BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|56699492 small proline-rich protein 2D [Homo sapiens] (72 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|56699492 small proline-rich protein 2D [Homo sapiens] 181 8e-47 gi|83582817 small proline-rich protein 2E [Homo sapiens] 176 4e-45 gi|62955831 small proline-rich protein 2B [Homo sapiens] 175 6e-45 gi|5174693 small proline-rich protein 2A [Homo sapiens] 172 5e-44 gi|62945419 small proline-rich protein 2F [Homo sapiens] 168 1e-42 gi|62122851 small proline-rich protein 2G [Homo sapiens] 138 1e-33 gi|45827734 small proline-rich protein 1A [Homo sapiens] 68 2e-12 gi|83582815 small proline-rich protein 1B [Homo sapiens] 66 7e-12 gi|30410035 late cornified envelope 5A [Homo sapiens] 63 6e-11 gi|30410045 late cornified envelope 2A [Homo sapiens] 57 2e-09 gi|239752912 PREDICTED: hypothetical protein [Homo sapiens] 55 9e-09 gi|30387654 late cornified envelope 1A [Homo sapiens] 55 9e-09 gi|30387646 late cornified envelope 1F [Homo sapiens] 55 9e-09 gi|30387650 late cornified envelope 1E [Homo sapiens] 55 9e-09 gi|30387652 late cornified envelope 1C [Homo sapiens] 55 9e-09 gi|27436869 small proline-rich protein 4 [Homo sapiens] 54 3e-08 gi|30387648 late cornified envelope 1D [Homo sapiens] 52 8e-08 gi|58082087 late cornified envelope-like proline-rich 1 [Homo sa... 52 1e-07 gi|7657685 late cornified envelope 2B [Homo sapiens] 51 2e-07 gi|40353729 Ras and Rab interactor 3 [Homo sapiens] 51 2e-07 gi|30387656 late cornified envelope 1B [Homo sapiens] 49 6e-07 gi|30410043 late cornified envelope 2D [Homo sapiens] 49 8e-07 gi|33356148 formin-like 1 [Homo sapiens] 49 1e-06 gi|30387642 late cornified envelope 4A [Homo sapiens] 48 1e-06 gi|114431236 zinc finger protein 462 [Homo sapiens] 48 2e-06 gi|150378543 MYST histone acetyltransferase (monocytic leukemia)... 48 2e-06 gi|150378463 MYST histone acetyltransferase (monocytic leukemia)... 48 2e-06 gi|150378493 MYST histone acetyltransferase (monocytic leukemia)... 48 2e-06 gi|30410047 late cornified envelope 2C [Homo sapiens] 48 2e-06 gi|90903231 huntingtin [Homo sapiens] 47 2e-06 >gi|56699492 small proline-rich protein 2D [Homo sapiens] Length = 72 Score = 181 bits (460), Expect = 8e-47 Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 Query: 61 PPCQPKCPPKSK 72 PPCQPKCPPKSK Sbjct: 61 PPCQPKCPPKSK 72 >gi|83582817 small proline-rich protein 2E [Homo sapiens] Length = 72 Score = 176 bits (446), Expect = 4e-45 Identities = 70/72 (97%), Positives = 70/72 (97%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCP PKCPQPCPPQQCQQK PPVTPS Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKCPPVTPS 60 Query: 61 PPCQPKCPPKSK 72 PPCQPKCPPKSK Sbjct: 61 PPCQPKCPPKSK 72 >gi|62955831 small proline-rich protein 2B [Homo sapiens] Length = 72 Score = 175 bits (444), Expect = 6e-45 Identities = 70/72 (97%), Positives = 70/72 (97%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCP PKCPQPCPPQQCQQKYPPVTPS Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPS 60 Query: 61 PPCQPKCPPKSK 72 PPCQPK PPKSK Sbjct: 61 PPCQPKYPPKSK 72 >gi|5174693 small proline-rich protein 2A [Homo sapiens] Length = 72 Score = 172 bits (436), Expect = 5e-44 Identities = 69/72 (95%), Positives = 69/72 (95%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCP PKCPQPCPPQQCQQKYPPVTPS Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPS 60 Query: 61 PPCQPKCPPKSK 72 PPCQ K PPKSK Sbjct: 61 PPCQSKYPPKSK 72 >gi|62945419 small proline-rich protein 2F [Homo sapiens] Length = 72 Score = 168 bits (425), Expect = 1e-42 Identities = 67/72 (93%), Positives = 67/72 (93%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MSYQQQQCKQPCQPPPVCP PKCPEPCPPPKCPEPCP KCPQ CPPQQCQQK PPVTPS Sbjct: 1 MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPS 60 Query: 61 PPCQPKCPPKSK 72 PPCQPKCPPKSK Sbjct: 61 PPCQPKCPPKSK 72 >gi|62122851 small proline-rich protein 2G [Homo sapiens] Length = 73 Score = 138 bits (347), Expect = 1e-33 Identities = 58/73 (79%), Positives = 59/73 (80%), Gaps = 1/73 (1%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKC-PQPCPPQQCQQKYPPVTP 59 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEP P C P+ CPP CQ K PPV P Sbjct: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPYLPPPCPPEHCPPPPCQDKCPPVQP 60 Query: 60 SPPCQPKCPPKSK 72 PPCQ K PPKSK Sbjct: 61 YPPCQQKYPPKSK 73 >gi|45827734 small proline-rich protein 1A [Homo sapiens] Length = 89 Score = 67.8 bits (164), Expect = 2e-12 Identities = 40/75 (53%), Positives = 42/75 (56%), Gaps = 10/75 (13%) Query: 4 QQQQCKQPCQPPPVCPT-PKCPEPCPPPKCPEPCPSPKCPQPCPP---QQCQQKYPPVTP 59 QQQQ KQPCQPPP P PK EPC P K PEPC PK P+PC P + CQ K P P Sbjct: 17 QQQQVKQPCQPPPQEPCIPKTKEPCHP-KVPEPC-HPKVPEPCQPKVPEPCQPKVPEPCP 74 Query: 60 S----PPCQPKCPPK 70 S P Q K K Sbjct: 75 STVTPAPAQQKTKQK 89 Score = 59.3 bits (142), Expect = 6e-10 Identities = 33/73 (45%), Positives = 37/73 (50%), Gaps = 16/73 (21%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPP-------PKCPEPCPSPKCPQPC---PPQQCQQKYP 55 QQ KQPC PPP + +PC P PK EPC PK P+PC P+ CQ K P Sbjct: 4 QQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPC-HPKVPEPCHPKVPEPCQPKVP 62 Query: 56 PVTPSPPCQPKCP 68 PCQPK P Sbjct: 63 -----EPCQPKVP 70 Score = 28.9 bits (63), Expect = 0.91 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 43 QPC-PPQQCQQKYPPVTPSPPCQPKCPPKSK 72 QPC PP Q QQ+ PP Q C PK+K Sbjct: 8 QPCTPPPQPQQQQVKQPCQPPPQEPCIPKTK 38 >gi|83582815 small proline-rich protein 1B [Homo sapiens] Length = 89 Score = 65.9 bits (159), Expect = 7e-12 Identities = 39/75 (52%), Positives = 41/75 (54%), Gaps = 10/75 (13%) Query: 4 QQQQCKQPCQPPPVCPT-PKCPEPCPPPKCPEPCPSPKCPQPCPP---QQCQQKYPPVTP 59 QQQQ KQPCQPPP P PK EPC P K PEPC PK P+PC P + C K P P Sbjct: 17 QQQQVKQPCQPPPQEPCIPKTKEPCHP-KVPEPC-HPKVPEPCQPKVPEPCHPKVPEPCP 74 Query: 60 S----PPCQPKCPPK 70 S P Q K K Sbjct: 75 SIVTPAPAQQKTKQK 89 Score = 58.9 bits (141), Expect = 8e-10 Identities = 35/78 (44%), Positives = 39/78 (50%), Gaps = 18/78 (23%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPP-------PKCPEPCPSPKCPQPC---PPQQC 50 MS QQQ KQPC PPP + +PC P PK EPC PK P+PC P+ C Sbjct: 1 MSSQQQ--KQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPC-HPKVPEPCHPKVPEPC 57 Query: 51 QQKYPPVTPSPPCQPKCP 68 Q K P PC PK P Sbjct: 58 QPKVP-----EPCHPKVP 70 Score = 29.6 bits (65), Expect = 0.53 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 43 QPC-PPQQCQQKYPPVTPSPPCQPKCPPKSK 72 QPC PP Q QQ+ PP Q C PK+K Sbjct: 8 QPCTPPPQLQQQQVKQPCQPPPQEPCIPKTK 38 >gi|30410035 late cornified envelope 5A [Homo sapiens] Length = 118 Score = 62.8 bits (151), Expect = 6e-11 Identities = 28/45 (62%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPP---PKCPEPCPSPKCPQPCPP 47 QQ +Q CQPPP C TPKCP C P PKCP CP P+C PCPP Sbjct: 4 QQSQQQCQPPPKC-TPKCPPKCTPKCPPKCPPKCP-PQCSAPCPP 46 Score = 33.1 bits (74), Expect = 0.048 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQSQQQCQPPPKCTPKCPPK 23 Score = 29.6 bits (65), Expect = 0.53 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Query: 48 QQCQQKYPPVTPSPPCQPKCPPK 70 QQCQ PP +P C PKC PK Sbjct: 8 QQCQ---PPPKCTPKCPPKCTPK 27 >gi|30410045 late cornified envelope 2A [Homo sapiens] Length = 106 Score = 57.4 bits (137), Expect = 2e-09 Identities = 27/42 (64%), Positives = 28/42 (66%), Gaps = 6/42 (14%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPP---PKCPEPCPSP 39 MS QQ Q Q CQPPP CP PKCP CPP P+CP PCP P Sbjct: 1 MSCQQNQ--QQCQPPPKCP-PKCPPKCPPKCRPQCPAPCPPP 39 Score = 33.1 bits (74), Expect = 0.048 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQNQQQCQPPPKCPPKCPPK 23 Score = 32.3 bits (72), Expect = 0.082 Identities = 14/25 (56%), Positives = 15/25 (60%), Gaps = 3/25 (12%) Query: 48 QQCQQKYPPVTPSPPCQPKCPPKSK 72 QQCQ PP P C PKCPPK + Sbjct: 8 QQCQ---PPPKCPPKCPPKCPPKCR 29 >gi|239752912 PREDICTED: hypothetical protein [Homo sapiens] Length = 118 Score = 55.5 bits (132), Expect = 9e-09 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 15/53 (28%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVT 58 QQ +Q CQPPP C PKCP CP+PKCP CPP K PPV+ Sbjct: 4 QQSQQQCQPPPKCT----------PKCPPKCPTPKCPPKCPP-----KCPPVS 41 Score = 52.8 bits (125), Expect = 6e-08 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Query: 5 QQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPP 47 QQQC+ P P C TPKCP CP PKCP PKCP CPP Sbjct: 7 QQQCQPP----PKC-TPKCPPKCPTPKCP-----PKCPPKCPP 39 Score = 33.1 bits (74), Expect = 0.048 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQSQQQCQPPPKCTPKCPPK 23 >gi|30387654 late cornified envelope 1A [Homo sapiens] Length = 110 Score = 55.5 bits (132), Expect = 9e-09 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 15/53 (28%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVT 58 QQ +Q CQPPP C PKCP CP+PKCP CPP K PPV+ Sbjct: 4 QQSQQQCQPPPKCT----------PKCPPKCPTPKCPPKCPP-----KCPPVS 41 Score = 52.8 bits (125), Expect = 6e-08 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Query: 5 QQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPP 47 QQQC+ P P C TPKCP CP PKCP PKCP CPP Sbjct: 7 QQQCQPP----PKC-TPKCPPKCPTPKCP-----PKCPPKCPP 39 Score = 33.1 bits (74), Expect = 0.048 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQSQQQCQPPPKCTPKCPPK 23 >gi|30387646 late cornified envelope 1F [Homo sapiens] Length = 118 Score = 55.5 bits (132), Expect = 9e-09 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 15/53 (28%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVT 58 QQ +Q CQPPP C PKCP CP+PKCP CPP K PPV+ Sbjct: 4 QQSQQQCQPPPKCT----------PKCPPKCPTPKCPPKCPP-----KCPPVS 41 Score = 52.8 bits (125), Expect = 6e-08 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Query: 5 QQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPP 47 QQQC+ P P C TPKCP CP PKCP PKCP CPP Sbjct: 7 QQQCQPP----PKC-TPKCPPKCPTPKCP-----PKCPPKCPP 39 Score = 33.1 bits (74), Expect = 0.048 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQSQQQCQPPPKCTPKCPPK 23 >gi|30387650 late cornified envelope 1E [Homo sapiens] Length = 118 Score = 55.5 bits (132), Expect = 9e-09 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 15/53 (28%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVT 58 QQ +Q CQPPP C PKCP CP+PKCP CPP K PPV+ Sbjct: 4 QQSQQQCQPPPKCT----------PKCPPKCPTPKCPPKCPP-----KCPPVS 41 Score = 52.8 bits (125), Expect = 6e-08 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Query: 5 QQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPP 47 QQQC+ P P C TPKCP CP PKCP PKCP CPP Sbjct: 7 QQQCQPP----PKC-TPKCPPKCPTPKCP-----PKCPPKCPP 39 Score = 33.1 bits (74), Expect = 0.048 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQSQQQCQPPPKCTPKCPPK 23 >gi|30387652 late cornified envelope 1C [Homo sapiens] Length = 118 Score = 55.5 bits (132), Expect = 9e-09 Identities = 26/53 (49%), Positives = 29/53 (54%), Gaps = 15/53 (28%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVT 58 QQ +Q CQPPP C PKCP CP+PKCP CPP K PPV+ Sbjct: 4 QQSQQQCQPPPKCT----------PKCPPKCPTPKCPPKCPP-----KCPPVS 41 Score = 52.8 bits (125), Expect = 6e-08 Identities = 25/43 (58%), Positives = 26/43 (60%), Gaps = 10/43 (23%) Query: 5 QQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPP 47 QQQC+ P P C TPKCP CP PKCP PKCP CPP Sbjct: 7 QQQCQPP----PKC-TPKCPPKCPTPKCP-----PKCPPKCPP 39 Score = 33.1 bits (74), Expect = 0.048 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQSQQQCQPPPKCTPKCPPK 23 >gi|27436869 small proline-rich protein 4 [Homo sapiens] Length = 79 Score = 53.5 bits (127), Expect = 3e-08 Identities = 30/65 (46%), Positives = 34/65 (52%), Gaps = 15/65 (23%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPC 63 QQQQ KQPCQPPPV KC E C +PK PC P Q +++ PP P Sbjct: 19 QQQQVKQPCQPPPV----KCQETC----------APKTKDPCAP-QVKKQCPPKGTIIPA 63 Query: 64 QPKCP 68 Q KCP Sbjct: 64 QQKCP 68 Score = 33.5 bits (75), Expect = 0.037 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Query: 43 QPCPPQQCQQ---KYPPVTPSPPCQPKCPPKSK 72 Q CPPQ+ QQ K P P CQ C PK+K Sbjct: 11 QQCPPQRAQQQQVKQPCQPPPVKCQETCAPKTK 43 >gi|30387648 late cornified envelope 1D [Homo sapiens] Length = 114 Score = 52.4 bits (124), Expect = 8e-08 Identities = 21/32 (65%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 6 QQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCP 37 QQ +Q CQPPP C TPKC CP PKCP CP Sbjct: 4 QQSQQQCQPPPKC-TPKCTPKCPAPKCPPKCP 34 Score = 30.0 bits (66), Expect = 0.41 Identities = 11/21 (52%), Positives = 11/21 (52%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKC PK Sbjct: 3 CQQSQQQCQPPPKCTPKCTPK 23 Score = 28.1 bits (61), Expect = 1.5 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 3/21 (14%) Query: 48 QQCQQKYPPVTPSPPCQPKCP 68 QQCQ PP +P C PKCP Sbjct: 8 QQCQ---PPPKCTPKCTPKCP 25 >gi|58082087 late cornified envelope-like proline-rich 1 [Homo sapiens] Length = 98 Score = 52.0 bits (123), Expect = 1e-07 Identities = 29/88 (32%), Positives = 34/88 (38%), Gaps = 38/88 (43%) Query: 5 QQQCKQPCQPPPV----------CPTPKCPEP-------------CPPPKCPEPCPSPKC 41 +Q+C+ CQP + CP KCP P CPP C +PCP PKC Sbjct: 24 EQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCP-PKC 82 Query: 42 PQPCPPQQCQQKYPPVTPSPPCQPKCPP 69 P CP C P CPP Sbjct: 83 PSSCP--------------HACPPPCPP 96 Score = 51.6 bits (122), Expect = 1e-07 Identities = 21/39 (53%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQ 49 P Q P CP C +PCPP KCP CP CP PCPP + Sbjct: 62 PSQSPSSCPPQPCTKPCPP-KCPSSCPH-ACPPPCPPPE 98 >gi|7657685 late cornified envelope 2B [Homo sapiens] Length = 110 Score = 51.2 bits (121), Expect = 2e-07 Identities = 25/46 (54%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Query: 5 QQQCKQPCQPPPVCPTPKCPEPCPP---PKCPEPCPSPKCPQPCPP 47 QQQC+ P + PP C TPKCP CPP P+CP PC SP C P Sbjct: 7 QQQCQPPPKCPPKC-TPKCPPKCPPKCLPQCPAPC-SPAVSSCCGP 50 Score = 45.1 bits (105), Expect = 1e-05 Identities = 26/60 (43%), Positives = 30/60 (50%), Gaps = 17/60 (28%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MS QQ Q Q CQPPP CP PKC +PKCP CPP+ Q P +P+ Sbjct: 1 MSCQQNQ--QQCQPPPKCP----------PKC-----TPKCPPKCPPKCLPQCPAPCSPA 43 Score = 32.0 bits (71), Expect = 0.11 Identities = 14/23 (60%), Positives = 14/23 (60%), Gaps = 3/23 (13%) Query: 48 QQCQQKYPPVTPSPPCQPKCPPK 70 QQCQ PP P C PKCPPK Sbjct: 8 QQCQ---PPPKCPPKCTPKCPPK 27 Score = 30.0 bits (66), Expect = 0.41 Identities = 11/21 (52%), Positives = 11/21 (52%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKC PK Sbjct: 3 CQQNQQQCQPPPKCPPKCTPK 23 >gi|40353729 Ras and Rab interactor 3 [Homo sapiens] Length = 985 Score = 50.8 bits (120), Expect = 2e-07 Identities = 24/61 (39%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 9 KQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCP 68 ++P PPPV P C P PP P P+P CP P P P P PP P P Sbjct: 278 RRPPPPPPVLPLQPC-SPAQPPVLPALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQP 336 Query: 69 P 69 P Sbjct: 337 P 337 Score = 34.7 bits (78), Expect = 0.017 Identities = 22/64 (34%), Positives = 26/64 (40%), Gaps = 7/64 (10%) Query: 11 PCQPPPV--CPTPKCPEPCPPPKCPEPCPSPKCPQPCPP----QQCQQKYPPVTPSPPCQ 64 P PP+ CP P P P +P+ P P PP Q C PPV P+ Sbjct: 248 PTDQPPLGNCPARPLP-PTSDATSPTSRWAPRRPPPPPPVLPLQPCSPAQPPVLPALAPA 306 Query: 65 PKCP 68 P CP Sbjct: 307 PACP 310 Score = 31.2 bits (69), Expect = 0.18 Identities = 28/87 (32%), Positives = 31/87 (35%), Gaps = 24/87 (27%) Query: 6 QQCKQPCQPP--------PVCPTPKCPE-PCP--------PPKCPEPCPSPKCPQ-PCP- 46 Q C P QPP P CP P P P P PP P P C + PCP Sbjct: 290 QPCS-PAQPPVLPALAPAPACPLPTSPPVPAPHVTPHAPGPPDHPNQPPMMTCERLPCPT 348 Query: 47 ----PQQCQQKYPPVTPSPPCQPKCPP 69 P + + P SP Q PP Sbjct: 349 AGLGPLREEAMKPGAASSPLQQVPAPP 375 >gi|30387656 late cornified envelope 1B [Homo sapiens] Length = 118 Score = 49.3 bits (116), Expect = 6e-07 Identities = 27/58 (46%), Positives = 30/58 (51%), Gaps = 17/58 (29%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVT 58 MS QQ Q Q CQPPP C PKCP C +P+CP CPP K PPV+ Sbjct: 1 MSCQQNQ--QQCQPPPKCI----------PKCPPKCLTPRCPPKCPP-----KCPPVS 41 Score = 32.3 bits (72), Expect = 0.082 Identities = 12/21 (57%), Positives = 12/21 (57%) Query: 50 CQQKYPPVTPSPPCQPKCPPK 70 CQQ P P C PKCPPK Sbjct: 3 CQQNQQQCQPPPKCIPKCPPK 23 >gi|30410043 late cornified envelope 2D [Homo sapiens] Length = 110 Score = 48.9 bits (115), Expect = 8e-07 Identities = 33/75 (44%), Positives = 35/75 (46%), Gaps = 27/75 (36%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MS QQ Q Q CQPPP CP PKC +PKCP CPP K PP P+ Sbjct: 1 MSCQQNQ--QQCQPPPKCP----------PKC-----TPKCPPKCPP-----KCPPQCPA 38 Query: 61 PPCQPK----CPPKS 71 PC P C P S Sbjct: 39 -PCSPAVSSCCGPSS 52 >gi|33356148 formin-like 1 [Homo sapiens] Length = 1100 Score = 48.5 bits (114), Expect = 1e-06 Identities = 25/59 (42%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPP 69 P PP P P PEP P P P P P P P PP PP P PP P PP Sbjct: 559 PSAPPQAPPLPGSPEPPPAPPLPGDLPPPP-PPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 41.2 bits (95), Expect = 2e-04 Identities = 21/54 (38%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Query: 14 PPPVCPTPKCPEP--CPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQP 65 PPP P P P P PP P+ P P P+P P PP P PP P Sbjct: 542 PPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPP 595 Score = 40.4 bits (93), Expect = 3e-04 Identities = 25/67 (37%), Positives = 29/67 (43%), Gaps = 8/67 (11%) Query: 11 PCQPPPVCPTPKCPEPCPPPKC------PEPCPSPKCPQPCPPQQCQQKYPPVT--PSPP 62 P P P P+P+ P PP+ PEP P+P P PP PP T P PP Sbjct: 544 PPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGPVPP 603 Query: 63 CQPKCPP 69 P PP Sbjct: 604 PPPPPPP 610 Score = 35.0 bits (79), Expect = 0.013 Identities = 21/60 (35%), Positives = 24/60 (40%), Gaps = 9/60 (15%) Query: 19 PTPKCPEPCPPPKC-----PEPCPSPKCPQPCP----PQQCQQKYPPVTPSPPCQPKCPP 69 PTP P P P P P +P P P P PQ+ PP P P P+ PP Sbjct: 517 PTPGVPTGSPSPDLAPAAEPAPGAAPPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPP 576 Score = 34.7 bits (78), Expect = 0.017 Identities = 21/56 (37%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 15 PPVCPTPK-CPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYP-PVTPSPPCQPKCP 68 P + P + P PPP P P P PQ PP Q P P +P PP P P Sbjct: 528 PDLAPAAEPAPGAAPPP--PPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLP 581 Score = 33.5 bits (75), Expect = 0.037 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPP 69 P P P P P P P+ P P P PP + PP P P P PP Sbjct: 532 PAAEPAPGAAPPPPPPLPGLPSPQEAP-PSAPPQAPPLPGSPEPPPAPPLPGDLPPPPP 589 Score = 33.5 bits (75), Expect = 0.037 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Query: 11 PCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPK 66 P PPP P P P PPP P P P P P ++ + P V P Q K Sbjct: 585 PPPPPPPPPPPGTDGPVPPPP-PPPPPPPGGPPDALGRRDSELGPGVKAKKPIQTK 639 >gi|30387642 late cornified envelope 4A [Homo sapiens] Length = 99 Score = 48.1 bits (113), Expect = 1e-06 Identities = 23/39 (58%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSP 39 MS QQ Q Q CQPPP CP PK P C P KC CP P Sbjct: 1 MSCQQNQ--QQCQPPPKCPIPKYPPKC-PSKCASSCPPP 36 Score = 28.1 bits (61), Expect = 1.5 Identities = 13/23 (56%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Query: 48 QQCQQKYPPVTPSPPCQPKCPPK 70 QQCQ PP P P PKCP K Sbjct: 8 QQCQP--PPKCPIPKYPPKCPSK 28 >gi|114431236 zinc finger protein 462 [Homo sapiens] Length = 2506 Score = 47.8 bits (112), Expect = 2e-06 Identities = 27/63 (42%), Positives = 31/63 (49%), Gaps = 9/63 (14%) Query: 7 QCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPK 66 Q +QP QPPP P P PPP P+P P+ PQ PP Q + P T PP Q Sbjct: 538 QQQQPPQPPP-------PPPPPPPSQPQPLQQPQPPQLQPPHQVPPQ--PQTQPPPTQQP 588 Query: 67 CPP 69 PP Sbjct: 589 QPP 591 Score = 43.9 bits (102), Expect = 3e-05 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 5/61 (8%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPC 63 QQQQ QP PPP P P P+P P+ P+ P P PPQ Q P P PP Sbjct: 538 QQQQPPQPPPPPPP-PPPSQPQPLQQPQPPQLQP----PHQVPPQPQTQPPPTQQPQPPT 592 Query: 64 Q 64 Q Sbjct: 593 Q 593 Score = 34.7 bits (78), Expect = 0.017 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Query: 25 EPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSP---PCQPKCPP 69 +P + P+P P P P P PQ QQ PP P P QP+ P Sbjct: 535 DPLQQQQPPQPPPPPPPPPPSQPQPLQQPQPPQLQPPHQVPPQPQTQP 582 Score = 25.8 bits (55), Expect = 7.7 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 8/51 (15%) Query: 4 QQQQCKQPCQPPPVCP---TPKCPEPCPPP-KCPEPCPSPKCPQPCPPQQC 50 Q Q +QP QPP + P P P+ PPP + P+P P P P +C Sbjct: 556 QPQPLQQP-QPPQLQPPHQVPPQPQTQPPPTQQPQP---PTQAAPLHPYKC 602 >gi|150378543 MYST histone acetyltransferase (monocytic leukemia) 3 [Homo sapiens] Length = 2004 Score = 47.8 bits (112), Expect = 2e-06 Identities = 29/63 (46%), Positives = 35/63 (55%), Gaps = 5/63 (7%) Query: 10 QPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPP 69 Q QPPP P P+ P+P PPP+ P+P P P PQ PQQ Q P P PP + PP Sbjct: 1647 QQQQPPP--PPPQQPQP-PPPQ-PQPAPQPPPPQQ-QPQQQPQPQPQQPPPPPPPQQQPP 1701 Query: 70 KSK 72 S+ Sbjct: 1702 LSQ 1704 Score = 32.7 bits (73), Expect = 0.063 Identities = 20/56 (35%), Positives = 22/56 (39%) Query: 13 QPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCP 68 Q V P C P E PS + QP PP Q + PP P P QP P Sbjct: 1620 QQSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPP 1675 >gi|150378463 MYST histone acetyltransferase (monocytic leukemia) 3 [Homo sapiens] Length = 2004 Score = 47.8 bits (112), Expect = 2e-06 Identities = 29/63 (46%), Positives = 35/63 (55%), Gaps = 5/63 (7%) Query: 10 QPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPP 69 Q QPPP P P+ P+P PPP+ P+P P P PQ PQQ Q P P PP + PP Sbjct: 1647 QQQQPPP--PPPQQPQP-PPPQ-PQPAPQPPPPQQ-QPQQQPQPQPQQPPPPPPPQQQPP 1701 Query: 70 KSK 72 S+ Sbjct: 1702 LSQ 1704 Score = 32.7 bits (73), Expect = 0.063 Identities = 20/56 (35%), Positives = 22/56 (39%) Query: 13 QPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCP 68 Q V P C P E PS + QP PP Q + PP P P QP P Sbjct: 1620 QQSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPP 1675 >gi|150378493 MYST histone acetyltransferase (monocytic leukemia) 3 [Homo sapiens] Length = 2004 Score = 47.8 bits (112), Expect = 2e-06 Identities = 29/63 (46%), Positives = 35/63 (55%), Gaps = 5/63 (7%) Query: 10 QPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCPP 69 Q QPPP P P+ P+P PPP+ P+P P P PQ PQQ Q P P PP + PP Sbjct: 1647 QQQQPPP--PPPQQPQP-PPPQ-PQPAPQPPPPQQ-QPQQQPQPQPQQPPPPPPPQQQPP 1701 Query: 70 KSK 72 S+ Sbjct: 1702 LSQ 1704 Score = 32.7 bits (73), Expect = 0.063 Identities = 20/56 (35%), Positives = 22/56 (39%) Query: 13 QPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPCQPKCP 68 Q V P C P E PS + QP PP Q + PP P P QP P Sbjct: 1620 QQSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPP 1675 >gi|30410047 late cornified envelope 2C [Homo sapiens] Length = 110 Score = 47.8 bits (112), Expect = 2e-06 Identities = 33/75 (44%), Positives = 35/75 (46%), Gaps = 27/75 (36%) Query: 1 MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPS 60 MS QQ Q Q CQPPP CP PKC +PKCP CPP K PP P+ Sbjct: 1 MSCQQNQ--QQCQPPPKCP----------PKC-----TPKCPPKCPP-----KCPPQCPA 38 Query: 61 PPCQPK----CPPKS 71 PC P C P S Sbjct: 39 -PCFPAVSSCCGPSS 52 >gi|90903231 huntingtin [Homo sapiens] Length = 3144 Score = 47.4 bits (111), Expect = 2e-06 Identities = 28/61 (45%), Positives = 31/61 (50%), Gaps = 15/61 (24%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCP--SPKCPQPCPPQQCQQKYPPVTPSP 61 QQQQ +Q QPPP P P PPP+ P+P P P PQP PP PP P P Sbjct: 31 QQQQQQQQQQPPPPPPPP------PPPQLPQPPPQAQPLLPQPQPP-------PPPPPPP 77 Query: 62 P 62 P Sbjct: 78 P 78 Score = 47.4 bits (111), Expect = 2e-06 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 9/69 (13%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPC 63 QQQQ +QP PPP P P+ P+ PPP+ P P+ P P PP PP P+ Sbjct: 34 QQQQQQQPPPPPPPPPPPQLPQ--PPPQAQPLLPQPQPPPPPPP-------PPPGPAVAE 84 Query: 64 QPKCPPKSK 72 +P PK + Sbjct: 85 EPLHRPKKE 93 Score = 37.7 bits (86), Expect = 0.002 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 5/65 (7%) Query: 4 QQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKYPPVTPSPPC 63 QQQQ +Q Q + +P PPP P P P+ PQ PP Q Q P P PP Sbjct: 19 QQQQQQQQQQQQQQQQQQQQQQPPPPP---PPPPPPQLPQ--PPPQAQPLLPQPQPPPPP 73 Query: 64 QPKCP 68 P P Sbjct: 74 PPPPP 78 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.316 0.140 0.541 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,882,559 Number of Sequences: 37866 Number of extensions: 591659 Number of successful extensions: 16741 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 664 Number of HSP's that attempted gapping in prelim test: 4440 Number of HSP's gapped (non-prelim): 7139 length of query: 72 length of database: 18,247,518 effective HSP length: 45 effective length of query: 27 effective length of database: 16,543,548 effective search space: 446675796 effective search space used: 446675796 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.