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSS 25347

Query: 1888  HTRLLVEG 1895
             +  L V+G
Sbjct: 25348 YAELFVKG 25355



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 51/238 (21%), Positives = 89/238 (37%), Gaps = 41/238 (17%)

Query: 965   SGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYK 1024
             S EY   +  E+    V V+EPP+    P   VTL+ VT           R  A ++W K
Sbjct: 18970 SNEYGIGLPAETTE-PVKVSEPPL----PPGRVTLVDVT-----------RNTATIKWEK 19013

Query: 1025  ---DGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVT----AP 1077
                DG        + ++  G          +  +       AG++  F    V     + 
Sbjct: 19014 PESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSD 19073

Query: 1078  PERIVHPA-ARSLDLH---------FGAPGRVELRCEVAPAG---SQVRWYKDGLEVEAS 1124
             P ++  P  AR +++          F    R +L+ +V   G   + V W KDG  ++ +
Sbjct: 19074 PRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKET 19133

Query: 1125  DALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSP 1182
               + + +     +L++  A  ED G Y     + A +  V     P+  + L+    P
Sbjct: 19134 TRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITV-----PITIIVLDRPGPP 19186



 Score = 34.3 bits (77), Expect = 1.2
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 487   VTREDAGEVTFSLGNSRTTTLLRVKCVKH-SPPGPPILAEMFKGHKNTVLLTWKPPEPAP 545
             V  E+A  V  + G SR      +KC +  +PPGPP + ++    K TV L W  P    
Sbjct: 21922 VMAENAAGVGPASGISRL-----IKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDG 21976

Query: 546   ETPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGR 600
                 I Y +E  +    DW +  + E           + +  +Y+FR+  ++G G+
Sbjct: 21977 GMEIIGYIIEMCKADLGDWHK-VNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGK 22031



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 30/114 (26%), Positives = 48/114 (42%), Gaps = 7/114 (6%)

Query: 489  REDAGEVTFSLGN--SRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE 546
            R D G       N   R T ++ V  +    PGPP   ++      + LLTW PP     
Sbjct: 7450 RSDTGTYIIEAVNVCGRATAVVEVNVL--DKPGPPAAFDITDVTNESCLLTWNPPRDDGG 7507

Query: 547  TPFI-YRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHG 599
            +    Y +ER+   SE W +  S  K    +     +P++ +Y FR+   + +G
Sbjct: 7508 SKITNYVVERRATDSEVWHKLSSTVKDTNFKAT-KLIPNK-EYIFRVAAENMYG 7559



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 19/79 (24%), Positives = 36/79 (45%)

Query: 925  PWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVT 984
            P   V W KDG+EV  S  L ++ +     L +P     D+G Y   ++++  S T ++ 
Sbjct: 8109 PVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASIN 8168

Query: 985  EPPVRIIYPRDEVTLIAVT 1003
               + +  P  ++    +T
Sbjct: 8169 VKVIGLPGPCKDIKASDIT 8187



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 838  VRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTI 892
            V W+KDG+EV+ SD + ++N+     L +P +  +D G +     ++    T +I
Sbjct: 8113 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASI 8167



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 1112 VRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
            V W+KDG EV+ASD L +  +  +  L +P +   DAG Y
Sbjct: 8113 VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 8152



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFT 980
             +P    +W K  +EVV S  L + K D+   L++  V  +DSG Y    ++ S + T
Sbjct: 12620 KPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDT 12676



 Score = 33.9 bits (76), Expect = 1.6
 Identities = 33/149 (22%), Positives = 60/149 (40%), Gaps = 15/149 (10%)

Query: 748   TWYKDGQKV---EESELLVVKMDGRKHRLILPEAKVQDSGEF------ECRTEGVSAFFG 798
             TWYK GQK+   +  +    + D   ++L +      D  E+      +   +   A   
Sbjct: 25417 TWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLT 25476

Query: 799   VTVQDPPVH--IVDPREHVFVHAITSECVMLACEVDREDAP---VRWYKDGQEVEESDFV 853
             VT+  PP    +    + +  +A   E   +  E+     P   ++W KDGQ +     +
Sbjct: 25477 VTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNI 25536

Query: 854   VLENEG-PHRRLVLPATQPSDGGEFQCVA 881
              + +EG  +  L +  T P D G ++  A
Sbjct: 25537 EIIHEGLDYYALHIRDTLPEDTGYYRVTA 25565



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 21/73 (28%), Positives = 31/73 (42%), Gaps = 8/73 (10%)

Query: 18   PRPVRVVSGAEAELKC--------VVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGL 69
            PRP+ ++ G   +  C        V +       VW K GQ++  S+R+    D   H L
Sbjct: 2307 PRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHML 2366

Query: 70   LLTAALPTDAGVY 82
            L+      DAG Y
Sbjct: 2367 LIEDMTKEDAGNY 2379



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 18/60 (30%), Positives = 30/60 (50%)

Query: 482   LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPP 541
             LV+  VTR D+G    +L N+  +    V       P  P+   + +  K++V L+W+PP
Sbjct: 18858 LVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPP 18917



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 41/171 (23%), Positives = 64/171 (37%), Gaps = 28/171 (16%)

Query: 63    DGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPG 122
             D +E    +T   P D   +   ARNA G        T+  P  S   +   +  +P   
Sbjct: 21602 DVSECQYTVTGLSPGDRYEFRIIARNAVG--------TISPPSQSSGIIMTRDENVP--- 21650

Query: 123   SGEGAPVFLTGPR---SQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFAL 179
                  P+   GP       +  G  + +     G P P + W KDG+ +++  +      
Sbjct: 21651 -----PIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNME---- 21701

Query: 180   QPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPP 230
                   D  G S +L +  A     GVY   A+NA G A+A   ++V   P
Sbjct: 21702 ----ITDVLG-STSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTP 21747



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 1/91 (1%)

Query: 1183  LCVAPGEPVVLSCELSRAGAP-VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAG 1241
             L +  GE + +   +     P V W  +G  +++   +E+        L ++ A   H G
Sbjct: 21663 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 21722

Query: 1242  LYTCQSGAAPGAPSLSFTVQVAEPPVRVVAP 1272
             +YT ++  A G+      V+V + P +VV P
Sbjct: 21723 VYTVEAKNASGSAKAEIKVKVQDTPGKVVGP 21753



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 39/167 (23%), Positives = 65/167 (38%), Gaps = 32/167 (19%)

Query: 453   LEAGVEGR------WSRDGEELPVICQSSS----GHMHALVLPGVTREDAGEVTFSLGNS 502
             L+A V G+      W++  +EL  +C+  S    G     V+    R D+G+ T ++ N+
Sbjct: 22762 LDAAVGGKPEPKIIWTKGDKELD-LCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 22820

Query: 503   RTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWK-PPEPAPETPFIYRLERQEVGSE 561
               T  + V       PGP     + +  +    L W  P E        Y +ER+E    
Sbjct: 22821 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 22880

Query: 562   DWIQCFSIEKAGAVEVPGDC---------VPSEGDYRFRICTVSGHG 599
             +W           V V G+C         +    +Y FR+  V+ +G
Sbjct: 22881 NW-----------VIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYG 22916



 Score = 33.5 bits (75), Expect = 2.0
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 1721  VLSELRSVSAREGDGATFEC-TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSE 1779
             +L++ RS++  EG+ A F C T  E   T  W   G+ L   AR ++     K    +S 
Sbjct: 26258 ILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISS 26317

Query: 1780  LRAEDAG 1786
             ++A D G
Sbjct: 26318 VQASDEG 26324



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 27/97 (27%), Positives = 40/97 (41%), Gaps = 9/97 (9%)

Query: 139  VLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILA 198
            V  G ++ L     G PEP + W K  M L +        +     E+ P  S  + I+ 
Sbjct: 7397 VKAGTKIELPATVTGKPEPKITWTKADMILKQ---DKRITI-----ENVPKKS-TVTIVD 7447

Query: 199  ARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPA 235
            ++  D+G Y+  A N  G A A   + V   P  P A
Sbjct: 7448 SKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAA 7484



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 32/111 (28%), Positives = 44/111 (39%), Gaps = 11/111 (9%)

Query: 134   PRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLA 193
             P    +  G ++ +     G P PT  W+K     DEV  SSH A+          +S  
Sbjct: 12600 PEQITIKAGKKLRIEAHVYGKPHPTCKWKK---GEDEVVTSSHLAVHKA------DSSSI 12650

Query: 194   LRILAARLPDSGVYVCHARNAHG-HAQAGALLQVHQP-PESPPADPDEAPA 242
             L I      DSG Y   A N+ G   Q   ++ +  P P  PP D  +  A
Sbjct: 12651 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDA 12701



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 13/89 (14%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTV 983
             RP  EV+W +D  E ++  +  ++   +   L++  V   DSG+Y+  +++ S S +  V
Sbjct: 15582 RPAPEVKWARDHGESLDKAS--IESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFV 15639

Query: 984   TEPPVRII----YPRD----EVTLIAVTL 1004
                 VR++     P+D    EVT  +VTL
Sbjct: 15640 N---VRVLDTPGPPQDLKVKEVTKTSVTL 15665



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 5/83 (6%)

Query: 1640  VTEGDTATFECEL-SQALADVTWEKDGNAL-TPSPRLRLQALGTRRLLQLRRCGPSDAGT 1697
             V  G+T   E ++  + + DV W KDG  L   + R+ +++   +  L ++ C  +D G 
Sbjct: 18414 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18473

Query: 1698  YSCA---VGTARAGPVRLTVRER 1717
             Y      VG  ++ P+ + V +R
Sbjct: 18474 YILKLSNVGGTKSIPITVKVLDR 18496



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%)

Query: 512   CVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC 566
             C  + PPGPP   E+    K+++++TW  P     T    Y LE+++     W +C
Sbjct: 18591 CNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKC 18646



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 491   DAGEVTFSLGNSRTTTLLRVKCVKHSPPGPP----ILAEMFKGHKNTVLLTWKPPE-PAP 545
             DAG    +  NS  TT   +  V    PGPP    +++++    + +V L W+PP+    
Sbjct: 20238 DAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDI---TEESVTLKWEPPKYDGG 20294

Query: 546   ETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHV 604
                  Y L ++E  +  W +  +      ++V    + +  +Y+FRI   +  G S H+
Sbjct: 20295 SQVTNYILLKRETSTAVWTEVSATVARTMMKVMK--LTTGEEYQFRIKAENRFGISDHI 20351



 Score = 33.1 bits (74), Expect = 2.6
 Identities = 24/92 (26%), Positives = 36/92 (39%), Gaps = 2/92 (2%)

Query: 16    RFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAAL 75
             R+   + V  G    L   + G+P P+  W K GQ +  S+R           L++  A 
Sbjct: 23836 RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSETHTELVIKEAD 23893

Query: 76    PTDAGVYVCRARNAAGEAYAAAAVTVLEPPAS 107
               D+G Y     N  G+      V V+  P S
Sbjct: 23894 RGDSGTYDLVLENKCGKKAVYIKVRVIGSPNS 23925



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 33/158 (20%), Positives = 60/158 (37%), Gaps = 22/158 (13%)

Query: 720  PQDRVSLTFTTSERVVLTCELSRVDFP--------ATWYKDGQKVEESELLVVKMDGRKH 771
            P  + ++   T + +V+  E   +  P         +W+KDG++V+ S+ L +K D    
Sbjct: 8078 PDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISA 8137

Query: 772  RLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEV 831
             L +P++   D+G +    E        ++    + +  P + +    IT     L  E 
Sbjct: 8138 HLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEP 8197

Query: 832  DRED--APVRWYKDGQEVEESDFVVLENEGPHRRLVLP 867
               D   P+  Y            VLE     RR  +P
Sbjct: 8198 PEFDGGTPILHY------------VLERREAGRRTYIP 8223



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 34/109 (31%), Positives = 47/109 (43%), Gaps = 8/109 (7%)

Query: 1638  LEVTEGDTATFECEL-SQALADVTWEKDGNA--LTPSPRLRLQALGTRRLLQLRRCGPSD 1694
             L V  GDT   E  +  +   +V W KD +A  LT SPR+++          L +   SD
Sbjct: 11906 LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSD 11965

Query: 1695  AGTYSCAVGTARAGPVRLTVRERTVAVLSELRSV-SAREGDGATFECTV 1742
              G Y     T  AG     V   TV VL +   V + +  D ++  CTV
Sbjct: 11966 GGKY-VVTATNTAGSF---VAYATVNVLDKPGPVRNLKIVDVSSDRCTV 12010



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 40/173 (23%), Positives = 66/173 (38%), Gaps = 17/173 (9%)

Query: 1096  PGRVELRCEVAPAG-SQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCE 1154
             PG   +RC  AP    Q  +   GLE +A    Q  A   T     P ++P D    + E
Sbjct: 12927 PGDKWVRCNTAPHQIPQEEYTATGLEEKAQ--YQFRAIARTAVNISPPSEPSDPVTILAE 12984

Query: 1155  TRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVV-WSHNGRPV 1213
                  I  +V +              S L V  G  V L   +     P V W  +G  +
Sbjct: 12985 NVPPRIDLSVAMK-------------SLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLL 13031

Query: 1214  QEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPP 1266
             +  EG+++  +     L + +     +G YT  +  + G+ S +  ++V + P
Sbjct: 13032 KPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKP 13084



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 4/85 (4%)

Query: 518   PGPPILAEMFKGHKNTVLLTW-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVE 576
             P PP    +    K+TV L W KP          Y +E Q  GS+ W    +++  G   
Sbjct: 14660 PSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVK--GLEC 14717

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRS 601
             V  +    E +Y F++  V+  GRS
Sbjct: 14718 VVRNLTEGE-EYTFQVMAVNSAGRS 14741



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 26/102 (25%), Positives = 41/102 (40%), Gaps = 8/102 (7%)

Query: 232   SPPADP-------DEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGR 284
             SPP++P       D+  AP ++       T  +  G+  +    V G+P P +EW  +G+
Sbjct: 15136 SPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGK 15195

Query: 285   PLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAG 326
               L    +L  +  D    L       +D G Y   A N  G
Sbjct: 15196 E-LEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGG 15236



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 20/87 (22%), Positives = 36/87 (41%)

Query: 833   REDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTI 892
             R  A V W KDGQ ++E+  V + +      L +      D G ++    +     TV I
Sbjct: 19116 RPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPI 19175

Query: 893   TDVSSWIVYPSGKVYVAAVRLERVVLT 919
             T +      P G + +  V  + + ++
Sbjct: 19176 TIIVLDRPGPPGPIRIDEVSCDSITIS 19202



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             P PP    +    K++V LTW  PE    +  + Y +E  E G ++W++C ++ K+    
Sbjct: 20070 PSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC-AVAKSTHHV 20128

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRS 601
             V G  +    +Y FR+   +  G S
Sbjct: 20129 VSG--LRENSEYFFRVFAENQAGLS 20151



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD---ESASFT 980
             RP   V W KD + +       ++  D+   L +P V   D+G+Y+  I++   E  S T
Sbjct: 20993 RPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSST 21052

Query: 981   VTV 983
             V+V
Sbjct: 21053 VSV 21055



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 23/89 (25%), Positives = 35/89 (39%), Gaps = 9/89 (10%)

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
             G+++VL    GG PEP + W K    LD          +      G  A+  ++      
Sbjct: 22757 GSDLVLDAAVGGKPEPKIIWTKGDKELD-------LCEKVSLQYTGKRATAVIKF--CDR 22807

Query: 202   PDSGVYVCHARNAHGHAQAGALLQVHQPP 230
              DSG Y    +NA G      +++V   P
Sbjct: 22808 SDSGKYTLTVKNASGTKAVSVMVKVLDSP 22836



 Score = 32.7 bits (73), Expect = 3.5
 Identities = 19/75 (25%), Positives = 33/75 (44%), Gaps = 2/75 (2%)

Query: 1637  DLEVTEGDTATFECEL-SQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDA 1695
             D+    G+ A   C++  + L D+ W + G  L  S + ++ + G    L +      D 
Sbjct: 24236 DVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDE 24295

Query: 1696  GTYSCAVGTARAGPV 1710
             G Y+C + T   G V
Sbjct: 24296 GVYTC-IATNEVGEV 24309



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 18/76 (23%), Positives = 32/76 (42%)

Query: 37   GEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVCRARNAAGEAYAA 96
            G P P   W  G + L   +R+      A   L+++ +  +D G+Y  +  N        
Sbjct: 7115 GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGE 7174

Query: 97   AAVTVLEPPASDPELQ 112
              V V+  P++  EL+
Sbjct: 7175 IDVNVIARPSAPKELK 7190



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 517  PPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDW 563
            PP PP   E+    KNT  L W  PE    +P   Y +E+++V  + W
Sbjct: 7778 PPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGW 7825



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 8/99 (8%)

Query: 25   SGAEAELKCVVLGEPPPVVVWEKGGQQLAASER--LSFPADG----AEHG--LLLTAALP 76
            +G++  +  V+ G P P   WE  G+   A +      P D     AE+   +++     
Sbjct: 9519 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKR 9578

Query: 77   TDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
            +  G Y   A+N AG+  A   V V++ P    +L+ ++
Sbjct: 9579 SHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSD 9617



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 6/70 (8%)

Query: 924   RPWAEVRWTKDGE--EVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASF-- 979
             +P+ EV WTKD +  ++  SP + +       +  L   +  D G+Y+    + + SF  
Sbjct: 11923 KPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVA 11982

Query: 980   --TVTVTEPP 987
               TV V + P
Sbjct: 11983 YATVNVLDKP 11992



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 19/81 (23%), Positives = 34/81 (41%)

Query: 25    SGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVYVC 84
             +G+   +   + G P P V W+    +L  ++R+S         L +  ++  D+G Y  
Sbjct: 22356 AGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFL 22415

Query: 85    RARNAAGEAYAAAAVTVLEPP 105
                N AG    +  V V+  P
Sbjct: 22416 TLENTAGVKTFSVTVVVIGRP 22436



 Score = 32.3 bits (72), Expect = 4.5
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 4/93 (4%)

Query: 1432  RAGSTATSARLHVRETELLFLRR-LQDVRAEEGQDVCLEVE-TGRVGAAGAVRWVRGGQP 1489
             R   TA S +  +   E   +R+ ++DV  + G+   L  +  GR      ++W R G+ 
Sbjct: 24210 RPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGR--PLPDIKWYRFGKE 24267

Query: 1490  LPHDSRLSMAQDGHIHRLFIHGVILADQGTYGC 1522
             L    +  M+ DG  H L +      D+G Y C
Sbjct: 24268 LIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC 24300



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 27/102 (26%), Positives = 42/102 (41%), Gaps = 15/102 (14%)

Query: 21    VRVVSGAEAELKCVVLGEPPPVVVWEKGG-------QQLAASERLSFPADGAEHGLLLTA 73
             V V +G    L  +V G P P V W K G        Q+   + ++F        L++  
Sbjct: 12311 VIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDTMAF--------LVIPN 12362

Query: 74    ALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAE 115
             +   D+G Y     N AGE      V VL+ P    +L+ ++
Sbjct: 12363 STRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSD 12404



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 16/60 (26%), Positives = 30/60 (50%)

Query: 924   RPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTV 983
             +P   V W KDG  +  +  + +  +  +  L L +V  +DSG+Y    ++ S S + T+
Sbjct: 13017 KPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 13076



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 1114  WYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
             W K G ++  SD  Q+ +   +  LT+ +A  +DAGEY
Sbjct: 14108 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEY 14145



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 1/84 (1%)

Query: 517   PPGPPILAEMFKGHKNTVLLTW-KPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAV 575
             PPGPP    +    K +  L W KP          Y +E Q+VG E WI+  +       
Sbjct: 14367 PPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRIT 14426

Query: 576   EVPGDCVPSEGDYRFRICTVSGHG 599
             +     + ++  Y FRI  ++  G
Sbjct: 14427 QFVVPDLQTKEKYNFRISAINDAG 14450



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 1081  IVHPAARSLDLHFGAPGRVELRCEVAPAGSQ---VRWYKDGLEVEASDALQLGAEGPTRT 1137
             ++ PA + L   F      +L+ +V   G     V W+KD + ++ +  +   +      
Sbjct: 15840 VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSL 15899

Query: 1138  LTLPHAQPEDAGEYVCETRH---EAI-TFNVILAEPP 1170
             LT+  A  ED G YV +  +   EAI T NVI+ + P
Sbjct: 15900 LTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKP 15936



 Score = 32.0 bits (71), Expect = 5.9
 Identities = 38/148 (25%), Positives = 56/148 (37%), Gaps = 23/148 (15%)

Query: 93    AYAAAAVTVL---EPPASDPELQPAER-PLPSPGSGEGAPVFLTGPRSQWVLRGAEVVLT 148
             ++  AAV V    E   S  E++P ER  +P     +     +T      +  GA + L 
Sbjct: 23109 SFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVT------IRAGASLRLM 23162

Query: 149   CRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRIL-AARLPDSGVY 207
                 G P P + W K G+ L              RA      S +L I+      D+G Y
Sbjct: 23163 VSVSGRPPPVITWSKQGIDL------------ASRAIIDTTESYSLLIVDKVNRYDAGKY 23210

Query: 208   VCHARNAHGHAQAGALLQVHQPPESPPA 235
                A N  G   A  L++V+  P   P+
Sbjct: 23211 TIEAENQSGKKSATVLVKVYDTPGPCPS 23238



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 21/110 (19%)

Query: 424 VTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEG------RWSRDGE-----ELPVIC 472
           +T + P   +  + + VLEG  A     T EA + G       W RDG+      LP + 
Sbjct: 1   MTTQAPTFTQPLQSVVVLEGSTA-----TFEAHISGFPVPEVSWFRDGQVISTSTLPGVQ 55

Query: 473 QSSSGHMHALVLPGVTREDAG----EVTFSLGNSRTTTLLRVKCVKHSPP 518
            S S     L +P VT+ ++G    + T   G + +T  L VK  + +PP
Sbjct: 56  ISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK-AETAPP 104



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 47/196 (23%), Positives = 80/196 (40%), Gaps = 24/196 (12%)

Query: 343 FTRPLQDVEGREHGIAVLECKVPNSRIP-TAWFREDQRL----LPCRKYEQIEEGTVRRL 397
           FT+PLQ V   E   A  E  +    +P  +WFR+ Q +    LP  +     +G  +  
Sbjct: 8   FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQI-SFSDGRAKLT 66

Query: 398 IIHRLKADDD--GIYLCEMRGRVRTVANVTVKG----PILKRLPRKLDVLEGENAVLLVE 451
           I    KA+     +      G+  + A + VK     P   +  + + V +G    L V 
Sbjct: 67  IPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVR 126

Query: 452 TLEAGVEG---RWSRDGEELPVICQ---SSSGHMHALVLPGVTREDAG----EVTFSLGN 501
               G+     ++ RDG E+        S  G +++L++     ED+G      T S+G 
Sbjct: 127 V--TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184

Query: 502 SRTTTLLRVKCVKHSP 517
           + +T  L V+  +  P
Sbjct: 185 ATSTAELLVQGEEEVP 200



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 22/104 (21%), Positives = 45/104 (43%), Gaps = 2/104 (1%)

Query: 1630 TIVRGPHDLEVTEGDTATFECELSQA-LADVTWEKDGNALTPSPRLRLQALGTRRLLQLR 1688
            TI    HD+ V EG+  +         +  V+W KDG  +  S RL ++       L++ 
Sbjct: 8083 TIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVP 8142

Query: 1689 RCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSARE 1732
            +   +DAG Y+  +   + G    ++  + + +    + + A +
Sbjct: 8143 KSVRADAGIYTITLEN-KLGSATASINVKVIGLPGPCKDIKASD 8185



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 26/112 (23%), Positives = 42/112 (37%), Gaps = 8/112 (7%)

Query: 232  SPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRR 291
            S    P +   P + P     +   V EG +      + G P P + W ++  P  PD +
Sbjct: 9798 SATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTLTW-FKAPPKKPDNK 9856

Query: 292  RLMYRDR-------DGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHV 336
              +  D        D    L +   +  D GLY   A N+ G     ++L+V
Sbjct: 9857 EPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9908



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 2/88 (2%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             PG P    +    K  V L W+ P+    +P + Y +ER+  GS+DW +           
Sbjct: 11796 PGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHY 11855

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRSPHV 604
             +   CV ++  Y FR+ T +  G S  V
Sbjct: 11856 MVDRCVENQ-IYEFRVQTKNEGGESDWV 11882



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 25/85 (29%), Positives = 32/85 (37%), Gaps = 10/85 (11%)

Query: 153   GLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHAR 212
             G P+PT+ W+K    L +    +          +    S  L I      DSG Y   AR
Sbjct: 14786 GRPKPTVTWKKGDQILKQTQRVNF---------ETTATSTILNINECVRSDSGPYPLTAR 14836

Query: 213   NAHGHAQAGALLQVHQPPESPPADP 237
             N  G       +QVH  P  PP  P
Sbjct: 14837 NIVGEVGDVITIQVHDIP-GPPTGP 14860



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 13/40 (32%), Positives = 20/40 (50%)

Query: 1659  VTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTY 1698
             VTW+K    L  + R+  +   T  +L +  C  SD+G Y
Sbjct: 14792 VTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPY 14831



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 515   HSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQC 566
             + PP PP   E+    K+++++ W  P+    +  I Y +ER++   + WI+C
Sbjct: 15347 YGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKC 15399



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 518   PGPPILAEMFKGHKNTVLLTWKPPEPAPETPFI-YRLERQEVGSEDWIQCFSIEKAGAVE 576
             P PP    +    +N+V L+W+ PE    +  + Y +E Q  GS+ W  C ++ K     
Sbjct: 15744 PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATV-KVTEAT 15802

Query: 577   VPGDCVPSEGDYRFRICTVSGHGRS 601
             + G  +  E +Y FR+   +  G S
Sbjct: 15803 ITG-LIQGE-EYSFRVSAQNEKGIS 15825



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 29/107 (27%), Positives = 40/107 (37%), Gaps = 10/107 (9%)

Query: 142   GAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARL 201
             G  V L     G P PT+ W KD    D+   ++         +       ++ I  A  
Sbjct: 20582 GTSVKLRAGISGKPAPTIEWYKD----DKELQTNALVCVENTTD-----LASILIKDADR 20632

Query: 202   PDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPL 248
              +SG Y    RNA G A A   +Q+   P  PP  P E      E +
Sbjct: 20633 LNSGCYELKLRNAMGSASATIRVQILDKP-GPPGGPIEFKTVTAEKI 20678



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 18/77 (23%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 260   GKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVC 319
             G   K R  + GKP P IEW+ + + L  +    +    D   +L +      + G Y  
Sbjct: 20582 GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASIL-IKDADRLNSGCYEL 20640

Query: 320   AARNSAGQTLSAVQLHV 336
               RN+ G   + +++ +
Sbjct: 20641 KLRNAMGSASATIRVQI 20657



 Score = 31.6 bits (70), Expect = 7.7
 Identities = 24/83 (28%), Positives = 29/83 (34%), Gaps = 2/83 (2%)

Query: 23    VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLTAALPTDAGVY 82
             V +GA   L     G P P  VW K    L  S R       +   L +      DAG Y
Sbjct: 22064 VRAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNRNDAGKY 22121

Query: 83    VCRARNAAGEAYAAAAVTVLEPP 105
                  N +G       V VL+ P
Sbjct: 22122 TLTVENNSGSKSITFTVKVLDTP 22144


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  461 bits (1185), Expect = e-129
 Identities = 389/1568 (24%), Positives = 676/1568 (43%), Gaps = 73/1568 (4%)

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
            K   V E + A+F C +    E  + W  +G  ++    +          +L +   Q  
Sbjct: 5121 KDVTVPERRQARFECVLTR--EANVIWS-KGPDIIKSSDKFDIIADGKKHILVINDSQFD 5177

Query: 313  DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA 372
            D G+Y        G+  SA +L V   RL+F  PL+D   +E   A   C++ + ++   
Sbjct: 5178 DEGVYTAEVE---GKKTSA-RLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVV 5233

Query: 373  WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILK 432
            WF+ D +L   R      EG   +L +  +  DD    + +++ +V+ +++ T +  +L+
Sbjct: 5234 WFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDD----ISQIKAQVKELSS-TAQLKVLE 5288

Query: 433  RLPRKLDVLEGENAVLLVE-TLEAGVEG----RWSRDGEEL---PVICQSSSGHMHALVL 484
              P     L  + AV   E TL+  V      +W +DGEE+   P     + G    L +
Sbjct: 5289 ADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKI 5348

Query: 485  PGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPA 544
                 +D GE     G  +T   + V+        P    E+F G      +    P+  
Sbjct: 5349 KKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVH 5408

Query: 545  PETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHV 604
             +    ++L+ Q + +    +     K   + +    +   G+  F+    + + +S   
Sbjct: 5409 GQ----WKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQ----AANAKSAAN 5460

Query: 605  VFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
            +      L+     +  L DV+V++ ++A F  ++S   +   +L G          Q  
Sbjct: 5461 LKVKELPLI----FITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGT---------QEI 5507

Query: 665  PGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRV 724
             G  R+ + + G +H +++ +   +D    + F       S  L I+   +  L+P   V
Sbjct: 5508 TGDDRFELIKDGTKHSMVIKSAAFEDEAKYM-FEAEDKHTSGKLIIEGIRLKFLTPLKDV 5566

Query: 725  SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
              T    E  V T ELS  +    W+K+ Q++  +  + ++ +G+ H +   +  + D+ 
Sbjct: 5567 --TAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTS 5624

Query: 785  EFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDG 844
            +      G+S+   +TV +   +     +      +  + V+L CE+ + DAPV+W+KDG
Sbjct: 5625 QIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYT--GVEKDEVILQCEISKADAPVKWFKDG 5682

Query: 845  QEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSG 904
            +E++ S   V++ +G  R L+L     SD G++ C  G +     + I D    +V P  
Sbjct: 5683 KEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH 5742

Query: 905  KVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLED 964
             V V      R     E+        W   GE ++++P   +++E  +  LVL   +L+ 
Sbjct: 5743 SVEVMETETAR--FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQ 5800

Query: 965  SGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYK 1024
            +G    +  +  +S  + V    + ++ P  +VT+ A   E     CELS ED PV WY 
Sbjct: 5801 TGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAG--ETATFDCELSYEDIPVEWYL 5858

Query: 1025 DGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHP 1084
             G ++E S+ +V   +G    L L   + ED GE    A D      + V  PP     P
Sbjct: 5859 KGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKP 5918

Query: 1085 AARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQ 1144
                 D          L CEV+   ++V+W+K+G E+  S   ++ A+G  R L +    
Sbjct: 5919 LE---DQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCT 5975

Query: 1145 PEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPV 1204
            PED   Y C+ +    + N+ +  P V+FL   T    L V   E     CELSR  A V
Sbjct: 5976 PEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTD---LQVREKEMARFECELSRENAKV 6032

Query: 1205 VWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE 1264
             W  +G  +++G+  ++ ++G  R+L I          Y+C+   A  +  L+   + A 
Sbjct: 6033 KWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEA- 6091

Query: 1265 PPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQ 1324
                V     A   V  T    ++LV  +S PG  V WYK  E +   GR ++   G ++
Sbjct: 6092 ----VFTKNLANIEVSETD--TIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKR 6145

Query: 1325 VLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVS 1384
            +L +Q A   DAG Y C  P       V V E L  + +S+   L + EG+ A F C +S
Sbjct: 6146 ILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHE-LAAEFISKPQNLEILEGEKAEFVCSIS 6204

Query: 1385 PPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHV 1444
                 V W R+   +  G + ++  +G  R+L ++   L D GT  +  G+   +A L V
Sbjct: 6205 KESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTV 6264

Query: 1445 RETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHI 1504
             E +L  +  L+D R +E Q+V    E    GA    +W R  + +   S+  + Q   +
Sbjct: 6265 IE-KLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKA--KWFRNEEAIFDSSKYIILQKDLV 6321

Query: 1505 HRLFIHGVILADQGTYGCESHHDR-----TLARLSVRPRQLRVLRPLEDVTISEGGSATF 1559
            + L I    L DQ  Y     + R     + A L V    LR++ PL+D+   E  S TF
Sbjct: 6322 YTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTF 6381

Query: 1560 QLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCA 1619
              ++++  VT +W + G ++    +     D ++H L +   G  D G    TA   +  
Sbjct: 6382 WCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSV 6441

Query: 1620 ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQAL 1679
            A L++ E P   V    D  VTE D A F C+LS+  A+V W ++G  +    + + +  
Sbjct: 6442 AELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKD 6501

Query: 1680 GTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFE 1739
            G+   L ++ C   D   Y+C V   R    RL V E  V ++   + +    G    F 
Sbjct: 6502 GSIHRLIIKDCRLDDECEYACGV-EDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFL 6560

Query: 1740 CTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLA 1799
              +++ +   +W      +  G + ++  EGK H L + +++  D GE RF A   ++ A
Sbjct: 6561 AELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARA 6620

Query: 1800 LLEVEALP 1807
             LE+ A P
Sbjct: 6621 KLELAAAP 6628



 Score =  439 bits (1128), Expect = e-122
 Identities = 392/1575 (24%), Positives = 667/1575 (42%), Gaps = 85/1575 (5%)

Query: 327  QTLSAVQ---LHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPC 383
            Q L+A+    L VKE  L F  PL+DV   E   A  EC V        W +    +   
Sbjct: 5097 QALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFEC-VLTREANVIWSKGPDIIKSS 5155

Query: 384  RKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILKRLPRKLD--VL 441
             K++ I +G    L+I+  + DD+G+Y  E+ G+ +T A + V G  LK +    D  V 
Sbjct: 5156 DKFDIIADGKKHILVINDSQFDDEGVYTAEVEGK-KTSARLFVTGIRLKFMSPLEDQTVK 5214

Query: 442  EGENAVLLVETLEAGVEGRWSRDGEELPV---ICQSSSGHMHALVLPGVTREDAGEVTFS 498
            EGE A  + E     +   W ++  +L     +  SS G  H L +  VT +D  ++   
Sbjct: 5215 EGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQ 5274

Query: 499  LGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPF-----IYRL 553
            +    +T  L+V  ++  P     L +     K+ + L  +  +  P   F     I   
Sbjct: 5275 VKELSSTAQLKV--LEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPS 5332

Query: 554  ERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLV 613
             +  + ++   +   I+KA         +  +G+Y   +C         +V     A L+
Sbjct: 5333 PKYSIKADGLRRILKIKKAD--------LKDKGEY---VCDCGTDKTKANVTVE--ARLI 5379

Query: 614  PTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGTWFLNGEELKSNEPEGQVEPGALRYRI 672
               + + G+E   V+ GE A F ++LS   + G W L G+ L ++ P+ +         I
Sbjct: 5380 KVEKPLYGVE---VFVGETAHFEIELSEPDVHGQWKLKGQPLTAS-PDCE---------I 5426

Query: 673  EQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSE 732
             + G +H LILH  +   +G  V F     + +A L ++E P+  ++P   V +     +
Sbjct: 5427 IEDGKKHILILHNCQLGMTGE-VSFQAANAKSAANLKVKELPLIFITPLSDVKVF--EKD 5483

Query: 733  RVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEG 792
                 CE+SR      W K  Q++   +   +  DG KH +++  A  +D  ++    E 
Sbjct: 5484 EAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAED 5543

Query: 793  VSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDF 852
                  + ++   +  + P + V   A   E  +   E+  ++  V+W+K+ Q +  +  
Sbjct: 5544 KHTSGKLIIEGIRLKFLTPLKDVT--AKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRS 5601

Query: 853  VVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVY-VAAV 911
            V +++EG    +        D  + +  A    +   +T+ +      Y +GK+     V
Sbjct: 5602 VSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDP---YFTGKLQDYTGV 5658

Query: 912  RLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCE 971
              + V+L CE+ +  A V+W KDG+E+  S   +++ +   R L+L      D G+Y C+
Sbjct: 5659 EKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD 5718

Query: 972  IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEE 1031
               +  S  + + +  ++++ P   V ++    E      E+S +D    W   G  + +
Sbjct: 5719 CGTDKTSGKLDIEDREIKLVRPLHSVEVMET--ETARFETEISEDDIHANWKLKGEALLQ 5776

Query: 1032 SEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDL 1091
            +    ++ +G    LVL   + +  G     A +  +   + V      ++ P     D+
Sbjct: 5777 TPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLK---DV 5833

Query: 1092 HFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
               A       CE++     V WY  G ++E SD +   +EG   TLTL   + EDAGE 
Sbjct: 5834 TVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEV 5893

Query: 1152 VCETRHEAITFNVILAEPPVQFLALETTP-SPLCVAPGEPVVLSCELSRAGAPVVWSHNG 1210
                +      N+ + EPPV+F    T P     V  G   VL CE+SR  A V W  NG
Sbjct: 5894 QLTAKDFKTHANLFVKEPPVEF----TKPLEDQTVEEGATAVLECEVSRENAKVKWFKNG 5949

Query: 1211 RPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVV 1270
              + + +  E+ A+G  R L I    P     YTC +         S  + V  P V  +
Sbjct: 5950 TEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDF----KTSCNLNVVPPHVEFL 6005

Query: 1271 APEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQG 1330
             P     +VR       E    LS     V+W+KDG  +    +  +   GA ++L +  
Sbjct: 6006 RP-LTDLQVREKEMARFEC--ELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINK 6062

Query: 1331 ARSGDAGEYLCDA--PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA 1388
                D  EY C+    + S +  V  EE +  K    L  + V E D     CEVS P A
Sbjct: 6063 CLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTK---NLANIEVSETDTIKLVCEVSKPGA 6119

Query: 1389 DVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETE 1448
            +V W +    +    + E+   G  RIL ++   L DAG    R  S+ T  ++ V E  
Sbjct: 6120 EVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELA 6179

Query: 1449 LLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLF 1508
              F+ + Q++   EG+         +   +  V+W R  + L    +  +  DG    L 
Sbjct: 6180 AEFISKPQNLEILEGEKAEFVCSISK--ESFPVQWKRDDKTLESGDKYDVIADGKKRVLV 6237

Query: 1509 IHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGV 1568
            +    L D GTY       R  A L+V  + LR++ PL+D  + E     F  E++ EG 
Sbjct: 6238 VKDATLQDMGTYVVMVGAARAAAHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGA 6296

Query: 1569 TGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGC--VSFT---ADSLRCAARLI 1623
              +W R    ++   K  I      + L +    L D     VS T    ++++ AA LI
Sbjct: 6297 KAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLI 6356

Query: 1624 VREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRR 1683
            V E  + IV    D+E  E  + TF C++++    + W K+G  +    R+  +    + 
Sbjct: 6357 VEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKH 6416

Query: 1684 LLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVS 1743
            +L ++ CG  D G Y    G  ++    L + E     +  L   +  E D A F C +S
Sbjct: 6417 MLTIKDCGFPDEGEYIVTAGQDKS-VAELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQLS 6475

Query: 1744 EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEV 1803
              +   +W   GR ++ G + +  ++G  H L++ + R +D  E        +S A L V
Sbjct: 6476 REKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFV 6535

Query: 1804 EALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTH 1863
            E +P+++ R PP++     G   V    +++    V WLR    +  GDK++M S G  H
Sbjct: 6536 EEIPVEIIR-PPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIH 6594

Query: 1864 SLVIHDVRPEDQGTY 1878
             L I D++P DQG Y
Sbjct: 6595 RLQICDIKPRDQGEY 6609



 Score =  394 bits (1013), Expect = e-109
 Identities = 402/1699 (23%), Positives = 685/1699 (40%), Gaps = 129/1699 (7%)

Query: 228  QPPESPPADPDEAPAPVVEPLKCAPKTFWVNE------------GKHAKFRCYVMGKPEP 275
            +P       PDEAP      LK  P  F V E            G  A F C V   P  
Sbjct: 4720 RPGSGGEKPPDEAP--FTYQLKAVPLKF-VKEIKDIILTESEFVGSSAIFECLV--SPST 4774

Query: 276  EIE-WHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQL 334
             I  W  +G  +    +     D      L ++  Q  D G Y C  R    +  S  +L
Sbjct: 4775 AITTWMKDGSNIRESPKHRFIADGKDR-KLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL 4833

Query: 335  HVKEPRLRFTRPLQD----VEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIE 390
             V+E  +RF + L++    V+G+      L C++ N      W R+D +++   K  +I 
Sbjct: 4834 VVEELPVRFVKTLEEEVTVVKGQP---LYLSCEL-NKERDVVW-RKDGKIV-VEKPGRIV 4887

Query: 391  EGTV---RRLIIHRLKADDDGIYLCEMRGRVRTVANVTVK-----GPILKRLPRKLDVLE 442
             G +   R L I+     D G Y   +        +  VK        L +  R   V  
Sbjct: 4888 PGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKP 4947

Query: 443  GENAVLLVETLEAGVEGRWSRDGEELPVICQSSS-----GHMHALVLPGVTREDAGEVTF 497
               A+   +  +     +W +  +E+P      +     G+   L +     ED  E   
Sbjct: 4948 KGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAV 5007

Query: 498  SLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLER-- 555
             +   R                    A++  G +   LL  KP E       IY  E   
Sbjct: 5008 EIEGKRYP------------------AKLTLGEREVELL--KPIEDVT----IYEKESAS 5043

Query: 556  --QEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLV 613
               E+   D    + ++       P   + +EG  RF         ++  V++  + + +
Sbjct: 5044 FDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQ-ALNAI 5102

Query: 614  PTARL---------VAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVE 664
             TA L            L+DV V +   A F   L+      W    + +KS++      
Sbjct: 5103 TTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTREANVIWSKGPDIIKSSD------ 5156

Query: 665  PGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRV 724
                ++ I   G +H L+++  +  D G        G + SA L +    +  +SP +  
Sbjct: 5157 ----KFDIIADGKKHILVINDSQFDDEGVYTA-EVEGKKTSARLFVTGIRLKFMSPLE-- 5209

Query: 725  SLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSG 784
              T    E     CELS       W+K+  K+  S  +++  +G+ H+L + E  + D  
Sbjct: 5210 DQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDIS 5269

Query: 785  EFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVH---AITSECVMLACEVDREDAPVRWY 841
            + + + + +S+   + V +      DP   V +H   A+  + + L CEV + D PV+W+
Sbjct: 5270 QIKAQVKELSSTAQLKVLE-----ADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWF 5323

Query: 842  KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
            KDG+E+  S    ++ +G  R L +      D GE+ C  G +     VT   V + ++ 
Sbjct: 5324 KDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVT---VEARLIK 5380

Query: 902  PSGKVYVAAVRL-ERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAV 960
                +Y   V + E      EL  P    +W   G+ +  SP   + ++     L+L   
Sbjct: 5381 VEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNC 5440

Query: 961  QLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPV 1020
            QL  +GE   +  +  ++  + V E P+  I P  +V +     +     CE+SRE    
Sbjct: 5441 QLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVF--EKDEAKFECEVSREPKTF 5498

Query: 1021 RWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPER 1080
            RW K   E+   +   L +DG +  +V+ +A  ED  +++ +A D      + +     +
Sbjct: 5499 RWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLK 5558

Query: 1081 IVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTL 1140
             + P     D+            E++    +V+W+K+   +  + ++ +  EG T ++T 
Sbjct: 5559 FLTPLK---DVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITF 5615

Query: 1141 PHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRA 1200
                 +D  +   E    +    + + E    F               + V+L CE+S+A
Sbjct: 5616 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTG---KLQDYTGVEKDEVILQCEISKA 5672

Query: 1201 GAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTV 1260
             APV W  +G+ ++  +   + A+G +R+L ++ A  +  G YTC      G    S  +
Sbjct: 5673 DAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDC----GTDKTSGKL 5728

Query: 1261 QVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQA 1320
             + +  +++V P      V  T     E    +S       W   GE L      ++++ 
Sbjct: 5729 DIEDREIKLVRP-LHSVEVMETETARFE--TEISEDDIHANWKLKGEALLQTPDCEIKEE 5785

Query: 1321 GARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFR 1380
            G    L +   R    G     A        + V +P ++ L+  L  +TV  G+ ATF 
Sbjct: 5786 GKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRV-KPRVIGLLRPLKDVTVTAGETATFD 5844

Query: 1381 CEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSA 1440
            CE+S  D  V W   G  + P  +V     G    LTLR  +L DAG V L A    T A
Sbjct: 5845 CELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHA 5904

Query: 1441 RLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQ 1500
             L V+E  + F + L+D   EEG    LE E  R  A   V+W + G  +    +  +  
Sbjct: 5905 NLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENA--KVKWFKNGTEILKSKKYEIVA 5962

Query: 1501 DGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQ 1560
            DG + +L IH     D  TY C++   +T   L+V P  +  LRPL D+ + E   A F+
Sbjct: 5963 DGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFE 6022

Query: 1561 LELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAA 1620
             ELS+E    +W + G ++  G K  I S G    LV+N   L D    S    + R + 
Sbjct: 6023 CELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSG 6082

Query: 1621 RLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALG 1680
             L V E      +   ++EV+E DT    CE+S+  A+V W K    +  + R  +   G
Sbjct: 6083 MLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEG 6142

Query: 1681 TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFEC 1740
             +R+L ++     DAG Y+C + ++R    ++ V E     +S+ +++   EG+ A F C
Sbjct: 6143 RKRILVIQNAHLEDAGNYNCRLPSSRTDG-KVKVHELAAEFISKPQNLEILEGEKAEFVC 6201

Query: 1741 TVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLA- 1799
            ++S+     +W+   + L  G +  +  +GKK +LV+ +   +D G      G A++ A 
Sbjct: 6202 SISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAH 6261

Query: 1800 LLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSH 1859
            L  +E L + +   P ++  V   +  V    V+  G    W R    +    KY +   
Sbjct: 6262 LTVIEKLRIVV---PLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQK 6318

Query: 1860 GPTHSLVIHDVRPEDQGTY 1878
               ++L I D   +DQ  Y
Sbjct: 6319 DLVYTLRIRDAHLDDQANY 6337



 Score =  385 bits (988), Expect = e-106
 Identities = 420/1813 (23%), Positives = 709/1813 (39%), Gaps = 111/1813 (6%)

Query: 105  PASDPELQPAERP-------LPSPGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEP 157
            P S  E  P E P       +P     E   + LT   S++V  G+  +  C        
Sbjct: 4721 PGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILT--ESEFV--GSSAIFECLVSPSTAI 4776

Query: 158  TLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILAARLPDSGVYVCHARNAHGH 217
            T  W KDG  + E          P       G    L I+  +L D+G Y C  R  +  
Sbjct: 4777 TT-WMKDGSNIRE---------SPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKE 4826

Query: 218  AQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEI 277
              + A L V + P              V  +K   +   V +G+     C +    E ++
Sbjct: 4827 KTSTAKLVVEELP--------------VRFVKTLEEEVTVVKGQPLYLSCEL--NKERDV 4870

Query: 278  EWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVK 337
             W  +G+ ++    R++         L +      D G Y     N+     S+    V+
Sbjct: 4871 VWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVE 4930

Query: 338  EPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFR--EDQRLLPCRKYEQIEEGTVR 395
              R    +P++D   +  G A+  C +        WF+  ++    P  K E + +G   
Sbjct: 4931 VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHL 4990

Query: 396  RLIIHRLKADDDGIYLCEMRGRVRTVANVTV---KGPILKRLPRKLDVLEGENAVLLVET 452
             L I     +D   Y  E+ G+ R  A +T+   +  +LK +   + + E E+A    E 
Sbjct: 4991 YLKIKNAMPEDIAEYAVEIEGK-RYPAKLTLGEREVELLKPI-EDVTIYEKESASFDAEI 5048

Query: 453  LEAGVEGRWSRDGEEL---PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLR 509
             EA + G+W   GE L   P     + G    L L  V  + AGEV +   N+ TT +L 
Sbjct: 5049 SEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILT 5108

Query: 510  VKCVK--HSPPGPPILAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCF 567
            VK ++   + P   +     +  +   +LT        E   I+      + S D     
Sbjct: 5109 VKEIELDFAVPLKDVTVPERRQARFECVLT-------REANVIWSKGPDIIKSSDKFDII 5161

Query: 568  SIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQV 627
            +  K   + +       EG Y      V G   S  +   G        + ++ LED  V
Sbjct: 5162 ADGKKHILVINDSQFDDEGVYT---AEVEGKKTSARLFVTGIR-----LKFMSPLEDQTV 5213

Query: 628  YDGEDAVFSLDLS-TIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAV 686
             +GE A F  +LS   +   WF N  +L ++              I  +G  H+L +  V
Sbjct: 5214 KEGETATFVCELSHEKMHVVWFKNDAKLHTSRT----------VLISSEGKTHKLEMKEV 5263

Query: 687  KHQDSGALVGFSCPGVQDSAALTIQES-PVHILSPQDRVSLTFTTSERVVLTCELSRVDF 745
               D   +       +  +A L + E+ P   +   D+   T    + + L CE+S+ D 
Sbjct: 5264 TLDDISQIKA-QVKELSSTAQLKVLEADPYFTVKLHDK---TAVEKDEITLKCEVSK-DV 5318

Query: 746  PATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPP 805
            P  W+KDG+++  S    +K DG +  L + +A ++D GE+ C          VTV+   
Sbjct: 5319 PVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARL 5378

Query: 806  VHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLV 865
            + +  P   V V     E      E+   D   +W   GQ +  S    +  +G    L+
Sbjct: 5379 IKVEKPLYGVEV--FVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILI 5436

Query: 866  LPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRP 925
            L   Q    GE    A +  +   + + ++    + P   V V     +     CE+ R 
Sbjct: 5437 LHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKV--FEKDEAKFECEVSRE 5494

Query: 926  WAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTE 985
                RW K  +E+       L K+ T   +V+ +   ED  +Y+ E +D+  S  + +  
Sbjct: 5495 PKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEG 5554

Query: 986  PPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCR 1045
              ++ + P  +VT  A   E  V   ELS ++  V+W+K+   +  + ++ ++ +G    
Sbjct: 5555 IRLKFLTPLKDVT--AKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHS 5612

Query: 1046 LVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEV 1105
            +       +D  +   +A   S+   +TV    E   +   +  D        V L+CE+
Sbjct: 5613 ITFKDLSIDDTSQIRVEAMGMSSEAKLTVL---EGDPYFTGKLQDYTGVEKDEVILQCEI 5669

Query: 1106 APAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVI 1165
            + A + V+W+KDG E++ S    + A+G  R L L  A   D G+Y C+   +  +  + 
Sbjct: 5670 SKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLD 5729

Query: 1166 LAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEG 1225
            + +  ++   L      + V   E      E+S       W   G  + +    E+  EG
Sbjct: 5730 IEDREIK---LVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEG 5786

Query: 1226 PRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGG 1285
                L +        G      G    A ++  +  +   P RV+        V  T G 
Sbjct: 5787 KIHSLVLHNCRLDQTG------GVDFQAANVKSSAHLRVKP-RVIGLLRPLKDVTVTAGE 5839

Query: 1286 DLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQ 1345
                   LS    PV WY  G++L    +V     G    L ++  +  DAGE    A  
Sbjct: 5840 TATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 5899

Query: 1346 DSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQV 1405
                  + V+EP  V+    L   TV EG  A   CEVS  +A V W +NG  +    + 
Sbjct: 5900 FKTHANLFVKEPP-VEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKY 5958

Query: 1406 EMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQD 1465
            E+  +G  R L +  C   D  T T  A    TS  L+V    + FLR L D++  E + 
Sbjct: 5959 EIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEM 6018

Query: 1466 VCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESH 1525
               E E  R  A   V+W + G  +    +  +   G +  L I+  +L D+  Y CE  
Sbjct: 6019 ARFECELSRENAK--VKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVR 6076

Query: 1526 HDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKC 1585
              RT   L+V   +    + L ++ +SE  +     E+S+ G    W +G  ++    + 
Sbjct: 6077 TARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRY 6136

Query: 1586 HIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDT 1645
             I ++G +  LV+    L D+G  +    S R   ++ V E+    +  P +LE+ EG+ 
Sbjct: 6137 EILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEK 6196

Query: 1646 ATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTA 1705
            A F C +S+    V W++D   L    +  + A G +R+L ++     D GTY   VG A
Sbjct: 6197 AEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAA 6256

Query: 1706 RAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVR 1765
            RA    LTV E+ + ++  L+    +E     F C V+      +W      +   ++  
Sbjct: 6257 RAA-AHLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYI 6314

Query: 1766 IRQEGKKHILVLSELRAEDAGE-----VRFQAGPAQSLALLEVEALPLQMCRHPPREKTV 1820
            I Q+   + L + +   +D           +    +S A L VE   L++   P ++   
Sbjct: 6315 ILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIV-EPLKDIET 6373

Query: 1821 LVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCC 1880
            +  +       V+R    + W + G E+   ++   R     H L I D    D+G Y  
Sbjct: 6374 MEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIV 6433

Query: 1881 QAGQDSTHTRLLV 1893
             AGQD +   LL+
Sbjct: 6434 TAGQDKSVAELLI 6446



 Score =  380 bits (975), Expect = e-105
 Identities = 317/1277 (24%), Positives = 523/1277 (40%), Gaps = 41/1277 (3%)

Query: 622  LEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRL 681
            L D    + ++     ++S  +   WF +GEE+  +           +Y I+  GL+  L
Sbjct: 5297 LHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSP----------KYSIKADGLRRIL 5346

Query: 682  ILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELS 741
             +     +D G  V   C   +  A +T++   + +  P   V +     E      ELS
Sbjct: 5347 KIKKADLKDKGEYV-CDCGTDKTKANVTVEARLIKVEKPLYGVEVF--VGETAHFEIELS 5403

Query: 742  RVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTV 801
              D    W   GQ +  S    +  DG+KH LIL   ++  +GE   +     +   + V
Sbjct: 5404 EPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKV 5463

Query: 802  QDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPH 861
            ++ P+  + P   V V     +     CEV RE    RW K  QE+   D   L  +G  
Sbjct: 5464 KELPLIFITPLSDVKV--FEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTK 5521

Query: 862  RRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCE 921
              +V+ +    D  ++   A D+     + I  +    + P   V   A   E  V T E
Sbjct: 5522 HSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDV--TAKEKESAVFTVE 5579

Query: 922  LCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTV 981
            L      V+W K+ + +  + ++ +Q E     +    + ++D+ +   E    S+   +
Sbjct: 5580 LSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKL 5639

Query: 982  TVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDG 1041
            TV E          + T   V  + V+L CE+S+ DAPV+W+KDG E++ S+  V++ DG
Sbjct: 5640 TVLEGDPYFTGKLQDYT--GVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADG 5697

Query: 1042 PRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVEL 1101
             +  L+L  A   D G++ CD G D     + +     ++V P   S+++      R E 
Sbjct: 5698 KKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPL-HSVEVMETETARFET 5756

Query: 1102 RCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAIT 1161
              E++       W   G  +  +   ++  EG   +L L + + +  G    +  +   +
Sbjct: 5757 --EISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSS 5814

Query: 1162 FNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLEL 1221
             + +  +P V  + L      + V  GE     CELS    PV W   G+ ++  + +  
Sbjct: 5815 AH-LRVKPRV--IGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVP 5871

Query: 1222 HAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRS 1281
             +EG    L ++      AG     +       +L     V EPPV    P   QT    
Sbjct: 5872 RSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLF----VKEPPVEFTKPLEDQT---V 5924

Query: 1282 TPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLC 1341
              G    L   +S     V+W+K+G  +    + ++   G  + L +      D   Y C
Sbjct: 5925 EEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTC 5984

Query: 1342 DAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTP 1401
            DA        ++V  P  V+ +  LT L V E + A F CE+S  +A V W ++GA +  
Sbjct: 5985 DAKDFKTSCNLNVVPPH-VEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKK 6043

Query: 1402 GPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAE 1461
            G + ++   G+ RIL +  C L D    +    +  TS  L V E E +F + L ++   
Sbjct: 6044 GKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVS 6103

Query: 1462 EGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYG 1521
            E   + L  E  + GA   V W +G + +    R  +  +G    L I    L D G Y 
Sbjct: 6104 ETDTIKLVCEVSKPGAE--VIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYN 6161

Query: 1522 CESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYP 1581
            C     RT  ++ V       +   +++ I EG  A F   +S+E    +W R    L  
Sbjct: 6162 CRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLES 6221

Query: 1582 GPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVT 1641
            G K  + +DG +  LV+    L D G       + R AA L V E  + IV    D  V 
Sbjct: 6222 GDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVK 6280

Query: 1642 EGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCA 1701
            E     F CE++   A   W ++  A+  S +  +        L++R     D   Y+ +
Sbjct: 6281 EQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVS 6340

Query: 1702 VGTARAGPVR----LTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRWELGGRP 1757
            +   R   V+    L V E  + ++  L+ +   E    TF C V+ +  T +W   G  
Sbjct: 6341 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 6400

Query: 1758 LRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPRE 1817
            +    RV  R +  KH+L + +    D GE    AG  +S+A L +   P +   H   +
Sbjct: 6401 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHL-ED 6459

Query: 1818 KTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGT 1877
            +TV     AV    +SR   +V W R G E+  G KY+    G  H L+I D R +D+  
Sbjct: 6460 QTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECE 6519

Query: 1878 YCCQAGQDSTHTRLLVE 1894
            Y C      +  RL VE
Sbjct: 6520 YACGVEDRKSRARLFVE 6536



 Score =  371 bits (952), Expect = e-102
 Identities = 397/1661 (23%), Positives = 670/1661 (40%), Gaps = 102/1661 (6%)

Query: 276  EIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKD-RGLYVCAARNSAGQTLSAVQL 334
            E+ W++E + L+P   +         + L +     +D +G YVC A N +G+T ++ +L
Sbjct: 4396 EVNWYFENK-LVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKL 4454

Query: 335  H-VKEPRLRFTRPLQDVEGREHGIAVLECKV---PNSRIPTAWFREDQRLLPCRKYEQIE 390
              VK       R ++ +E     +A   C++   PN R    WF+  + +    K     
Sbjct: 4455 TVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRF--QWFKAGREIYESDKCSIRS 4512

Query: 391  EGTVRRLIIHRLKADDDGIYLCEMR---GRVRTVANVTVKGP-----ILKRLPRKLDVLE 442
               +  L I R +  D G Y C+     G V   A +TV  P     + K LP +    E
Sbjct: 4513 SKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKP--E 4570

Query: 443  GENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHALVLP-GVTREDAGEVTFSLGN 501
             +  V+L   L         R  EE P +       +    +P     +   EV      
Sbjct: 4571 PKEEVVLKSVLR-------KRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVT 4623

Query: 502  SRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPE-TPFIYRLERQEVGS 560
             R   +     V    P  P+ A   K      + T KPP   PE TP    +    VG 
Sbjct: 4624 KRERKIPEPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGK 4683

Query: 561  EDWIQCFSIEKA---GAVEVPGDCVPSEGDYRFRICTVSGHGRSP--HVVFHGSAHLVPT 615
            +   +    E A   G ++      PS  +   R       G  P     F      VP 
Sbjct: 4684 KAEAKAPKEEAAKPKGPIKGVPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVP- 4742

Query: 616  ARLVAGLEDV----QVYDGEDAVFS--LDLSTIIQGTWFLNGEELKSNEPEGQVEPGALR 669
             + V  ++D+      + G  A+F   +  ST I  TW  +G  ++ +           +
Sbjct: 4743 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAIT-TWMKDGSNIRESP----------K 4791

Query: 670  YRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD---SAALTIQESPVHILSPQDRVSL 726
            +R    G   +L +  V+  D+G        G ++   +A L ++E PV  +   +   +
Sbjct: 4792 HRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEE-EV 4850

Query: 727  TFTTSERVVLTCELSRVDFPATWYKDGQ-KVEESELLVVKMDGRKHRLILPEAKVQDSGE 785
            T    + + L+CEL++ +    W KDG+  VE+   +V  + G    L + +A   D+G 
Sbjct: 4851 TVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGT 4909

Query: 786  FECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECV------MLACEVDREDAPVR 839
            +    E  +     +     V +V+      V  I  + V      + AC++ ++   ++
Sbjct: 4910 YTVTVENANNLECSSC----VKVVEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIK 4965

Query: 840  WYKDGQEV--EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSS 897
            W+K   E+  E +D   +  +G H  L +    P D  E+      +     +T+ +   
Sbjct: 4966 WFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREV 5025

Query: 898  WIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVL 957
             ++ P   V +     E      E+       +W   GE +  SP   ++ E   R L L
Sbjct: 5026 ELLKPIEDVTI--YEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTL 5083

Query: 958  PAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTL---IAVTLECVVLMCELS 1014
              V+L+ +GE L +  +   +  +TV E  +    P  +VT+        ECV     L+
Sbjct: 5084 HKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFECV-----LT 5138

Query: 1015 REDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTV 1074
            RE A V W K    ++ S+   +  DG +  LV+  +Q +D G +  +         + V
Sbjct: 5139 RE-ANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFV 5197

Query: 1075 TAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGP 1134
            T    + + P     D            CE++     V W+K+  ++  S  + + +EG 
Sbjct: 5198 TGIRLKFMSPLE---DQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGK 5254

Query: 1135 TRTLTLPHAQPEDAGEYVCETRHEAIT--FNVILAEPPVQFLALETTPSPLCVAPGEPVV 1192
            T  L +     +D  +   + +  + T    V+ A+P       + T         + + 
Sbjct: 5255 THKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKT-----AVEKDEIT 5309

Query: 1193 LSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPG 1252
            L CE+S+   PV W  +G  +       + A+G RR+L I+ A     G Y C  G    
Sbjct: 5310 LKCEVSK-DVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGT--D 5366

Query: 1253 APSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQ 1312
                + TV+      R++  E     V    G      + LS P    +W   G+ L + 
Sbjct: 5367 KTKANVTVE-----ARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTAS 5421

Query: 1313 GRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVH 1372
               ++ + G + +L +   + G  GE    A        + V+E  L+  ++ L+ + V 
Sbjct: 5422 PDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLI-FITPLSDVKVF 5480

Query: 1373 EGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLR 1432
            E D+A F CEVS       WL+    +T   + E+ ++G+   + ++     D       
Sbjct: 5481 EKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFE 5540

Query: 1433 AGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPH 1492
            A    TS +L +    L FL  L+DV A+E +     VE         V+W +  Q L  
Sbjct: 5541 AEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNI--RVKWFKNDQRLHT 5598

Query: 1493 DSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTIS 1552
               +SM  +G  H +    + + D      E+    + A+L+V          L+D T  
Sbjct: 5599 TRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGV 5658

Query: 1553 EGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFT 1612
            E      Q E+S+     +W + G ++ P     I +DG +  L+L     +D G  +  
Sbjct: 5659 EKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCD 5718

Query: 1613 ADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSP 1672
              + + + +L + +  + +VR  H +EV E +TA FE E+S+      W+  G AL  +P
Sbjct: 5719 CGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTP 5778

Query: 1673 RLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSARE 1732
               ++  G    L L  C     G         ++    L V+ R + +L  L+ V+   
Sbjct: 5779 DCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSS-AHLRVKPRVIGLLRPLKDVTVTA 5837

Query: 1733 GDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA 1792
            G+ ATF+C +S  +    W L G+ L P  +V  R EGK H L L +++ EDAGEV+  A
Sbjct: 5838 GETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTA 5897

Query: 1793 GPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGD 1852
               ++ A L V+  P++  + P  ++TV  G  AVLE  VSR    V W + G E+    
Sbjct: 5898 KDFKTHANLFVKEPPVEFTK-PLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSK 5956

Query: 1853 KYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLV 1893
            KYE+ + G    LVIHD  PED  TY C A    T   L V
Sbjct: 5957 KYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNV 5997



 Score =  349 bits (896), Expect = 1e-95
 Identities = 341/1251 (27%), Positives = 528/1251 (42%), Gaps = 98/1251 (7%)

Query: 701  GVQDSAALTIQESPVHILS---PQDRVSLTFTTSER---VVLTCELSRVDFPATWYKDGQ 754
            G ++ A + IQE+   ++    P     L  T SE    V LT  ++       WY + +
Sbjct: 4346 GTEEVATVKIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTTSITNAK-EVNWYFENK 4404

Query: 755  KVEESELLVVKMDGRKHRLILPEAKVQD-SGEFECRT------EGVSAFFGVTVQDPPV- 806
             V   E      D   + L++ +   +D  GE+ C           SA   V  +  PV 
Sbjct: 4405 LVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVI 4464

Query: 807  -HIVDPREHVFVHAITSECVMLACEVDREDAP---VRWYKDGQEVEESDFVVLENEGPHR 862
               ++P E    H          CE+  + AP    +W+K G+E+ ESD   + +     
Sbjct: 4465 KRKIEPLEVALGHL-----AKFTCEI--QSAPNVRFQWFKAGREIYESDKCSIRSSKYIS 4517

Query: 863  RLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLER------- 915
             L +  TQ  D GE+ C A +E    + T T     +  P G+  V  +  ER       
Sbjct: 4518 SLEILRTQVVDCGEYTCKASNEYGSVSCTATLT---VTVPGGEKKVRKLLPERKPEPKEE 4574

Query: 916  VVLTCELCR------PWAEVRWTKDGE-------------EVVESPALLLQK----EDTV 952
            VVL   L +      P  E +  +  +             E VE P +  ++    E T 
Sbjct: 4575 VVLKSVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIPEPTK 4634

Query: 953  RRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCE 1012
               + PA+ L  + E   + + E  +      EP    I     V ++    E      E
Sbjct: 4635 VPEIKPAIPLP-APEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEE 4693

Query: 1013 LSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTV 1072
             ++   P++    G+  +    +  ER   R         P  GGE       D A FT 
Sbjct: 4694 AAKPKGPIK----GVPKKTPSPIEAERRKLR---------PGSGGE----KPPDEAPFTY 4736

Query: 1073 TVTAPPERIVHPAARSLDLHFGAPGRVEL-RCEVAPAGSQVRWYKDGLEVEASDALQLGA 1131
             + A P + V      +       G   +  C V+P+ +   W KDG  +  S   +  A
Sbjct: 4737 QLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIA 4796

Query: 1132 EGPTRTLTLPHAQPEDAGEYVCETR----HEAITFNVILAEPPVQFLALETTPSPLCVAP 1187
            +G  R L +   Q  DAGEY C  R     +  T  +++ E PV+F+  +T    + V  
Sbjct: 4797 DGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFV--KTLEEEVTVVK 4854

Query: 1188 GEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAE-GPRRVLCIQAAGPAHAGLYTCQ 1246
            G+P+ LSCEL++    VVW  +G+ V E  G  +    G  R L I  A    AG YT  
Sbjct: 4855 GQPLYLSCELNKE-RDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVT 4913

Query: 1247 SGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDG 1306
               A      S  V+V E     +        V+  P G       ++     ++W+K  
Sbjct: 4914 VENANNL-ECSSCVKVVEVIRDWLVKPIRDQHVK--PKGTAIFACDIAKDTPNIKWFKGY 4970

Query: 1307 ERLASQ--GRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVS 1364
            + + ++   + ++ + G    L+++ A   D  EY  +         +++ E   V+L+ 
Sbjct: 4971 DEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGERE-VELLK 5029

Query: 1365 ELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLG 1424
             +  +T++E + A+F  E+S  D    W   G ++ P P  E+   G  R LTL   +L 
Sbjct: 5030 PIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLD 5089

Query: 1425 DAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWV 1484
             AG V  +A +  T+A L V+E EL F   L+DV   E +    E    R      V W 
Sbjct: 5090 QAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTR---EANVIWS 5146

Query: 1485 RGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLR 1544
            +G   +    +  +  DG  H L I+     D+G Y  E    +T ARL V   +L+ + 
Sbjct: 5147 KGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMS 5206

Query: 1545 PLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLA 1604
            PLED T+ EG +ATF  ELS E +   W +   +L+      I S+G  H+L +  + L 
Sbjct: 5207 PLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLD 5266

Query: 1605 DSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKD 1664
            D   +      L   A+L V E         HD    E D  T +CE+S+ +  V W KD
Sbjct: 5267 DISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVP-VKWFKD 5325

Query: 1665 GNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSE 1724
            G  + PSP+  ++A G RR+L++++    D G Y C  GT +     +TV  R + V   
Sbjct: 5326 GEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT-KANVTVEARLIKVEKP 5384

Query: 1725 LRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAED 1784
            L  V    G+ A FE  +SE +  G+W+L G+PL       I ++GKKHIL+L   +   
Sbjct: 5385 LYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGM 5444

Query: 1785 AGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLRE 1844
             GEV FQA  A+S A L+V+ LPL     P  +  V     A  E  VSR      WL+ 
Sbjct: 5445 TGEVSFQAANAKSAANLKVKELPLIFIT-PLSDVKVFEKDEAKFECEVSREPKTFRWLKG 5503

Query: 1845 GAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEG 1895
              E+   D++E+   G  HS+VI     ED+  Y  +A    T  +L++EG
Sbjct: 5504 TQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEG 5554



 Score =  315 bits (807), Expect = 3e-85
 Identities = 253/996 (25%), Positives = 429/996 (43%), Gaps = 47/996 (4%)

Query: 917  VLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEI---- 972
            +  C +    A   W KDG  + ESP      +   R+L +  VQL D+GEY C +    
Sbjct: 4765 IFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGN 4824

Query: 973  DDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDG-LEVEE 1031
             +++++  + V E PVR +   +E   + V  + + L CEL++E   V W KDG + VE+
Sbjct: 4825 KEKTSTAKLVVEELPVRFVKTLEEEVTV-VKGQPLYLSCELNKE-RDVVWRKDGKIVVEK 4882

Query: 1032 SEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGD----DSAFFTVTVTAPPERIVHPAAR 1087
               +V    G    L +  A   D G +     +    + +     V    + +V P   
Sbjct: 4883 PGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIR- 4941

Query: 1088 SLDLHFGAPGRVELRCEVAPAGSQVRWYK--DGLEVEASDALQLGAEGPTRTLTLPHAQP 1145
              D H    G     C++A     ++W+K  D +  E +D  ++  +G    L + +A P
Sbjct: 4942 --DQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMP 4999

Query: 1146 EDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVV 1205
            ED  EY  E   +     + L E  V+ L        + +   E      E+S A  P  
Sbjct: 5000 EDIAEYAVEIEGKRYPAKLTLGEREVELL---KPIEDVTIYEKESASFDAEISEADIPGQ 5056

Query: 1206 WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAG--LYTCQSGAAPGAPSL-SFTVQV 1262
            W   G  ++     E+ AEG +R L +       AG  LY   +       ++    +  
Sbjct: 5057 WKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDF 5116

Query: 1263 AEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGA 1322
            A P   V  PE  Q R       +  ++           W K  + + S  +  +   G 
Sbjct: 5117 AVPLKDVTVPERRQARFECVLTREANVI-----------WSKGPDIIKSSDKFDIIADGK 5165

Query: 1323 RQVLRVQGARSGDAGEYLCDA---PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATF 1379
            + +L +  ++  D G Y  +       +R+F+  +     +K +S L   TV EG+ ATF
Sbjct: 5166 KHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIR----LKFMSPLEDQTVKEGETATF 5221

Query: 1380 RCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATS 1439
             CE+S     V W +N A +     V ++  G +  L ++   L D   +  +    +++
Sbjct: 5222 VCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSST 5281

Query: 1440 ARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMA 1499
            A+L V E +  F  +L D  A E  ++ L+ E   V     V+W + G+ +    + S+ 
Sbjct: 5282 AQLKVLEADPYFTVKLHDKTAVEKDEITLKCE---VSKDVPVKWFKDGEEIVPSPKYSIK 5338

Query: 1500 QDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATF 1559
             DG    L I    L D+G Y C+   D+T A ++V  R ++V +PL  V +  G +A F
Sbjct: 5339 ADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHF 5398

Query: 1560 QLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCA 1619
            ++ELS+  V G+W   G  L   P C I  DG +H L+L+   L  +G VSF A + + A
Sbjct: 5399 EIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSA 5458

Query: 1620 ARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQAL 1679
            A L V+E+P+  +    D++V E D A FECE+S+      W K    +T   R  L   
Sbjct: 5459 ANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKD 5518

Query: 1680 GTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFE 1739
            GT+  + ++     D   Y            +L +    +  L+ L+ V+A+E + A F 
Sbjct: 5519 GTKHSMVIKSAAFEDEAKYMFEAEDKHTSG-KLIIEGIRLKFLTPLKDVTAKEKESAVFT 5577

Query: 1740 CTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQA-GPAQSL 1798
              +S      +W    + L     V ++ EGK H +   +L  +D  ++R +A G +   
Sbjct: 5578 VELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEA 5637

Query: 1799 ALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRS 1858
             L  +E  P    +   ++ T +     +L+  +S++   V W ++G E+ P     +++
Sbjct: 5638 KLTVLEGDPYFTGK--LQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIKA 5695

Query: 1859 HGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVE 1894
             G    L++      D G Y C  G D T  +L +E
Sbjct: 5696 DGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIE 5731



 Score =  291 bits (745), Expect = 4e-78
 Identities = 315/1294 (24%), Positives = 508/1294 (39%), Gaps = 122/1294 (9%)

Query: 674  QKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAA-LTIQESPVHILSPQDRVSLTFTTSE 732
            +KGLQ    L  + H+  GAL G +    +     + +   PV +L             E
Sbjct: 1764 RKGLQRIEELERMAHE--GALTGVTTDQKEKQKPDIVLYPEPVRVLE-----------GE 1810

Query: 733  RVVLTCELSRVDFP-ATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTE 791
                 C ++    P   WY +GQ + +S+   V+ DG  H L + + K  D+GE +   E
Sbjct: 1811 TARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGEVKVTAE 1869

Query: 792  GVSAFFGVTVQDPPVHIV-------------DPREHVFVHAITSECVMLACEVDREDAPV 838
                  GV      + I              +PR    VH    E   L  EV + D PV
Sbjct: 1870 NPE---GVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH----EPGKLQFEVQKVDRPV 1922

Query: 839  -----------------RWYKDGQEVEE--SDFVVLENEGPHRRLV---LPATQPSDG-G 875
                                K  +E EE  S F     EG +  +    L + +  +   
Sbjct: 1923 DTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYE 1982

Query: 876  EFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCEL------------- 922
            E      DE  ++T  +T+     +   GK+ +   + +++ L+  +             
Sbjct: 1983 ELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQT 2042

Query: 923  --------------CRPWAEVRWTKDGEEVVESPALLLQ-KEDTVRRLVLPAVQLEDSGE 967
                           +P  E  W K+G ++  S  +     ED V  LV+  V  EDS  
Sbjct: 2043 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSAS 2102

Query: 968  YLCE---IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLM-CELSREDAPVRWY 1023
             + +   I  E++S    + +    I + ++   ++A   + +    CE S     V+WY
Sbjct: 2103 IMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWY 2162

Query: 1024 KDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVH 1083
            KDG+EV E +   +  D     L +      D  ++ C   +D    T         +V 
Sbjct: 2163 KDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVE 2222

Query: 1084 PAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHA 1143
                  D+        EL C V+P   + +WY + +E++++    + +    + LT+   
Sbjct: 2223 FVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDV 2282

Query: 1144 QPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAP 1203
              ED GEY      +  T  + +   P+  L      S   V  G+ V L  ++S     
Sbjct: 2283 TKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQ---GLSDQKVCEGDIVQLEVKVSLESVE 2339

Query: 1204 VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVA 1263
             VW  +G+ VQ  + + +  +    +L I+      AG Y+    A      LS + +V+
Sbjct: 2340 GVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPAL----GLSTSGRVS 2395

Query: 1264 EPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPG-GPVRWYKDGERLASQGRVQLEQAGA 1322
               V V+ P      V    G    L   +S P    V+WY + E++    RVQ    G 
Sbjct: 2396 VYSVDVITP---LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGT 2452

Query: 1323 RQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCE 1382
            +Q L +    + D G Y     +      +SVE+   +K++  L  LT  E  +  F  E
Sbjct: 2453 KQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK---IKIIRGLRDLTCTETQNVVFEVE 2509

Query: 1383 VSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARL 1442
            +S    DV W      + P  + ++  +G    LT+      D G  T  AG   TS +L
Sbjct: 2510 LSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKL 2569

Query: 1443 HVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDG 1502
             V    +   + L D    E Q+   E E     + G   W+R G+ LP  + +    DG
Sbjct: 2570 TVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKG--EWLRDGKHLPLTNNIRSESDG 2625

Query: 1503 HIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLE 1562
            H  RL I    L D G Y  +    +T A+L V    +++ + L+++T++E   A F +E
Sbjct: 2626 HKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA--VKIKKTLKNLTVTETQDAVFTVE 2683

Query: 1563 LSQEGVTG-EWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAAR 1621
            L+   V G +W + GV L    K  I   G  + L +    + D     F    L  +AR
Sbjct: 2684 LTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASAR 2743

Query: 1622 LIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGT 1681
            L V  V   I++ P D+   E  T  FE  +S     V W      + PS + RL +   
Sbjct: 2744 LHVETVK--IIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERK 2801

Query: 1682 RRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECT 1741
               L L+   PSDAG Y+  VG       +  +   T+ +   ++++   E   A+FEC 
Sbjct: 2802 VHKLMLQNISPSDAGEYTAVVGQLEC---KAKLFVETLHITKTMKNIEVPETKTASFECE 2858

Query: 1742 VSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALL 1801
            VS       W   G  +    + +I  +GK H L++     ED+ E  F  G  Q  A L
Sbjct: 2859 VSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATL 2918

Query: 1802 EVEALPL-QMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHG 1860
             V  + +  M +    E+   +      EVTV+  G    WL+ G E+   DK +MR+  
Sbjct: 2919 TVTPIMITSMLKDINAEEKDTI----TFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK 2974

Query: 1861 PTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVE 1894
             THSL I +V   D   Y   AG+ ++   L VE
Sbjct: 2975 LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVE 3008



 Score =  283 bits (723), Expect = 1e-75
 Identities = 253/1072 (23%), Positives = 449/1072 (41%), Gaps = 36/1072 (3%)

Query: 831  VDREDAPVRWYKDGQEVEESDFVVLE-NEGPHRRLVLPATQPSDGGEFQC----VAGDEC 885
            V + D    WYK+G ++E SD +     E     LV+      D          +AG+  
Sbjct: 2056 VGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETS 2115

Query: 886  AYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALL 945
            ++  + +            +  VA  +       CE   P+ +V+W KDG EV E     
Sbjct: 2116 SHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYR 2175

Query: 946  LQKEDTVRRLVLPAVQLEDSGEYLCE-IDDESASFTVTVTEPPVRIIYPRDEVTLIAVTL 1004
            +  +  V  L +  +   D+ +Y C  ++DE+   T  +      + + ++   +     
Sbjct: 2176 MHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPES 2235

Query: 1005 ECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAG 1064
                L C +S E+   +WY + +E++ +    +     R  L +     ED GE+     
Sbjct: 2236 YSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVID 2295

Query: 1065 DDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEAS 1124
                   + +   P  I+   +   D        V+L  +V+    +  W KDG EV+ S
Sbjct: 2296 GKKTTCKLKMKPRPIAILQGLS---DQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPS 2352

Query: 1125 DALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLC 1184
            D + +  +  +  L +     EDAG Y        ++ +  ++   V  +   T    + 
Sbjct: 2353 DRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVI---TPLKDVN 2409

Query: 1185 VAPGEPVVLSCELSRAGAPVV-WSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLY 1243
            V  G   VL C++S      V W  N   ++  + ++   +G ++ L I     +  G Y
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2469

Query: 1244 TCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWY 1303
                G      +LS         V  +        +  T   ++   V LS  G  V W 
Sbjct: 2470 KLIVGRVETNCNLS---------VEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWN 2520

Query: 1304 KDGERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLV 1363
               + +    + ++E  G    L V      D G+Y   A ++     ++V    + K  
Sbjct: 2521 FKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISK-- 2578

Query: 1364 SELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQL 1423
              LT  TV E  +A F CEV+ PD+   WLR+G  +     +    +G  R L +   +L
Sbjct: 2579 -PLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKL 2637

Query: 1424 GDAGTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRW 1483
             D G  T +  ++ TSA+L V   ++   + L+++   E QD    VE       G V+W
Sbjct: 2638 DDIGEYTYKVATSKTSAKLKVEAVKIK--KTLKNLTVTETQDAVFTVELTHPNVKG-VQW 2694

Query: 1484 VRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVL 1543
            ++ G  L  + + +++  G I+ L I    + D+  YG         ARL V    ++++
Sbjct: 2695 IKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVET--VKII 2752

Query: 1544 RPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGL 1603
            +  +DVT  E  +  F++ +S + V  +W    V++ P  K  + S+   H+L+L  +  
Sbjct: 2753 KKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2812

Query: 1604 ADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEK 1663
            +D+G  +     L C A+L V  + +T  +   ++EV E  TA+FECE+S       W K
Sbjct: 2813 SDAGEYTAVVGQLECKAKLFVETLHIT--KTMKNIEVPETKTASFECEVSHFNVPSMWLK 2870

Query: 1664 DGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLS 1723
            +G  +  S + ++   G    L +      D+  Y+   G  +   V  T+    + + S
Sbjct: 2871 NGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQ---VSATLTVTPIMITS 2927

Query: 1724 ELRSVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE 1783
             L+ ++A E D  TFE TV+    + +W   G  ++   + ++R +   H L +  +   
Sbjct: 2928 MLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFG 2987

Query: 1784 DAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLR 1843
            DA +  F AG A S A L VEA  ++  +H  ++  VL  +RA+ E  VS     V W++
Sbjct: 2988 DAADYTFVAGKATSTATLYVEARHIEFRKHI-KDIKVLEKKRAMFECEVSEPDITVQWMK 3046

Query: 1844 EGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEG 1895
            +  EL   D+ +++     H L+I   R  D G Y   AG + +  +L VEG
Sbjct: 3047 DDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEG 3098



 Score =  257 bits (657), Expect = 7e-68
 Identities = 273/1217 (22%), Positives = 467/1217 (38%), Gaps = 48/1217 (3%)

Query: 681  LILHAVKHQDSGALV--GFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVV-LT 737
            L++  V  +DS +++    +  G   S A  + ++   I   Q+   +     + +    
Sbjct: 2090 LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFE 2149

Query: 738  CELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFEC---RTEGVS 794
            CE S       WYKDG +V E +   +  D + H L +      D+ ++ C     E V 
Sbjct: 2150 CETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVK 2209

Query: 795  AFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVV 854
                + V+   V  V   + + V    S    L C V  E+   +WY +  E++ +    
Sbjct: 2210 TTAKLIVEGAVVEFVKELQDIEVPESYSG--ELECIVSPENIEGKWYHNDVELKSNGKYT 2267

Query: 855  LENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRLE 914
            + +    + L +      D GE+  V   +    T  +      I    G         +
Sbjct: 2268 ITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKT--TCKLKMKPRPIAILQGLSDQKVCEGD 2325

Query: 915  RVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD 974
             V L  ++     E  W KDG+EV  S  + +  +     L++  +  ED+G Y   I  
Sbjct: 2326 IVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPA 2385

Query: 975  ESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAP-VRWYKDGLEVEESE 1033
               S +  V+   V +I P  +V +I  T    VL C++S  D   V+WY +  +++  +
Sbjct: 2386 LGLSTSGRVSVYSVDVITPLKDVNVIEGTK--AVLECKVSVPDVTSVKWYLNDEQIKPDD 2443

Query: 1034 ALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSL-DLH 1092
             +     G + RLV+      D G +    G       ++V    E+I     R L DL 
Sbjct: 2444 RVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSV----EKI--KIIRGLRDLT 2497

Query: 1093 FGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYV 1152
                  V    E++ +G  V W     E++ S   ++ A G    LT+ +   +D G+Y 
Sbjct: 2498 CTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYT 2557

Query: 1153 CETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRP 1212
                    +  + +A   +     + T     VA  +  V  CE++   +   W  +G+ 
Sbjct: 2558 FYAGENMTSGKLTVAGGAISKPLTDQT-----VAESQEAVFECEVANPDSKGEWLRDGKH 2612

Query: 1213 VQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAP 1272
            +     +   ++G +R L I A      G YT +   +  +  L          V  V  
Sbjct: 2613 LPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLK---------VEAVKI 2663

Query: 1273 EAAQTRVRSTPGGDLELVVHLSGPGGP-VRWYKDGERLASQGRVQLEQAGARQVLRVQGA 1331
            +     +  T   D    V L+ P    V+W K+G  L S  +  +   G    LR++  
Sbjct: 2664 KKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNC 2723

Query: 1332 RSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDADVT 1391
               D   Y     +      + VE   ++K   ++T L   E     F   VS     V 
Sbjct: 2724 AIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTAL---ENATVAFEVSVSHDTVPVK 2780

Query: 1392 WLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETELLF 1451
            W      + P  +  +        L L+     DAG  T   G     A+L V    +  
Sbjct: 2781 WFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHIT- 2839

Query: 1452 LRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHG 1511
             + ++++   E +    E E           W++ G  +    +  +   G +H+L I  
Sbjct: 2840 -KTMKNIEVPETKTASFECEVSHFNVPSM--WLKNGVEIEMSEKFKIVVQGKLHQLIIMN 2896

Query: 1512 VILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGE 1571
                D   Y     +D+  A L+V P  + +   L+D+   E  + TF++ ++ EG++ +
Sbjct: 2897 TSTEDSAEYTFVCGNDQVSATLTVTP--IMITSMLKDINAEEKDTITFEVTVNYEGISYK 2954

Query: 1572 WARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTI 1631
            W + GV++    KC + +    H L +  +   D+   +F A      A L V    +  
Sbjct: 2955 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3014

Query: 1632 VRGPHDLEVTEGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCG 1691
             +   D++V E   A FECE+S+    V W KD   L  + R+++Q       L +    
Sbjct: 3015 RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3074

Query: 1692 PSDAGTYSCAVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTGRW 1751
             SDAG Y+   G       +L V  R V + S  + V   E   A  E  V+E +    W
Sbjct: 3075 MSDAGKYTVVAG-GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHW 3133

Query: 1752 ELGGRPLRPGARVRIRQ--EGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQ 1809
               G  +    + R +   E + H + +SE R  DAGE  F AG  +S   L V A    
Sbjct: 3134 YKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPP 3193

Query: 1810 MCRHPPREKTVLVGRRAVLEVTVS-RSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIH 1868
                  +  TV  G+ A     +S R    + W +E   L  G K +    G  ++L++ 
Sbjct: 3194 QVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLI 3253

Query: 1869 DVRPEDQGTYCCQAGQD 1885
            +  PED   Y C+A  D
Sbjct: 3254 EAFPEDAAVYTCEAKND 3270



 Score =  257 bits (657), Expect = 7e-68
 Identities = 274/1222 (22%), Positives = 495/1222 (40%), Gaps = 93/1222 (7%)

Query: 619  VAGLEDVQV---YDGE-DAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQ 674
            V  L+D++V   Y GE + + S +    I+G W+ N  ELKSN           +Y I  
Sbjct: 2224 VKELQDIEVPESYSGELECIVSPEN---IEGKWYHNDVELKSNG----------KYTITS 2270

Query: 675  KGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERV 734
            +  +  L +  V  +D G    F   G + +  L ++  P+ IL  Q          + V
Sbjct: 2271 RRGRQNLTVKDVTKEDQGEY-SFVIDGKKTTCKLKMKPRPIAIL--QGLSDQKVCEGDIV 2327

Query: 735  VLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEFECRTEGVS 794
             L  ++S       W KDGQ+V+ S+ + + +D + H L++ +   +D+G +      + 
Sbjct: 2328 QLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALG 2387

Query: 795  AFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAP-VRWYKDGQEVEESDFV 853
                  V    V ++ P + V V  I     +L C+V   D   V+WY + ++++  D V
Sbjct: 2388 LSTSGRVSVYSVDVITPLKDVNV--IEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRV 2445

Query: 854  VLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKVYVAAVRL 913
                +G  +RLV+  T  SD G ++ + G       +++  +        G   +     
Sbjct: 2446 QAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIK----IIRGLRDLTCTET 2501

Query: 914  ERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEID 973
            + VV   EL     +V W    +E+  S    ++    + +L +  +  +D G+Y     
Sbjct: 2502 QNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAG 2561

Query: 974  DESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESE 1033
            +   S  +TV    +    P  + T +A + E V   CE++  D+   W +DG  +  + 
Sbjct: 2562 ENMTSGKLTVAGGAIS--KPLTDQT-VAESQEAV-FECEVANPDSKGEWLRDGKHLPLTN 2617

Query: 1034 ALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHF 1093
             +  E DG + RL++ A + +D GE+            + V A     +    ++L +  
Sbjct: 2618 NIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVK---IKKTLKNLTVTE 2674

Query: 1094 --GAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEY 1151
               A   VEL     P    V+W K+G+ +E+++   +  +G   +L + +    D   Y
Sbjct: 2675 TQDAVFTVEL---THPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVY 2731

Query: 1152 VCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGR 1211
                     +     A   V+ + +   P  +       V     +S    PV W H   
Sbjct: 2732 GFRLGRLGAS-----ARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSV 2786

Query: 1212 PVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSF-TVQVAEPPVRVV 1270
             ++  +   L +E     L +Q   P+ AG YT   G       L   T+ + +    + 
Sbjct: 2787 EIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIE 2846

Query: 1271 APEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGARQVLRVQG 1330
             PE        T   + E V H + P     W K+G  +    + ++   G    L +  
Sbjct: 2847 VPET------KTASFECE-VSHFNVPS---MWLKNGVEIEMSEKFKIVVQGKLHQLIIMN 2896

Query: 1331 ARSGDAGEY--LCDAPQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSPPDA 1388
              + D+ EY  +C   Q S    V+   P+++   S L  +   E D  TF   V+    
Sbjct: 2897 TSTEDSAEYTFVCGNDQVSATLTVT---PIMI--TSMLKDINAEEKDTITFEVTVNYEGI 2951

Query: 1389 DVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDAGTVTLRAGSTATSARLHVRETE 1448
               WL+NG  +    + +M     +  L +R    GDA   T  AG   ++A L+V    
Sbjct: 2952 SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARH 3011

Query: 1449 LLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLF 1508
            + F + ++D++  E +    E E         V+W++  Q L    R+ + ++ ++HRL 
Sbjct: 3012 IEFRKHIKDIKVLEKKRAMFECEVSEPDIT--VQWMKDDQELQITDRIKIQKEKYVHRLL 3069

Query: 1509 IHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGV 1568
            I    ++D G Y   +  + + A+L V  R +R+    ++V + E   A  + E++++ V
Sbjct: 3070 IPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDV 3129

Query: 1569 TGEWARGGVQL-YPGPKCHIHSDGHR-HRLVLNGLGLADSGCVSFTADSLRCAARLIVRE 1626
               W + G+++ +   + H +    R HR+ ++    +D+G  +F A   R +  L V  
Sbjct: 3130 DAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNA 3189

Query: 1627 V-PVTIVRGPHDLEVTEGDTATFECELS-QALADVTWEKDGNALTPSPRLRLQALGTRRL 1684
              P  +++    + V  G  A F   +S +    ++W K+   L+   + +    G    
Sbjct: 3190 PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYT 3249

Query: 1685 LQLRRCGPSDAGTYSC------AVGTARAGPVRLTVRERTV------------AVLSELR 1726
            L L    P DA  Y+C       V T  A    L+V    V            A+++ L+
Sbjct: 3250 LLLIEAFPEDAAVYTCEAKNDYGVATTSAS---LSVEVPEVVSPDQEMPVYPPAIITPLQ 3306

Query: 1727 SVSAREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAG 1786
                 EG  A F+C VS  +    W    + ++P    R+ Q    + L ++E   ED G
Sbjct: 3307 DTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEG 3366

Query: 1787 EVRFQA----GPAQSLALLEVE 1804
               F A    G   S A L +E
Sbjct: 3367 TYTFVASNAVGQVSSTANLSLE 3388



 Score =  257 bits (656), Expect = 9e-68
 Identities = 297/1331 (22%), Positives = 528/1331 (39%), Gaps = 109/1331 (8%)

Query: 612  LVPTARLVAGLEDVQ--VYDGEDAVFSLDLST---IIQGTWFLNGEELKSNEPEGQVEPG 666
            LV   +L+   +++Q  V   +D + + +  T    ++  W+ +G E+   +        
Sbjct: 2121 LVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGD-------- 2172

Query: 667  ALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQD-----SAALTIQESPVHILSPQ 721
              +YR+      H L +  +   D+     +SC  V+D     +A L ++ + V  +   
Sbjct: 2173 --KYRMHSDRKVHFLSILTIDTSDAE---DYSCVLVEDENVKTTAKLIVEGAVVEFVKEL 2227

Query: 722  DRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQ 781
              + +  + S    L C +S  +    WY +  +++ +    +     +  L + +   +
Sbjct: 2228 QDIEVPESYSGE--LECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKE 2285

Query: 782  DSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWY 841
            D GE+    +G      + ++  P+ I+       V     + V L  +V  E     W 
Sbjct: 2286 DQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKV--CEGDIVQLEVKVSLESVEGVWM 2343

Query: 842  KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
            KDGQEV+ SD V +  +     L++      D G +          FT+    +S+    
Sbjct: 2344 KDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYS---------FTIPALGLST---- 2390

Query: 902  PSGKVYVAAVRL------------ERVVLTCELCRP-WAEVRWTKDGEEVVESPALLLQK 948
             SG+V V +V +             + VL C++  P    V+W  + E++     +    
Sbjct: 2391 -SGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIV 2449

Query: 949  EDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVV 1008
            + T +RLV+      D G Y   +     +  ++V +  ++II    ++T      + VV
Sbjct: 2450 KGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK--IKIIRGLRDLT--CTETQNVV 2505

Query: 1009 LMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSA 1068
               ELS     V W     E++ S    +E  G   +L +     +D G++   AG++  
Sbjct: 2506 FEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMT 2565

Query: 1069 FFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQ 1128
               +TV      I  P     D            CEVA   S+  W +DG  +  ++ ++
Sbjct: 2566 SGKLTVAGGA--ISKPLT---DQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIR 2620

Query: 1129 LGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPG 1188
              ++G  R L +   + +D GEY  +     +  +   A+  V+ + ++ T   L V   
Sbjct: 2621 SESDGHKRRLIIAATKLDDIGEYTYK-----VATSKTSAKLKVEAVKIKKTLKNLTVTET 2675

Query: 1189 EPVVLSCELSRAGAP-VVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQS 1247
            +  V + EL+      V W  NG  ++  E   +  +G    L I+        +Y  + 
Sbjct: 2676 QDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRL 2735

Query: 1248 GAAPGAPSLSF-TVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDG 1306
            G    +  L   TV++ + P  V A E A               V +S    PV+W+   
Sbjct: 2736 GRLGASARLHVETVKIIKKPKDVTALENATVAFE----------VSVSHDTVPVKWFHKS 2785

Query: 1307 ERLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFLVSVEEPLLVKLVSEL 1366
              +    + +L        L +Q     DAGEY     Q      + VE   + K +  +
Sbjct: 2786 VEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNI 2845

Query: 1367 TPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRILTLRGCQLGDA 1426
                V E   A+F CEVS  +    WL+NG  +    + ++   G    L +      D+
Sbjct: 2846 E---VPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDS 2902

Query: 1427 GTVTLRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGAAGAVRWVRG 1486
               T   G+   SA L V  T ++    L+D+ AEE   +  EV     G +   +W++ 
Sbjct: 2903 AEYTFVCGNDQVSATLTV--TPIMITSMLKDINAEEKDTITFEVTVNYEGIS--YKWLKN 2958

Query: 1487 GQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPL 1546
            G  +    +  M      H L I  V   D   Y   +    + A L V  R +   + +
Sbjct: 2959 GVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHI 3018

Query: 1547 EDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLNGLGLADS 1606
            +D+ + E   A F+ E+S+  +T +W +   +L    +  I  + + HRL++    ++D+
Sbjct: 3019 KDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDA 3078

Query: 1607 GCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGN 1666
            G  +  A      A+L V    V I     +++V E   A  E E+++   D  W KDG 
Sbjct: 3079 GKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGI 3138

Query: 1667 ALTPSPRLRLQALGTRRL--LQLRRCGPSDAGTYSCAVGTARAGPVRLTVRERTVAVLSE 1724
             +    + R + +  RR+  + +     SDAG Y+   G  R+             VL E
Sbjct: 3139 EINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQE 3198

Query: 1725 LRSVSAREGDGATFECTVS-EVETTGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAE 1783
            L+ V+ + G  A F   +S   +    W    + L  G + +   +G+++ L+L E   E
Sbjct: 3199 LQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPE 3258

Query: 1784 DAG----EVRFQAGPAQSLALLEVEALPL-----QMCRHPPREKTVLV------GRRAVL 1828
            DA     E +   G A + A L VE   +     +M  +PP   T L       G+ A  
Sbjct: 3259 DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARF 3318

Query: 1829 EVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQA----GQ 1884
            +  VS +   V W  +  ++ P   + M     T+ L I +  PED+GTY   A    GQ
Sbjct: 3319 QCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3378

Query: 1885 DSTHTRLLVEG 1895
             S+   L +EG
Sbjct: 3379 VSSTANLSLEG 3389



 Score =  254 bits (650), Expect = 4e-67
 Identities = 329/1456 (22%), Positives = 574/1456 (39%), Gaps = 170/1456 (11%)

Query: 233  PPADPDEAPAPVVEPLKCAPKTF------WVNEGKHAKFRCYVMGKPEPEIEWHWEGRPL 286
            P   PD+     + P   APK F       V +G  A FR  V+GKP+PE EW+  G  +
Sbjct: 2016 PTFKPDKIE---LSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKI 2072

Query: 287  LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRL-RFTR 345
                R   Y   D    L +    A+D    +  A N AG+T S   L V+  +L  FT+
Sbjct: 2073 ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQ 2132

Query: 346  PLQDVEGREHG-IAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKA 404
             LQDV  +E   +A  EC+     +   W+++   +    KY    +  V  L I  +  
Sbjct: 2133 ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDT 2192

Query: 405  DDDGIYLCEM--RGRVRTVANVTVKGPILKRLP--RKLDVLEGENAVLLVETLEAGVEGR 460
             D   Y C +     V+T A + V+G +++ +   + ++V E  +  L        +EG+
Sbjct: 2193 SDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGK 2252

Query: 461  WSRDGEEL----PVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHS 516
            W  +  EL         S  G  + L +  VT+ED GE +F +   +TT  L++K     
Sbjct: 2253 WYHNDVELKSNGKYTITSRRGRQN-LTVKDVTKEDQGEYSFVIDGKKTTCKLKMK----- 2306

Query: 517  PPGPPILAEMFKGHK----NTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKA 572
             P P  + +     K    + V L  K    + E   ++  + QEV   D +     +++
Sbjct: 2307 -PRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEG--VWMKDGQEVQPSDRVHIVIDKQS 2363

Query: 573  GAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGED 632
              + +        G+Y F I  + G   S  V  +    + P       L+DV V +G  
Sbjct: 2364 HMLLIEDMTKEDAGNYSFTIPAL-GLSTSGRVSVYSVDVITP-------LKDVNVIEGTK 2415

Query: 633  AVFSLDLST--IIQGTWFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQD 690
            AV    +S   +    W+LN E++K ++          R +   KG + RL+++     D
Sbjct: 2416 AVLECKVSVPDVTSVKWYLNDEQIKPDD----------RVQAIVKGTKQRLVINRTHASD 2465

Query: 691  SG---ALVGFSCPGVQDSAALTIQESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPA 747
             G    +VG     V+ +  L++++  + I   +D   LT T ++ VV   ELS      
Sbjct: 2466 EGPYKLIVG----RVETNCNLSVEKIKI-IRGLRD---LTCTETQNVVFEVELSHSGIDV 2517

Query: 748  TWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEF-----ECRTEGVSAFFGVTVQ 802
             W    ++++ S    ++  G+ ++L +      D G++     E  T G     G  + 
Sbjct: 2518 LWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS 2577

Query: 803  DPPVH--IVDPREHVFVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGP 860
             P     + + +E VF            CEV   D+   W +DG+ +  ++ +  E++G 
Sbjct: 2578 KPLTDQTVAESQEAVF-----------ECEVANPDSKGEWLRDGKHLPLTNNIRSESDGH 2626

Query: 861  HRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVYPSGKV-----YVAAVRLER 915
             RRL++ AT+  D GE+          + V  +  S+ +   + K+      +     + 
Sbjct: 2627 KRRLIIAATKLDDIGEYT---------YKVATSKTSAKLKVEAVKIKKTLKNLTVTETQD 2677

Query: 916  VVLTCELCRPWAE-VRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDD 974
             V T EL  P  + V+W K+G  +  +    +  + T+  L +    + D   Y   +  
Sbjct: 2678 AVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGR 2737

Query: 975  ESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEA 1034
              AS  + V    V+II    +VT  A+    V     +S +  PV+W+   +E++ S+ 
Sbjct: 2738 LGASARLHV--ETVKIIKKPKDVT--ALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK 2793

Query: 1035 LVLERDGPRCRLVLPAAQPEDGGEFVCDAGD---DSAFF--TVTVTAPPERIVHPAARSL 1089
              L  +    +L+L    P D GE+    G     +  F  T+ +T   + I  P  ++ 
Sbjct: 2794 HRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKT- 2852

Query: 1090 DLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAG 1149
                         CEV+       W K+G+E+E S+  ++  +G    L + +   ED+ 
Sbjct: 2853 ---------ASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSA 2903

Query: 1150 EY--VCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEPVVLSCELSRAGAPVVWS 1207
            EY  VC     + T  V     P+   ++      +     + +     ++  G    W 
Sbjct: 2904 EYTFVCGNDQVSATLTV----TPIMITSM---LKDINAEEKDTITFEVTVNYEGISYKWL 2956

Query: 1208 HNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQVAE--- 1264
             NG  ++  +  ++  +     L I+      A  YT  +G A    +L    +  E   
Sbjct: 2957 KNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRK 3016

Query: 1265 --PPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAGA 1322
                ++V+  + A                 +S P   V+W KD + L    R+++++   
Sbjct: 3017 HIKDIKVLEKKRAM------------FECEVSEPDITVQWMKDDQELQITDRIKIQKEKY 3064

Query: 1323 RQVLRVQGARSGDAGEYLCDA---PQDSRIFLVSVEEPLLVKLVSELTPLTVHEGDDATF 1379
               L +   R  DAG+Y   A      +++F+    E   V++ S    + V E   A  
Sbjct: 3065 VHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFV----EGRDVRIRSIKKEVQVIEKQRAVV 3120

Query: 1380 RCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRI--LTLRGCQLGDAGTVTLRAGSTA 1437
              EV+  D D  W ++G  +    Q         RI  + +   +  DAG  T  AG   
Sbjct: 3121 EFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNR 3180

Query: 1438 TSARLHVRETE-LLFLRRLQDVRAEEGQDV-CLEVETGRVGAAGAVRWVRGGQPLPHDSR 1495
            +S  L+V   E    L+ LQ V  + G+      V +GR      + W +  Q L    +
Sbjct: 3181 SSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGR--PQPKISWYKEEQLLSTGFK 3238

Query: 1496 LSMAQDGHIHRLFIHGVILADQGTYGCESHHD----RTLARLSVRPRQL----------- 1540
                 DG  + L +      D   Y CE+ +D     T A LSV   ++           
Sbjct: 3239 CKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3298

Query: 1541 -RVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYPGPKCHIHSDGHRHRLVLN 1599
              ++ PL+D   SEG  A FQ  +S   +   W     ++ P     +      ++L + 
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIA 3358

Query: 1600 GLGLADSGCVSFTADS 1615
                 D G  +F A +
Sbjct: 3359 EAYPEDEGTYTFVASN 3374



 Score =  238 bits (608), Expect = 3e-62
 Identities = 400/1896 (21%), Positives = 700/1896 (36%), Gaps = 265/1896 (13%)

Query: 127  APVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAED 186
            AP      +SQ V +G++     R  G P+P   W K+G+ ++       +   P   ED
Sbjct: 2031 APKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIER--SDRIYWYWP---ED 2085

Query: 187  GPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVE 246
                 L +R + A   DS   +  A N  G   + A L V                 ++ 
Sbjct: 2086 NV-CELVIRDVTAE--DSASIMVKAINIAGETSSHAFLLVQAKQ-------------LIT 2129

Query: 247  PLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKV 306
              +         +   A F C    +P  +++W+ +G  +    +  M+ DR   F L +
Sbjct: 2130 FTQELQDVVAKEKDTMATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF-LSI 2187

Query: 307  LYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPN 366
            L     D   Y C          +A +L V+   + F + LQD+E  E     LEC V  
Sbjct: 2188 LTIDTSDAEDYSCVLVEDENVKTTA-KLIVEGAVVEFVKELQDIEVPESYSGELECIVSP 2246

Query: 367  SRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTV 426
              I   W+  D  L    KY        + L +  +  +D G Y   + G+  T      
Sbjct: 2247 ENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCK---- 2302

Query: 427  KGPILKRLPRKLDVL---------EGENAVLLVETLEAGVEGRWSRDGEELP------VI 471
                LK  PR + +L         EG+   L V+     VEG W +DG+E+       ++
Sbjct: 2303 ----LKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIV 2358

Query: 472  CQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHK 531
                S   H L++  +T+EDAG  +F++     +T  RV         P     + +G K
Sbjct: 2359 IDKQS---HMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTK 2415

Query: 532  NTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFR 591
              +      P+    T   + L  +++  +D +Q         + +       EG Y+  
Sbjct: 2416 AVLECKVSVPDV---TSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLI 2472

Query: 592  ICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNG 651
            +  V  +              V   +++ GL D+   + ++ VF ++LS         +G
Sbjct: 2473 VGRVETNCNLS----------VEKIKIIRGLRDLTCTETQNVVFEVELSH--------SG 2514

Query: 652  EELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQ 711
             ++  N  + +++P + +Y+IE  G  ++L +  +   D G    ++   +  S  LT+ 
Sbjct: 2515 IDVLWNFKDKEIKPSS-KYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMT-SGKLTVA 2572

Query: 712  ESPVHILSPQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKH 771
               +     +     T   S+  V  CE++  D    W +DG+ +  +  +  + DG K 
Sbjct: 2573 GGAIS----KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKR 2628

Query: 772  RLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVH-------IVDPREHVFVHAITSEC 824
            RLI+   K+ D GE+  +         + V+   +        + + ++ VF   +T   
Sbjct: 2629 RLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPN 2688

Query: 825  VMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDE 884
            V            V+W K+G  +E ++   +  +G    L +            C   DE
Sbjct: 2689 VK----------GVQWIKNGVVLESNEKYAISVKGTIYSLRIK----------NCAIVDE 2728

Query: 885  CAY-FTVTITDVSSWIVYPSGKVY-----VAAVRLERVVLTCELCRPWAEVRWTKDGEEV 938
              Y F +     S+ +   + K+      V A+    V     +      V+W     E+
Sbjct: 2729 SVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEI 2788

Query: 939  VESPALLLQKEDTVRRLVLPAVQLEDSGEYLC---EIDDESASF--TVTVTEPPVRIIYP 993
              S    L  E  V +L+L  +   D+GEY     +++ ++  F  T+ +T+    I  P
Sbjct: 2789 KPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVP 2848

Query: 994  RDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQP 1053
              +              CE+S  + P  W K+G+E+E SE   +   G   +L++     
Sbjct: 2849 ETKTASFE---------CEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTST 2899

Query: 1054 EDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVR 1113
            ED  E+    G+D    T+TVT      +   +   D++      +     V   G   +
Sbjct: 2900 EDSAEYTFVCGNDQVSATLTVTP-----IMITSMLKDINAEEKDTITFEVTVNYEGISYK 2954

Query: 1114 WYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQF 1173
            W K+G+E++++D  Q+  +  T +L + +    DA +Y         T  + +    ++F
Sbjct: 2955 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3014

Query: 1174 LALETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAEGPRRVLCIQ 1233
                     + V   +  +  CE+S     V W  + + +Q  + +++  E     L I 
Sbjct: 3015 ---RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP 3071

Query: 1234 AAGPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHL 1293
            +   + AG YT  +G       L   V+  +  +R +  E    +V       +E  V+ 
Sbjct: 3072 STRMSDAGKYTVVAGGNVSTAKLF--VEGRDVRIRSIKKEV---QVIEKQRAVVEFEVNE 3126

Query: 1294 SGPGGPVRWYKDGERLASQGRVQLEQAGARQVLR--VQGARSGDAGEYLCDAPQDSRIFL 1351
                    WYKDG  +  Q + + +    R++ R  +   R  DAGEY   A ++     
Sbjct: 3127 DDVDA--HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVT 3184

Query: 1352 VSVEEPLLVKLVSELTPLTVHEGDDATFRCEVSP-PDADVTWLRNGAVVTPGPQVEMAQN 1410
            + V  P   +++ EL P+TV  G  A F   +S  P   ++W +   +++ G + +   +
Sbjct: 3185 LYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHD 3244

Query: 1411 GSSRILTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELL------------FLRR 1454
            G    L L      DA   T  A    G   TSA L V   E++             +  
Sbjct: 3245 GQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITP 3304

Query: 1455 LQDVRAEEGQDVCLEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVIL 1514
            LQD    EGQ    +      G    V W    + +       M Q    ++L I     
Sbjct: 3305 LQDTVTSEGQPARFQCRVS--GTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYP 3362

Query: 1515 ADQGTY--------------------GCESHHDRTL-----ARLSVRPRQLRV------L 1543
             D+GTY                    G     + T        LSV  ++  +      +
Sbjct: 3363 EDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFI 3422

Query: 1544 RPLEDVTISEGGSATFQLELSQEGVTG---EWARGGVQLYPGPKCHIH---SDGHRHRLV 1597
            +PL  + +  G +  F   +S  G+     +W      + P      H   S G    L+
Sbjct: 3423 QPLSSLRVHNGETVRFHARVS--GIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLI 3480

Query: 1598 LNGLG--LADSGC-VSFTADSLRCAARLIVR-EVPVTIVRGPHDLEVTEGDTATFECELS 1653
            ++          C  + +A    CAA L V  + P +I+    + E+ E +   F     
Sbjct: 3481 VDAYSEHAGQYSCKAANSAGEATCAATLTVTPKAPESILHERIEQEI-EMEMKEFSSSFL 3539

Query: 1654 QALADVTWEKDGNALTPSPRLRLQALG-TRRLLQLRRCGPSDAGTYSCAVGTARAGPVRL 1712
             A      E++G     S  L+L  +  T  LL       S++  Y     + + G   +
Sbjct: 3540 SA------EEEG---LHSAELQLSKINETLELL-------SESPVYPTKFDSEKEGTGPI 3583

Query: 1713 TVRERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RWELGGRPLRPGARVRIRQEGK 1771
             ++E + A +S         GD AT   TV  +     +W   G  L P A  +   +G 
Sbjct: 3584 FIKEVSNADISM--------GDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGD 3635

Query: 1772 KHILVLSELRAEDAGEVRFQAG------------------------PAQSLALLEVEALP 1807
             H L++   + ED GE    A                           +S     +E L 
Sbjct: 3636 DHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLG 3695

Query: 1808 LQMCRHPPREKTVL---VGRRAVLEVTV-SRSGGHVCWLREGAELCPGDKYEMRSHGPTH 1863
                 H  +E   +    G  A+ E TV       V W +E  +LC    Y +  H P  
Sbjct: 3696 GPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTI-IHNPNG 3754

Query: 1864 S--LVIHDVRPEDQGTYCCQA----GQDSTHTRLLV 1893
            S   +++D + ED G Y C+A    G+ +    LLV
Sbjct: 3755 SGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3790



 Score =  212 bits (539), Expect = 3e-54
 Identities = 217/957 (22%), Positives = 410/957 (42%), Gaps = 63/957 (6%)

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
            K   V  G+ A F C +  +  P +EW+ +G+ L P  + ++ R       L +   + +
Sbjct: 5831 KDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDK-VVPRSEGKVHTLTLRDVKLE 5888

Query: 313  DRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTA 372
            D G     A++      +   L VKEP + FT+PL+D    E   AVLEC+V        
Sbjct: 5889 DAGEVQLTAKDFK----THANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVK 5944

Query: 373  WFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVTVKGPILK 432
            WF+    +L  +KYE + +G VR+L+IH    +D   Y C+ +   +T  N+ V  P ++
Sbjct: 5945 WFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD-FKTSCNLNVVPPHVE 6003

Query: 433  --RLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SSSGHMHALVLPGV 487
              R    L V E E A    E      + +W +DG E+    +    S G +  LV+   
Sbjct: 6004 FLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKC 6063

Query: 488  TREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVLLTWKPPEPAPET 547
              +D  E +  +  +RT+ +L V  ++        LA +     +T+ L  +  +P  E 
Sbjct: 6064 LLDDEAEYSCEVRTARTSGMLTV--LEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEV 6121

Query: 548  PFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFH 607
              I+    +E+      +  +  +   + +    +   G+Y  R+ +    G+   V  H
Sbjct: 6122 --IWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGK---VKVH 6176

Query: 608  GSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLS-TIIQGTWFLNGEELKSNEPEGQVEPG 666
              A     A  ++  +++++ +GE A F   +S       W  + + L+S +        
Sbjct: 6177 ELA-----AEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGD-------- 6223

Query: 667  ALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQDRVSL 726
              +Y +   G +  L++     QD G  V       + +A LT+ E    ++  +D    
Sbjct: 6224 --KYDVIADGKKRVLVVKDATLQDMGTYV-VMVGAARAAAHLTVIEKLRIVVPLKD---T 6277

Query: 727  TFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLVVKMDGRKHRLILPEAKVQDSGEF 786
                 + VV  CE++     A W+++ + + +S   ++      + L + +A + D   +
Sbjct: 6278 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6337

Query: 787  EC-----RTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWY 841
                   R E V +   + V++  + IV+P +   +  +  + V   C+V+R +  ++W 
Sbjct: 6338 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKD--IETMEKKSVTFWCKVNRLNVTLKWT 6395

Query: 842  KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDECAYFTVTITDVSSWIVY 901
            K+G+EV   + V    +     L +      D GE+   AG + +   + I +  +  V 
Sbjct: 6396 KNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 6455

Query: 902  PSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQ 961
                  V     +  V +C+L R  A V+W ++G E+ E      +K+ ++ RL++   +
Sbjct: 6456 HLEDQTV--TEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCR 6513

Query: 962  LEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVR 1021
            L+D  EY C ++D  +   + V E PV II P  ++  +      VV + EL+++   V+
Sbjct: 6514 LDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDI--LEAPGADVVFLAELNKDKVEVQ 6571

Query: 1022 WYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERI 1081
            W ++ + V + +   +  +G   RL +   +P D GE+   A D  A   + + A P+  
Sbjct: 6572 WLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPK-- 6629

Query: 1082 VHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLP 1141
            +  A + L +  G P  + +  +  P  ++  W+K   E E      +       +  + 
Sbjct: 6630 IKTADQDLVVDVGKPLTMVVPYDAYPK-AEAEWFK---ENEPLSTKTIDTTAEQTSFRIL 6685

Query: 1142 HAQPEDAGEY--VCETRHEA----ITFNVILAEPPVQFLAL-ETTPSPLCVAPGEPV 1191
             A+  D G Y  V + +H      I   VI    PV+ L + ET    + +A  EP+
Sbjct: 6686 EAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPL 6742



 Score =  202 bits (514), Expect = 3e-51
 Identities = 155/558 (27%), Positives = 257/558 (46%), Gaps = 27/558 (4%)

Query: 1353 SVEEPLLVKLVSELTPLTVHEGDDATFRCEV-SPPDADVTWLRNGAVVTPGPQVEMAQNG 1411
            S+E P   K+   +   TV +G DA FR  V   PD +  W +NG  +    ++      
Sbjct: 2028 SMEAP---KIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPE 2084

Query: 1412 SSRI-LTLRGCQLGDAGTVTLRA----GSTATSARLHVRETELL-FLRRLQDVRAEEGQD 1465
             +   L +R     D+ ++ ++A    G T++ A L V+  +L+ F + LQDV A+E   
Sbjct: 2085 DNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2144

Query: 1466 VC-LEVETGRVGAAGAVRWVRGGQPLPHDSRLSMAQDGHIHRLFIHGVILADQGTYGC-- 1522
            +   E ET        V+W + G  +    +  M  D  +H L I  +  +D   Y C  
Sbjct: 2145 MATFECETSEPFVK--VKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVL 2202

Query: 1523 -ESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVQLYP 1581
             E  + +T A+L V    +  ++ L+D+ + E  S   +  +S E + G+W    V+L  
Sbjct: 2203 VEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKS 2262

Query: 1582 GPKCHIHSDGHRHRLVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPHDLEVT 1641
              K  I S   R  L +  +   D G  SF  D  +   +L ++  P+ I++G  D +V 
Sbjct: 2263 NGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVC 2322

Query: 1642 EGDTATFECELSQALADVTWEKDGNALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSC- 1700
            EGD    E ++S    +  W KDG  + PS R+ +       +L +      DAG YS  
Sbjct: 2323 EGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFT 2382

Query: 1701 --AVGTARAGPVRLTVRERTVAVLSELRSVSAREGDGATFECTVSEVETTG-RWELGGRP 1757
              A+G + +G V +     +V V++ L+ V+  EG  A  EC VS  + T  +W L    
Sbjct: 2383 IPALGLSTSGRVSV----YSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQ 2438

Query: 1758 LRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPRE 1817
            ++P  RV+   +G K  LV++   A D G  +   G  ++   L VE + +       R+
Sbjct: 2439 IKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKI---IRGLRD 2495

Query: 1818 KTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGT 1877
             T    +  V EV +S SG  V W  +  E+ P  KY++ +HG  + L + ++  +D+G 
Sbjct: 2496 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2555

Query: 1878 YCCQAGQDSTHTRLLVEG 1895
            Y   AG++ T  +L V G
Sbjct: 2556 YTFYAGENMTSGKLTVAG 2573



 Score =  189 bits (480), Expect = 2e-47
 Identities = 271/1226 (22%), Positives = 469/1226 (38%), Gaps = 182/1226 (14%)

Query: 15   LRFPRPVRVVSGAEAE--LKCVVLGEPPPVVVWEKGGQQLAASERLSFPADGAEHGLLLT 72
            L+F  P++ V+  E E  +  V L      V W K  Q+L  +  +S   +G  H +   
Sbjct: 5557 LKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFK 5616

Query: 73   AALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLT 132
                 D       A   + EA     +TVLE                      G P F  
Sbjct: 5617 DLSIDDTSQIRVEAMGMSSEA----KLTVLE----------------------GDPYFTG 5650

Query: 133  GPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASL 192
              +    +   EV+L C       P + W KDG    E+  S +  ++     DG    L
Sbjct: 5651 KLQDYTGVEKDEVILQCEISKADAP-VKWFKDGK---EIKPSKNAVIKA----DGKKRML 5702

Query: 193  ALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAP 252
             L+   A   D G Y C                      S   D ++    +V PL    
Sbjct: 5703 ILK--KALKSDIGQYTCDCGT---------------DKTSGKLDIEDREIKLVRPLHSVE 5745

Query: 253  KTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAK 312
                V E + A+F   +    E +I  +W+ +               G  +L+   C+ K
Sbjct: 5746 ----VMETETARFETEIS---EDDIHANWKLK---------------GEALLQTPDCEIK 5783

Query: 313  DRG------LYVCAARNSAG------QTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVL 360
            + G      L+ C    + G         S+  L VK   +   RPL+DV       A  
Sbjct: 5784 EEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATF 5843

Query: 361  ECKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRT 420
            +C++    IP  W+ + ++L P  K     EG V  L +  +K +D G      +   +T
Sbjct: 5844 DCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD-FKT 5902

Query: 421  VANVTVKGPILKRLPRKLD--VLEGENAVLLVETLEAGVEGRWSRDGEELPVICQ---SS 475
             AN+ VK P ++      D  V EG  AVL  E      + +W ++G E+    +    +
Sbjct: 5903 HANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVA 5962

Query: 476  SGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPILAEMFKGHKNTVL 535
             G +  LV+   T ED    T    + +T+  L V      PP    L  +         
Sbjct: 5963 DGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNV-----VPPHVEFLRPLTD------- 6010

Query: 536  LTWKPPEPAPETPFIYRLERQEVGSEDWIQC-----FSIEKAGAVE--VPGDC-VPSEGD 587
            L  +  E A     + R   +    +D  +      + I   GAV   V   C +  E +
Sbjct: 6011 LQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAE 6070

Query: 588  YRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTI-IQGT 646
            Y   + T    G            L   A     L +++V + +      ++S    +  
Sbjct: 6071 YSCEVRTARTSGM--------LTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVI 6122

Query: 647  WFLNGEELKSNEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSC--PGVQD 704
            W+   EE+        +E G  RY I  +G +  L++     +D+G    ++C  P  + 
Sbjct: 6123 WYKGDEEI--------IETG--RYEILTEGRKRILVIQNAHLEDAG---NYNCRLPSSRT 6169

Query: 705  SAALTIQESPVHILS-PQDRVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEESELLV 763
               + + E     +S PQ   +L     E+    C +S+  FP  W +D + +E  +   
Sbjct: 6170 DGKVKVHELAAEFISKPQ---NLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYD 6226

Query: 764  VKMDGRKHRLILPEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSE 823
            V  DG+K  L++ +A +QD G +        A   +TV +  + IV P +   V     +
Sbjct: 6227 VIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIE-KLRIVVPLKDTRVK--EQQ 6283

Query: 824  CVMLACEVDREDAPVRWYKDGQEV-EESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAG 882
             V+  CEV+ E A  +W+++ + + + S +++L+ +  +   +  A              
Sbjct: 6284 EVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHL------------ 6331

Query: 883  DECAYFTVTITDVSSWIVYPSGKVYV--------------AAVRLERVVLTCELCRPWAE 928
            D+ A + V++T+     V  +  + V                +  + V   C++ R    
Sbjct: 6332 DDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVT 6391

Query: 929  VRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPV 988
            ++WTK+GEEV     +  + +     L +      D GEY+     + +   + + E P 
Sbjct: 6392 LKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPT 6451

Query: 989  RIIYPRDEVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVL 1048
              +   ++ T+     +  V  C+LSRE A V+WY++G E++E +    E+DG   RL++
Sbjct: 6452 EFVEHLEDQTV--TEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLII 6509

Query: 1049 PAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGR-VELRCEVAP 1107
               + +D  E+ C   D  +   + V   P  I+ P    L+    APG  V    E+  
Sbjct: 6510 KDCRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILE----APGADVVFLAELNK 6565

Query: 1108 AGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILA 1167
               +V+W ++ + V   D  Q+ +EG    L +   +P D GEY    + +     + LA
Sbjct: 6566 DKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA 6625

Query: 1168 EPPVQFLALETTPSPLCVAPGEPVVL 1193
              P     ++T    L V  G+P+ +
Sbjct: 6626 AAP----KIKTADQDLVVDVGKPLTM 6647



 Score =  185 bits (469), Expect = 4e-46
 Identities = 322/1474 (21%), Positives = 542/1474 (36%), Gaps = 185/1474 (12%)

Query: 23   VVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERL--SFPADGAEHGLLLTAALPTDAG 80
            V  G++A  +  V+G+P P   W K G ++  S+R+   +P D     L++      D+ 
Sbjct: 2043 VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCE-LVIRDVTAEDSA 2101

Query: 81   VYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPSPGSGEGAPVFLTGPRSQWVL 140
              + +A N AGE  + A + V                           +  T      V 
Sbjct: 2102 SIMVKAINIAGETSSHAFLLVQAKQL----------------------ITFTQELQDVVA 2139

Query: 141  RGAEVVLT--CRAGGLPEPTLYWEKDGMALDEVWDSSHFALQPGRAEDGPGASLALRILA 198
            +  + + T  C     P   + W KDGM   EV +   + +   R          L IL 
Sbjct: 2140 KEKDTMATFECETSE-PFVKVKWYKDGM---EVHEGDKYRMHSDRKVH------FLSILT 2189

Query: 199  ARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAPAPVVEPLKCAPKTFWVN 258
                D+  Y C             L++      +     + A    V+ L    +   V 
Sbjct: 2190 IDTSDAEDYSC------------VLVEDENVKTTAKLIVEGAVVEFVKEL----QDIEVP 2233

Query: 259  EGKHAKFRCYVMGKPEPEIEWHWEGRPL-LPDRRRLMYRDRDGGFVLKVLYCQAKDRGLY 317
            E    +  C V   PE  IE  W    + L    +     R G   L V     +D+G Y
Sbjct: 2234 ESYSGELECIV--SPE-NIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2290

Query: 318  VCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFRED 377
                        +  +L +K   +   + L D +  E  I  LE KV    +   W ++ 
Sbjct: 2291 SFVIDGKK----TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDG 2346

Query: 378  QRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYL-------CEMRGRVRTVANVTVKGPI 430
            Q + P  +   + +     L+I  +  +D G Y            GRV +V +V V  P+
Sbjct: 2347 QEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV-SVYSVDVITPL 2405

Query: 431  LKRLPRKLDVLEGENAVLLVETLEAGVEG-RWSRDGEELPV---ICQSSSGHMHALVLPG 486
                 + ++V+EG  AVL  +     V   +W  + E++     +     G    LV+  
Sbjct: 2406 -----KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINR 2460

Query: 487  VTREDAGEVTFSLGNSRTTTLLRVKCVK--------HSPPGPPILAEMFKGHKN-TVLLT 537
                D G     +G   T   L V+ +K               ++ E+   H    VL  
Sbjct: 2461 THASDEGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWN 2520

Query: 538  WKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSG 597
            +K  E  P +   Y++E              I K   + +  D    EG Y F       
Sbjct: 2521 FKDKEIKPSSK--YKIEAHG----------KIYKLTVLNMMKD---DEGKYTF---YAGE 2562

Query: 598  HGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLST-IIQGTWFLNGEELKS 656
            +  S  +   G A   P       L D  V + ++AVF  +++    +G W  +G+ L  
Sbjct: 2563 NMTSGKLTVAGGAISKP-------LTDQTVAESQEAVFECEVANPDSKGEWLRDGKHL-- 2613

Query: 657  NEPEGQVEPGALRYRIEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVH 716
                    P     R E  G + RLI+ A K  D G    +     + SA L ++   + 
Sbjct: 2614 --------PLTNNIRSESDGHKRRLIIAATKLDDIGEYT-YKVATSKTSAKLKVEAVKI- 2663

Query: 717  ILSPQDRVSLTFTTSERVVLTCELSRVDFPAT-WYKDGQKVEESELLVVKMDGRKHRLIL 775
                +   +LT T ++  V T EL+  +     W K+G  +E +E   + + G  + L +
Sbjct: 2664 ---KKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRI 2720

Query: 776  PEAKVQDSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDRED 835
                + D   +  R   + A   + V+   + I  P++   V A+ +  V     V  + 
Sbjct: 2721 KNCAIVDESVYGFRLGRLGASARLHVETVKI-IKKPKD---VTALENATVAFEVSVSHDT 2776

Query: 836  APVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGD-ECA----YFTV 890
             PV+W+    E++ SD   L +E    +L+L    PSD GE+  V G  EC       T+
Sbjct: 2777 VPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETL 2836

Query: 891  TITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKED 950
             IT     I  P  K              CE+        W K+G E+  S    +  + 
Sbjct: 2837 HITKTMKNIEVPETKT---------ASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQG 2887

Query: 951  TVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLM 1010
             + +L++     EDS EY     ++  S T+TVT  P+ I     ++   A   + +   
Sbjct: 2888 KLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVT--PIMITSMLKDIN--AEEKDTITFE 2943

Query: 1011 CELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFF 1070
              ++ E    +W K+G+E++ ++   +        L +      D  ++   AG  ++  
Sbjct: 2944 VTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTA 3003

Query: 1071 TVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLG 1130
            T+ V A   R +       D+      R    CEV+     V+W KD  E++ +D +++ 
Sbjct: 3004 TLYVEA---RHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQ 3060

Query: 1131 AEGPTRTLTLPHAQPEDAGEYVCETRHEAITFNVILAEPPVQFLALETTPSPLCVAPGEP 1190
             E     L +P  +  DAG+Y         T  + +    V+  +++     + V   + 
Sbjct: 3061 KEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIK---KEVQVIEKQR 3117

Query: 1191 VVLSCELSRAGAPVVWSHNGRPV--QEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSG 1248
             V+  E++       W  +G  +  Q  E  +   E     + I     + AG YT  +G
Sbjct: 3118 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3177

Query: 1249 AAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG-PGGPVRWYKDGE 1307
                  S++  V   EPP   V  E     V+S  G        +SG P   + WYK+ +
Sbjct: 3178 R--NRSSVTLYVNAPEPP--QVLQELQPVTVQS--GKPARFCAVISGRPQPKISWYKEEQ 3231

Query: 1308 RLASQGRVQLEQAGARQVLRVQGARSGDAGEYLCDAPQDSRIFL----VSVEEPLLVK-- 1361
             L++  + +    G    L +  A   DA  Y C+A  D  +      +SVE P +V   
Sbjct: 3232 LLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVE