Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 46049110

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|46049110 myosin binding protein C, slow type isoform 4 [Homo
sapiens]
         (1123 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...  2284   0.0  
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...  2271   0.0  
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...  2270   0.0  
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...  2268   0.0  
gi|133908641 myosin binding protein C, fast type [Homo sapiens]      1168   0.0  
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]        1150   0.0  
gi|55956914 myosin binding protein H [Homo sapiens]                   458   e-128
gi|194018539 myosin binding protein H-like [Homo sapiens]             375   e-103
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     303   5e-82
gi|110349719 titin isoform N2-A [Homo sapiens]                        299   9e-81
gi|110349717 titin isoform novex-2 [Homo sapiens]                     299   9e-81
gi|110349713 titin isoform novex-1 [Homo sapiens]                     299   9e-81
gi|110349715 titin isoform N2-B [Homo sapiens]                        299   9e-81
gi|148839296 immunoglobulin-like and fibronectin type III domain...   249   1e-65
gi|110349721 titin isoform novex-3 [Homo sapiens]                     139   2e-32
gi|156104903 myomesin 2 [Homo sapiens]                                137   6e-32
gi|140560917 myomesin 1 isoform b [Homo sapiens]                      132   2e-30
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   129   2e-29
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   129   2e-29
gi|118572606 hemicentin 1 [Homo sapiens]                              123   9e-28
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      117   5e-26
gi|144226847 obscurin-like 1 [Homo sapiens]                           116   1e-25
gi|20127422 Down syndrome cell adhesion molecule isoform CHD2-42...   116   1e-25
gi|155969693 myomesin family, member 3 [Homo sapiens]                 114   7e-25
gi|157785645 SPEG complex locus [Homo sapiens]                        112   2e-24
gi|21359935 Down syndrome cell adhesion molecule like 1 [Homo sa...   111   4e-24
gi|19743806 roundabout 1 isoform b [Homo sapiens]                     105   3e-22
gi|169178458 PREDICTED: hemicentin 2 [Homo sapiens]                   105   3e-22
gi|4506569 roundabout 1 isoform a [Homo sapiens]                      105   3e-22
gi|239749684 PREDICTED: hemicentin 2 [Homo sapiens]                   104   4e-22

>gi|46049110 myosin binding protein C, slow type isoform 4 [Homo
            sapiens]
          Length = 1123

 Score = 2284 bits (5919), Expect = 0.0
 Identities = 1123/1123 (100%), Positives = 1123/1123 (100%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60

Query: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120
            IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS
Sbjct: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120

Query: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180
            RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE
Sbjct: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180

Query: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240
            GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR
Sbjct: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240

Query: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300
            LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF
Sbjct: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300

Query: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
            EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE
Sbjct: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360

Query: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
            LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG
Sbjct: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420

Query: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480
            QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV
Sbjct: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480

Query: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540
            HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG
Sbjct: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540

Query: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600
            NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN
Sbjct: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600

Query: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660
            LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK
Sbjct: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660

Query: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
            KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP
Sbjct: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720

Query: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT 780
            PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT
Sbjct: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT 780

Query: 781  GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVN 840
            GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVN
Sbjct: 781  GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVN 840

Query: 841  LVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 900
            LVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF
Sbjct: 841  LVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 900

Query: 901  VETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEW 960
            VETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEW
Sbjct: 901  VETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEW 960

Query: 961  FTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1020
            FTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY
Sbjct: 961  FTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1020

Query: 1021 EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1080
            EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN
Sbjct: 1021 EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1080

Query: 1081 QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
            QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ
Sbjct: 1081 QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123


>gi|46049119 myosin binding protein C, slow type isoform 3 [Homo
            sapiens]
          Length = 1141

 Score = 2271 bits (5886), Expect = 0.0
 Identities = 1122/1141 (98%), Positives = 1123/1141 (98%), Gaps = 18/1141 (1%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60

Query: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120
            IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS
Sbjct: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120

Query: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180
            RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE
Sbjct: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180

Query: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240
            GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR
Sbjct: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240

Query: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300
            LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF
Sbjct: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300

Query: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
            EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE
Sbjct: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360

Query: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
            LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG
Sbjct: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420

Query: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480
            QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV
Sbjct: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480

Query: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540
            HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG
Sbjct: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540

Query: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600
            NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN
Sbjct: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600

Query: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660
            LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK
Sbjct: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660

Query: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
            KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP
Sbjct: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720

Query: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT------------------E 762
            PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG+                  E
Sbjct: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE 780

Query: 763  DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR 822
            DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR
Sbjct: 781  DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR 840

Query: 823  IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK 882
            IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK
Sbjct: 841  IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK 900

Query: 883  AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN 942
            AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN
Sbjct: 901  AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN 960

Query: 943  AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT 1002
            AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT
Sbjct: 961  AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT 1020

Query: 1003 KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1062
            KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW
Sbjct: 1021 KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1080

Query: 1063 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA 1122
            MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA
Sbjct: 1081 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA 1140

Query: 1123 Q 1123
            Q
Sbjct: 1141 Q 1141


>gi|46049125 myosin binding protein C, slow type isoform 2 [Homo
            sapiens]
          Length = 1148

 Score = 2270 bits (5883), Expect = 0.0
 Identities = 1123/1148 (97%), Positives = 1123/1148 (97%), Gaps = 25/1148 (2%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD------------------------- 35
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD                         
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSD 60

Query: 36   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 95
            WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF
Sbjct: 61   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 120

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF
Sbjct: 121  KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 180

Query: 156  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 215
            DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK
Sbjct: 181  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 240

Query: 216  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 275
            NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE
Sbjct: 241  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 300

Query: 276  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
            LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL
Sbjct: 301  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 360

Query: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG
Sbjct: 361  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 420

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
            KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE
Sbjct: 421  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 480

Query: 456  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 515
            ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK
Sbjct: 481  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 540

Query: 516  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 575
            VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT
Sbjct: 541  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 600

Query: 576  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
            ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW
Sbjct: 601  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 660

Query: 636  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
            CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF
Sbjct: 661  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 720

Query: 696  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
            AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE
Sbjct: 721  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 780

Query: 756  YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
            YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI
Sbjct: 781  YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 840

Query: 816  IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD 875
            IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD
Sbjct: 841  IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD 900

Query: 876  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT 935
            TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT
Sbjct: 901  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT 960

Query: 936  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
            PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL
Sbjct: 961  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 1020

Query: 996  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
            SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN
Sbjct: 1021 SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1080

Query: 1056 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
            PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK
Sbjct: 1081 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1140

Query: 1116 LEVKVIAQ 1123
            LEVKVIAQ
Sbjct: 1141 LEVKVIAQ 1148


>gi|45976288 myosin binding protein C, slow type isoform 1 [Homo
            sapiens]
          Length = 1171

 Score = 2268 bits (5877), Expect = 0.0
 Identities = 1122/1148 (97%), Positives = 1122/1148 (97%), Gaps = 25/1148 (2%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD------------------------- 35
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD                         
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSD 60

Query: 36   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 95
            WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF
Sbjct: 61   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 120

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF
Sbjct: 121  KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 180

Query: 156  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 215
            DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK
Sbjct: 181  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 240

Query: 216  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 275
            NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE
Sbjct: 241  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 300

Query: 276  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
            LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL
Sbjct: 301  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 360

Query: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG
Sbjct: 361  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 420

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
            KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE
Sbjct: 421  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 480

Query: 456  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 515
            ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK
Sbjct: 481  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 540

Query: 516  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 575
            VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT
Sbjct: 541  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 600

Query: 576  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
            ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW
Sbjct: 601  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 660

Query: 636  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
            CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF
Sbjct: 661  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 720

Query: 696  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
            AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE
Sbjct: 721  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 780

Query: 756  YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
            YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI
Sbjct: 781  YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 840

Query: 816  IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD 875
            IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD
Sbjct: 841  IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD 900

Query: 876  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT 935
            TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT
Sbjct: 901  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT 960

Query: 936  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
            PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL
Sbjct: 961  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 1020

Query: 996  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
            SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN
Sbjct: 1021 SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1080

Query: 1056 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
            PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK
Sbjct: 1081 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1140

Query: 1116 LEVKVIAQ 1123
            LEVKVI Q
Sbjct: 1141 LEVKVIYQ 1148


>gi|133908641 myosin binding protein C, fast type [Homo sapiens]
          Length = 1141

 Score = 1168 bits (3022), Expect = 0.0
 Identities = 571/1135 (50%), Positives = 782/1135 (68%), Gaps = 44/1135 (3%)

Query: 13   PAPAPPPEEPSKE-KEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKV 71
            P  APP E P++  KEA   P +D    ++P  EE            +F++KP   +V+ 
Sbjct: 22   PKEAPPKEAPAEAPKEA---PPED----QSPTAEEPTG---------VFLKKPDSVSVET 65

Query: 72   GEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
            G+D   +AKV  ++L  KPTIKWFKGKW++L SK+G     KE+    S VYT E+ I K
Sbjct: 66   GKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGK 125

Query: 132  AKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQED-AGELDF 190
                  G YR EV  KD  DSC F+++V           + S FKR+ E + D AGELDF
Sbjct: 126  VVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLES-FKRTSEKKSDTAGELDF 184

Query: 191  SGLLKRREVKQQEEEPQV----------DVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240
            SGLLK+REV ++E++ +           ++WELLK AK SEYEKIAFQYGITDLRGMLKR
Sbjct: 185  SGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKR 244

Query: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300
            LK+ + E KKSAAF K LDPAYQVD+G +++ +VE++DP L +KW+KNGQEI+PS+KY+F
Sbjct: 245  LKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVF 304

Query: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
            E+ G +RIL IN C + DD+ Y V   DEKC TELFV+EPP+++   LED   + G+RVE
Sbjct: 305  ENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVE 364

Query: 361  LECEVSEDDANVKWFKNGEEIIPGP--KSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
            +  EVSE+ A V W K+G E+      K+RYR + +GK+HILI     + D   Y V+T 
Sbjct: 365  MAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITN 424

Query: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
            GGQ  A+L V+ K L++L  + D TV   ++   KCE+S E + GKW KNG+ V+ S R+
Sbjct: 425  GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRI 484

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVID----------PPKIILD 527
             + H GR HKLVI +   EDEGDY F PD Y ++L AK++ ++          PPKI LD
Sbjct: 485  TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544

Query: 528  --GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLV 585
              G  ++N + V+AGNKLRL++ I+GEPPP A W +GD+      GR R E   D S+ V
Sbjct: 545  CSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFV 604

Query: 586  IDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAY 645
            I+ A+R+D G Y I + N  GE  ASI ++VVD PDPP A  +T VG+DW I+ WEPP Y
Sbjct: 605  IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMY 664

Query: 646  DGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKP 705
            DGG P+ GY +ERKKK S RWM+LNF++  ETT+E  KMIEG+ YE+R+FAVNAIG+S+P
Sbjct: 665  DGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP 724

Query: 706  SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
            SM ++PF+P+A TS P  L V+ VTDTT T++WRPP+ IGA G+DGY++EYC EG+E+W+
Sbjct: 725  SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGSEEWV 784

Query: 766  VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
             AN + +++  FT+  LPT A+I  RV  VN AG SEP   +QP+ ++EI EPPKIR+PR
Sbjct: 785  PANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLAQPVTIREIAEPPKIRLPR 844

Query: 826  HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAER 885
            HL+QTYIR+VGE +NLV+PFQGKPRP++ W K GA +D +++++R S+ DT+ F+R+A R
Sbjct: 845  HLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRVHVRTSDFDTVFFVRQAAR 904

Query: 886  SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945
            S SG+Y+L V+++   +TA+I I+++++ GPP  V +++VWG N  + W  PKDDGN+ I
Sbjct: 905  SDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWGTNALVEWQAPKDDGNSEI 964

Query: 946  TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKES 1005
             GY +QKADKK+MEWF V E    TS T+++L++GNEYYFRV++EN+CGLS+   ++K +
Sbjct: 965  MGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRVYTENICGLSDSPGVSKNT 1024

Query: 1006 AVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKN 1065
            A I + G  +K   Y++ DF  AP F  PL++   +AGY+A LNC+VRG+PKPK+ WMKN
Sbjct: 1025 ARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAALNCAVRGHPKPKVVWMKN 1084

Query: 1066 KVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
            K+ I +DP++ + + QGV TL IR+PSP+D GTY C+AVN+LG    ECKLEV+V
Sbjct: 1085 KMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNELGEALAECKLEVRV 1139


>gi|148596957 myosin binding protein C, cardiac [Homo sapiens]
          Length = 1274

 Score = 1150 bits (2974), Expect = 0.0
 Identities = 583/1186 (49%), Positives = 775/1186 (65%), Gaps = 77/1186 (6%)

Query: 3    EPTKKEENEVPAPAP------PPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQN----- 51
            E  K E    PAPAP      P E P+   E G +         +P G   A  N     
Sbjct: 96   EAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGES-------APSPKGSSSAALNGPTPG 148

Query: 52   ANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQ 111
            A      LF+ +PQ G V VG  ITF A+V    LL+ P +KWFKGKW+DL+SK G+HLQ
Sbjct: 149  APDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQ 208

Query: 112  LKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDI 171
            L ++++R S+VY FE+ I  A+  F G+YRCEV+ KDKFD  +F+L VHE+ GT  ++D+
Sbjct: 209  LHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG-DLDL 267

Query: 172  RSAFKRSG---------EGQEDAGELDFSGLLKRREV------KQQEEEPQVDVWELLKN 216
             SAF+R+          +  ED G LDFS LLK+R+        + E   + DVWE+L+ 
Sbjct: 268  LSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQ 327

Query: 217  AKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVEL 276
            A PSEYE+IAFQYG+TDLRGMLKRLK MRR+EKKS AF K L+PAYQV KG ++R  VEL
Sbjct: 328  APPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVEL 387

Query: 277  ADPKLEVKWYKNGQEIRPS-TKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
            AD   EVKW KNGQEI+ S +KYIFE  G +R L I+ C + DD+ Y    G EKCSTEL
Sbjct: 388  ADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTEL 447

Query: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            FV+EPP+++T+ LED     G+RVE ECEVSE+ A VKW K+G E+      +YR + +G
Sbjct: 448  FVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDG 507

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
            ++H LII  A   DA  Y++ T+GGQ+ A+L V  K L++   + D  V    +   KCE
Sbjct: 508  QRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCE 567

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S EN+ G W KNG  +    R+KV H GR+HKL I +    DE DY F P+ +   L A
Sbjct: 568  VSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSA 627

Query: 515  KVHVID----------PPKIILD--GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR- 561
            K+H ++          PPKI LD  G   D T+ V+AGNKLRL++PISG+P P  +W + 
Sbjct: 628  KLHFMEVKIDFVPRQEPPKIHLDCPGRIPD-TIVVVAGNKLRLDVPISGDPAPTVIWQKA 686

Query: 562  -------------------GD--------KAIMEGSGRIRTESYPDSSTLVIDIAERDDS 594
                               GD        K + E  GR+R E+  D S   ++ AE++D 
Sbjct: 687  ITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDE 746

Query: 595  GVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
            GVY + +KN  GE   ++ VKV+D PD P AP ++ VG+D C + WEPPAYDGG PILGY
Sbjct: 747  GVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGY 806

Query: 655  FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVP 714
             +ERKKK+S RWMRLNFDL +E + E ++MIEGV YE+R++AVNAIG+S+PS  S+PF+P
Sbjct: 807  ILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP 866

Query: 715  LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774
            +   S PT L V+ V+DTTV+++WRPP+ +GA GLDGY +EYC EG  +W+ A + L + 
Sbjct: 867  IGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCSEWVAALQGLTEH 926

Query: 775  TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834
            T   +  LPT A++  RV+A N AG   P   ++P+ V+EI++ P++++PRHL+QT  ++
Sbjct: 927  TSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEILQRPRLQLPRHLRQTIQKK 986

Query: 835  VGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894
            VGE VNL+IPFQGKPRP++TW K+G  +   +++IRNS TDTI+FIR A R HSG Y + 
Sbjct: 987  VGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDTILFIRAARRVHSGTYQVT 1046

Query: 895  VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954
            V+++   + A++ +Q++D+P PPQ +++ D WG NVAL W PP+D GN  + GYT+QKAD
Sbjct: 1047 VRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKPPQDVGNTELWGYTVQKAD 1106

Query: 955  KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKI 1014
            KK+MEWFTV+EHY RT   + EL+IGN YYFRVFS+NM G S+ A  TKE   I R G  
Sbjct: 1107 KKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFSDRAATTKEPVFIPRPGIT 1166

Query: 1015 YKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPR 1074
            Y+ P Y+  DFSEAP FTQPLVN   IAGY A L C+VRG+PKPKI+W KN + + +D R
Sbjct: 1167 YEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSPKPKISWFKNGLDLGEDAR 1226

Query: 1075 YRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
            +RMFS QGV TLEIRKP P+DGG Y C+A N  G    EC+LEV+V
Sbjct: 1227 FRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRLEVRV 1272



 Score = 39.3 bits (90), Expect = 0.021
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 6/131 (4%)

Query: 248 EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
           +K  +AF+K    + +V  G    F  E     ++V+W + G +I  S KY    +G + 
Sbjct: 6   KKPVSAFSK-KPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRH 64

Query: 308 ILFINNCQMTDDSEYYVTAGDEKCSTELFV-----REPPIMVTKQLEDTTAYCGERVELE 362
            L +      D   Y V AG  K   +L V      EP +       + T   GE     
Sbjct: 65  TLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPA 124

Query: 363 CEVSEDDANVK 373
            E+ E   + K
Sbjct: 125 AELGESAPSPK 135



 Score = 39.3 bits (90), Expect = 0.021
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 338 REPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKK 397
           ++P    +K+        G     E E       V+W + G +I     ++Y +  EG +
Sbjct: 6   KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDI--SASNKYGLATEGTR 63

Query: 398 HILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLK 434
           H L +     AD   Y+V+      S+K+  DLK ++
Sbjct: 64  HTLTVREVGPADQGSYAVIA----GSSKVKFDLKVIE 96


>gi|55956914 myosin binding protein H [Homo sapiens]
          Length = 477

 Score =  458 bits (1178), Expect = e-128
 Identities = 221/427 (51%), Positives = 293/427 (68%), Gaps = 5/427 (1%)

Query: 696  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
            A  A   +KP+ PS       V S P LLT+D V+ ++VT+ W PP+ +G  GL GYVLE
Sbjct: 54   APTASTATKPAPPSED-----VPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLE 108

Query: 756  YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
             C EG  +W+  +   +  T+ T+  L    K  +RV AV++AGA  P    QPI ++E 
Sbjct: 109  LCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQPIHIREN 168

Query: 816  IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD 875
            IE PKIR+PRHL+QTYIR+VGE VNL IPFQGKP+P+ TW  +G  +D  ++++R  + D
Sbjct: 169  IEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHALDSQRVSMRTGDQD 228

Query: 876  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT 935
            +I+FIR A+RS SG+Y+L V+V+     A IDI +I++PGPP  +++ DVWG N AL WT
Sbjct: 229  SILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWT 288

Query: 936  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
            PP+D GN  + GY +QKADKK+ +WFTV+E YH T+ TI++L+IGN Y FRVFSEN+CGL
Sbjct: 289  PPQDTGNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFRVFSENLCGL 348

Query: 996  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
            S  AT+TKE A I +     K   + + DFSEAP FTQPL +  +  GY+  L CSVR +
Sbjct: 349  STSATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYSTQLFCSVRAS 408

Query: 1056 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
            PKPKI WMKNK+ I  +P+YR  S QGVCTLEIRKPSP+D G Y CKA+N LG   ++C+
Sbjct: 409  PKPKIIWMKNKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAINVLGEASVDCR 468

Query: 1116 LEVKVIA 1122
            LEVK  A
Sbjct: 469  LEVKASA 475



 Score = 89.7 bits (221), Expect = 1e-17
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 3/164 (1%)

Query: 540 GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
           G  + L+IP  G+P P+A W+    A+   S R+   +    S L I  A+R DSG Y +
Sbjct: 189 GETVNLQIPFQGKPKPQATWTHNGHAL--DSQRVSMRTGDQDSILFIRSAQRSDSGRYEL 246

Query: 600 NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
            ++ E  EA A I + V++ P PP +  + +V      + W PP   G + +LGY +++ 
Sbjct: 247 TVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLGYMVQKA 306

Query: 660 KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
            K++ +W  +  +    TT     +I G +Y  R+F+ N  G+S
Sbjct: 307 DKKTGQWFTV-LERYHPTTCTISDLIIGNSYSFRVFSENLCGLS 349



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 24/94 (25%), Positives = 46/94 (48%)

Query: 618 DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET 677
           D P  P+  T+ +V      ++WEPP   G   + GY +E  ++ +S W+ ++      T
Sbjct: 69  DVPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPVSARPMMVT 128

Query: 678 TFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRP 711
               + +  G  + +R+ AV++ G   P+M  +P
Sbjct: 129 QQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQP 162



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 73/314 (23%), Positives = 118/314 (37%), Gaps = 45/314 (14%)

Query: 337 VREPPIMVTKQLEDT-TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
           +  P I V + L  T     GE V L+     +      W  NG  +      R  +R  
Sbjct: 169 IEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHAL---DSQRVSMRTG 225

Query: 395 GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNL----GKEI 450
            +  IL I  A ++D+  Y +        AK  +D+  L I  P    ++ L    G   
Sbjct: 226 DQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDI--LVIEKPGPPSSIRLLDVWGCNA 283

Query: 451 CLKCEISENIPGKWTKNGLPVQESDR--------LKVVHKGR--IHKLVIANALTEDEGD 500
            L+    ++  G     G  VQ++D+        L+  H     I  L+I N+ +     
Sbjct: 284 ALQWTPPQDT-GNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFR--- 339

Query: 501 YVFAPDAYNVTLPA----------KVHVIDPPK--IILDGLDADNTVTVIA------GNK 542
            VF+ +   ++  A          K  +   PK  I  D  +A +    +A      G  
Sbjct: 340 -VFSENLCGLSTSATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYS 398

Query: 543 LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
            +L   +   P PK +W + +K  ++G+ + R  S     TL I      DSGVY     
Sbjct: 399 TQLFCSVRASPKPKIIWMK-NKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAI 457

Query: 603 NEAGEAHASIKVKV 616
           N  GEA    +++V
Sbjct: 458 NVLGEASVDCRLEV 471


>gi|194018539 myosin binding protein H-like [Homo sapiens]
          Length = 354

 Score =  375 bits (963), Expect = e-103
 Identities = 172/322 (53%), Positives = 232/322 (72%), Gaps = 4/322 (1%)

Query: 799  GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 858
            GA  P     P L+  I E PKI +PR L+QTYIR+VG+ VNL+IPFQGKP+P+  W  D
Sbjct: 35   GAGSPT----PQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHD 90

Query: 859  GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 918
            G  +D  ++++RN E D+I+FIR+A+R+ SG+Y L+V++     TA+IDI +I+RPGPPQ
Sbjct: 91   GCALDTRRVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDILVIERPGPPQ 150

Query: 919  IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 978
             +K+ DVWG +  L WTPP+D GN A+ GYT+QKAD KS  WFTV+EHYHRTS  +++L+
Sbjct: 151  SIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLI 210

Query: 979  IGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1038
            IGN Y FRVF+EN CGLSE A +T + A I +   +YK   +   DFSEAP FTQPL + 
Sbjct: 211  IGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADC 270

Query: 1039 YAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGT 1098
              + GYN  L C VR +P+PKI W+KNK+ I  +P+YR  ++ G+C+LEIRKP P+DGG 
Sbjct: 271  TTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGI 330

Query: 1099 YCCKAVNDLGTVEIECKLEVKV 1120
            Y CKAVN LG   ++C+++VKV
Sbjct: 331  YTCKAVNPLGEASVDCRVDVKV 352



 Score = 81.3 bits (199), Expect = 5e-15
 Identities = 48/165 (29%), Positives = 84/165 (50%), Gaps = 3/165 (1%)

Query: 540 GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
           G+ + L IP  G+P P+A+W+    A+   + R+   +    S L I  A+R DSG Y +
Sbjct: 68  GDTVNLLIPFQGKPKPQAIWTHDGCAL--DTRRVSVRNGEQDSILFIREAQRADSGRYQL 125

Query: 600 NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
            ++    EA A+I + V++ P PP +  + +V      + W PP   G + +LGY +++ 
Sbjct: 126 RVQLGGLEATATIDILVIERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKA 185

Query: 660 KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             +S  W  +  +    T+     +I G +Y  R+FA N  G+S+
Sbjct: 186 DTKSGLWFTV-LEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSE 229



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 36/161 (22%), Positives = 56/161 (34%), Gaps = 19/161 (11%)

Query: 720 PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTI 779
           PP  + +  V   + T+ W PP   G   L GY ++     +  W     +   +T   +
Sbjct: 148 PPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTV-LEHYHRTSCIV 206

Query: 780 TGLPTDAKIFVRVKAVNAAGASEPK---------------YYSQPILVKEIIEPPKIRIP 824
           + L        RV A N  G SE                 Y ++    ++  E PK   P
Sbjct: 207 SDLIIGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQP 266

Query: 825 RHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
                T     G    L    +  PRP++ W K+  +I  N
Sbjct: 267 LADCTTV---TGYNTQLFCCVRASPRPKIIWLKNKMDIQGN 304



 Score = 34.7 bits (78), Expect = 0.52
 Identities = 57/260 (21%), Positives = 93/260 (35%), Gaps = 38/260 (14%)

Query: 388 RYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLG 447
           R  +R   +  IL I  A +AD+  Y +    G   A  ++D+  L I  P   Q++ L 
Sbjct: 98  RVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDI--LVIERPGPPQSIKLV 155

Query: 448 KEICLKCEISENIP---GKWTKNGLPVQESDR--------LKVVHKGR--IHKLVIANA- 493
                   +    P   G     G  VQ++D         L+  H+    +  L+I N+ 
Sbjct: 156 DVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSY 215

Query: 494 -----------------LTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                            +T D      A   Y     A+    + PK      D     T
Sbjct: 216 AFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADC----T 271

Query: 537 VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
            + G   +L   +   P PK +W + +K  ++G+ + R  ++    +L I      D G+
Sbjct: 272 TVTGYNTQLFCCVRASPRPKIIWLK-NKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGI 330

Query: 597 YHINLKNEAGEAHASIKVKV 616
           Y     N  GEA    +V V
Sbjct: 331 YTCKAVNPLGEASVDCRVDV 350


>gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]
          Length = 1326

 Score =  303 bits (777), Expect = 5e-82
 Identities = 246/888 (27%), Positives = 381/888 (42%), Gaps = 46/888 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +  R     EL    + ++W K+GQ +   TKY   H+G +  L I + Q++D  EY
Sbjct: 429  RVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488

Query: 323  YVTAGDEKCSTELF------VREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFK 376
             V A  +   TE +      V E    V   + D  A  G   EL   ++++     W K
Sbjct: 489  TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLK 548

Query: 377  NGEEI--IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL- 433
            +G+EI  +PG     +I  +G  H LI          +Y+    G +S A + +   P  
Sbjct: 549  DGKEITDLPG----MQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTI 604

Query: 434  --KILTPLTDQ--TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHK 487
               +L  L     TV +G    +K         K  W K+G+ V E +R+ +        
Sbjct: 605  DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQAL 664

Query: 488  LVIANALTEDEGDYVFA--PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
            L I+N + ED G  +     D  + T    + V+D PK     ++           K + 
Sbjct: 665  LTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKA 724

Query: 546  EIPISGEPPPKAMWSR---GDKA---IMEGSGRIR---TESYPDSSTLVIDIAERDDSGV 596
                 G P  + +  R   G K+   I E  G++    T    +       I   +  GV
Sbjct: 725  PKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGV 784

Query: 597  YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
                  ++  E         ++ P     P VT+V  +   + W  P  DGG+P+LGY +
Sbjct: 785  ------SDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838

Query: 657  ERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLA 716
            ER+KK S+ W+ +N D  + T      ++E   YE R+ AVN  G  +PS+PS   V   
Sbjct: 839  ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898

Query: 717  VTSPPTL---LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLID 773
               PP L   L V   +++++++ WR P         GY+LE   E T++W    K  I 
Sbjct: 899  PVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDTKEWSKCTKIPIS 956

Query: 774  KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 833
             T +T+ GL    K F R++AVN AG  EP    + +        PK  +   LK   + 
Sbjct: 957  GTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPPPAAPKFDLSARLKSHMVV 1016

Query: 834  RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDL 893
            R G A+ +   F G P P++ W+KDG    K +  I  S+  +   I   +RS SG Y +
Sbjct: 1017 RAGTALCIHAAFSGSPPPDVIWQKDGVP-TKGRETITKSKNHSQFLINSTKRSDSGVYRI 1075

Query: 894  QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 953
             ++ +       I +++ D P PP  +++ +     V LTW    D        Y I K 
Sbjct: 1076 LLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWNHSPDVQEDGEAHYIIMKR 1135

Query: 954  DKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD-- 1011
            D  +  W+T  E       T+T L+ G +YYFRV + N  G SE    ++++ +I +D  
Sbjct: 1136 DASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGDSEPLD-SRDTWLINKDQI 1194

Query: 1012 -GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
                 K   YE  D+  AP F  PL     + G + T+ C+  GNP+P +T  K  V I 
Sbjct: 1195 QDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAFLGNPRPTVTLYKGDVNIT 1254

Query: 1071 DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             + ++   S  GVCTL I   +  D G Y     N+LG     C L V
Sbjct: 1255 ANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRSSCTLTV 1302



 Score =  261 bits (666), Expect = 3e-69
 Identities = 229/923 (24%), Positives = 389/923 (42%), Gaps = 132/923 (14%)

Query: 20  EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSIL-----------------FIE 62
           E  S E  + TT  + ++      GEE  ++ ++S +                    F+E
Sbjct: 12  EHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGDSVPEFVE 71

Query: 63  KPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAG--------KHLQLKE 114
           KPQ  T   G+   F A+V+      KP I W +   + +   A         +H+   E
Sbjct: 72  KPQPVTAPEGDKAVFRARVQGN---AKPHISWKRESGIPIKESAKIFYDSINKEHVLKLE 128

Query: 115 TF--------------ERHSRVYTFEMQIIKAKDNFAGNY----RCEVTYKDKFDSCSFD 156
                           +    +YT  + + + ++          R     K K    + +
Sbjct: 129 PLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANE 188

Query: 157 LEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKN 216
            E+ E     P  D             + G  DF GLL  R++K+ +++ +V+   +LK 
Sbjct: 189 KEMLEILSKVPKKDFEKVCM-------EYGFTDFRGLL--RKLKEMKKKVEVEAIRILKP 239

Query: 217 AKPSEYE-----------------------------KIAFQYGITDLRGMLKR------- 240
            +  E +                             +I +  G  D++ M  +       
Sbjct: 240 LEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISN 299

Query: 241 -------LKRMRREEKKSAAFAKILDPAYQ---------VDKGGRVRFVVELADPKLEVK 284
                  +  +   +K+ +A   +LD   +         V +     F + L+  +    
Sbjct: 300 VNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFV 359

Query: 285 WYKNGQEIRPSTKY--IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
           W  NG+E++   KY       G    L I + +++D  E+   AG+     +L +   PI
Sbjct: 360 WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPI 419

Query: 343 MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                L++       R  LECE++  D  ++W K+G+ ++ G K  Y +  EGK+  LII
Sbjct: 420 KFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTK--YSMNHEGKRAELII 477

Query: 403 EGATKADAAEYSVMT------TGGQSSAKLSVDLKPLKILTPLTDQTVNLGK--EICLKC 454
           E A  +D  EY+V+       T   S+A ++V+ +   + + ++D     G   E+C+  
Sbjct: 478 EDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVL 537

Query: 455 EISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
              E + G W K+G  + +   +++V +G +HKL+  +   E EG Y F   A      A
Sbjct: 538 N-DEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFR--AKGTESEA 594

Query: 515 KVHVIDPPKI---ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
            V + DPP I   +L+ L A + +TV  G+   +++P  G+P PK  W +    + E   
Sbjct: 595 SVFIADPPTIDPSVLEALAA-HAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEE- 652

Query: 572 RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTE 630
           R+  E   D + L I    R+DSG+  + LKN+ G A A++ + V+D P PP       E
Sbjct: 653 RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLE 712

Query: 631 VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAY 690
           +      M W+ P  +GG P+  + +ER+      W+++     K T F   K+ EG AY
Sbjct: 713 LSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAY 772

Query: 691 EVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAA 747
           + RI AVN+ G+S P      F    +  PP   +   VTD T   VT+ W  P   G A
Sbjct: 773 QFRILAVNSEGVSDPLETEEVFAGNPI-EPPGFASQPQVTDVTKEAVTITWNAPTQDGGA 831

Query: 748 GLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 807
            + GY++E   +G+  W+  NKD I  TK T+ GL  D +   RV AVN AG  +P   S
Sbjct: 832 PVLGYIVERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPS 891

Query: 808 QPILVKEIIEPPKIRIPRHLKQT 830
             ++ K+ ++PP +    H+  +
Sbjct: 892 SSVVAKDPVKPPGLVQDLHVSDS 914



 Score = 41.6 bits (96), Expect = 0.004
 Identities = 29/95 (30%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 536  TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSG 595
            TV+ G    +     G P P     +GD  I   S +    S     TLVI      DSG
Sbjct: 1223 TVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS-KFWYNSTSGVCTLVIPTCTLKDSG 1281

Query: 596  VYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             Y + ++NE G+  +S  + V D  D  V  ++TE
Sbjct: 1282 DYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316



 Score = 30.8 bits (68), Expect = 7.5
 Identities = 27/124 (21%), Positives = 48/124 (38%), Gaps = 3/124 (2%)

Query: 984  YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1043
            + + FS+    + E+    K S+++     + ++      D    P F +      A  G
Sbjct: 24   HVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGD--SVPEFVEKPQPVTAPEG 81

Query: 1044 YNATLNCSVRGNPKPKITWMKNK-VAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1102
              A     V+GN KP I+W +   + I +  +    S      L++   +  D   Y C 
Sbjct: 82   DKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNYKCI 141

Query: 1103 AVND 1106
            A ND
Sbjct: 142  ASND 145


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  299 bits (766), Expect = 9e-81
 Identities = 218/756 (28%), Positives = 346/756 (45%), Gaps = 52/756 (6%)

Query: 272   FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
             F  +L+  K  VKWY+NG+EI+   KY FE  G    L I +C++ D+ EY     D K 
Sbjct: 12842 FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS 12901

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
                LFV E P+ + +  +D     G  V    E+++D   V+W +N   ++ G K  +++
Sbjct: 12902 RARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDK--HQM 12959

Query: 392   RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
               EGK H L I      D  EY  +    ++ AKL +   P KI T   D  V++GK + 
Sbjct: 12960 MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVGKPLT 13018

Query: 452   LKC--EISENIPGKWTKNGLPV----------QESDRL---KVVHKGRIHKLVIANALTE 496
             +    +       +W K   P+          Q S R+   K   KGR +K+V+ N   +
Sbjct: 13019 MVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGR-YKIVLQNKHGK 13077

Query: 497   DEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
              EG                + VID P  + +    + T T      L  E P++      
Sbjct: 13078 AEGFI-------------NLKVIDVPGPVRN---LEVTETFDGEVSLAWEEPLTDGGSKI 13121

Query: 557   AMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHAS 611
               +    + I   +  + T+        V  + +     ++ ++ +N  G     E    
Sbjct: 13122 IGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNP 13181

Query: 612   IKVKV-VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLN 670
             ++ +   D P PP+  T+T+V      + WEPP YDGG+ I  Y IE + K S RW    
Sbjct: 13182 VEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 13241

Query: 671   FDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTSPPTLLTV 726
                 ++ +     ++EG  Y  R+ A N IG+ KPS  + PFV    P+   SPP  LT 
Sbjct: 13242 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLTS 13300

Query: 727   DSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDA 786
                T ++V ++W PP   G + + GY++E C EG ++WI  N  L+ +  + +TGL    
Sbjct: 13301 SDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGN 13360

Query: 787   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 846
             K   RV A N AG S+P     P+   +    P + +    K      V   + +++P  
Sbjct: 13361 KYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSA-FKDGLEVIVPNPITILVPST 13419

Query: 847   GKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 905
             G PRP  TW      ++  +++ ++       + I  +ERS  G Y L  K++  V+T S
Sbjct: 13420 GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTL--KLENRVKTIS 13477

Query: 906   --IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 963
               ID+ +I RP  P+ +K  D+  ++V LTW PP DDG + +TGY ++K +     W  V
Sbjct: 13478 GEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV 13537

Query: 964   IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 999
             ++       T+ +LV G EY F+V + N CG  E A
Sbjct: 13538 MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 13573



 Score =  288 bits (737), Expect = 2e-77
 Identities = 165/503 (32%), Positives = 269/503 (53%), Gaps = 17/503 (3%)

Query: 511   TLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             TLP  V     I+PP+I LD  D    V + A   LRL + I G P P+  W + +  + 
Sbjct: 25091 TLPGSVVAQERIEPPEIELDA-DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 25149

Query: 568   EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
             +   R + E     + LVID   R DSG Y++ L+N +G   A + V+V+D P  PV  T
Sbjct: 25150 D---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLT 25206

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             + EV  D   ++WEPP  DGG+ I  Y +E+++     +  +  + C +TTF  + + EG
Sbjct: 25207 IREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEG 25265

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
              +Y  R+ A N  GI  P+  + P        PP  +T+  VT  T T++W  P+  G +
Sbjct: 25266 CSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGS 25325

Query: 748   GLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 807
              + GYV+E   +G+E W    +  +   + TI+GL    +   RV AVN  G S+P+   
Sbjct: 25326 KITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG 25383

Query: 808   QPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQ 866
              P++ ++I   P + +P H   T+  +  E + + +PF+G+P+  + W+KDG  + +  +
Sbjct: 25384 VPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTR 25440

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
             +N+ +S+T T + I++A +   G Y+L V       T  I I ++DRPGPP  ++I++V 
Sbjct: 25441 VNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVS 25500

Query: 927   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFR 986
              +++ ++W PP+ DG   I+ Y ++K +  S  W  V +   RTS  I  L  G+EY FR
Sbjct: 25501 CDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFR 25560

Query: 987   VFSENMCGLSEDATMTKESAVIA 1009
             V +EN  G S   + ++ SAV+A
Sbjct: 25561 VCAENRYGKS---SYSESSAVVA 25580



 Score =  276 bits (707), Expect = 6e-74
 Identities = 176/570 (30%), Positives = 286/570 (50%), Gaps = 35/570 (6%)

Query: 438   PLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQ------ESDRLKVVHKGRIHKLVIA 491
             P+ D    +   I  KC++S    G+WT    P        E ++L   H+       I 
Sbjct: 22861 PIYDGGCEIQGYIVEKCDVSV---GEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAIN 22917

Query: 492   NALTEDEGDYVFAPDAYNVTLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIP 548
              A   +  D           +P  + V   ++ P I LD L+    + + AG  LRL +P
Sbjct: 22918 KAGVGEHAD-----------VPGPIIVEEKLEAPDIDLD-LELRKIINIRAGGSLRLFVP 22965

Query: 549   ISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEA 608
             I G P P+  W + D  I + +    T S+   ++LV+D   R DSG Y + L+N +G  
Sbjct: 22966 IKGRPTPEVKWGKVDGEIRDAAIIDVTSSF---TSLVLDNVNRYDSGKYTLTLENSSGTK 23022

Query: 609   HASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
              A + V+V+D P PPV   VTE+  D   + WEPP  DGGS I  Y +E+++     +  
Sbjct: 23023 SAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAA 23082

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             +  + C + +++  ++ EG +Y  R+ A N  GI  P+  + P     V  PP  +TVD 
Sbjct: 23083 VVTN-CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDD 23141

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKI 788
             VT  +V++ W  P+H G + +  Y++E   + +E W    +  +   +  IT L    + 
Sbjct: 23142 VTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEY 23199

Query: 789   FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 848
               RV AVN  G S+P+  + PI+ K+++  P +   +    +Y  +VG+ + + +P  G+
Sbjct: 23200 LFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV---KPAFSSYSVQVGQDLKIEVPISGR 23256

Query: 849   PRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASID 907
             P+P +TW KDG  + +  +IN+ +S   T + I++  +   G+Y + V      +TASI+
Sbjct: 23257 PKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIE 23316

Query: 908   IQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 966
             I  +D+P PP+  VK +DV  E++ L+W PP   G   IT Y +QK D  +  W  V   
Sbjct: 23317 IVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT 23376

Query: 967   YHRTSATITELVIGNEYYFRVFSENMCGLS 996
               RT+  +T+L  G EY FR+F+EN  G S
Sbjct: 23377 VARTTLKVTKLKTGTEYQFRIFAENRYGQS 23406



 Score =  272 bits (695), Expect = 1e-72
 Identities = 159/562 (28%), Positives = 280/562 (49%), Gaps = 19/562 (3%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++ P++ LD  +    + V AG   R+ IP  G P P+  WSR +    E + +++ E  
Sbjct: 24019 LEAPELDLDS-ELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEG---EFTDKVQIEKG 24074

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
              + + L ID  +R+D+G Y + L+N +G   A + VKV+D P PP    V EV  D   +
Sbjct: 24075 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFL 24134

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              WEPP  DGG+ +  Y I++++     +  ++   C +T+F+ + + EG  Y  R+ A N
Sbjct: 24135 VWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKTSFKVENLTEGAIYYFRVMAEN 24193

Query: 699   AIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
               G+  P             SPP  +T+  V+ T+ ++ W  P+H G + + GYV+E   
Sbjct: 24194 EFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 24253

Query: 759   EGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEP 818
             +GTE W +  +  +      +TGL +  +   RVKA N  G S+P+    P++ K++   
Sbjct: 24254 KGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQ 24311

Query: 819   PKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTI 877
             P +++P +   TY  + GE + + IP  G+PRP ++W KDG  + +  ++N+  + T T+
Sbjct: 24312 PSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTV 24368

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENVALTWTP 936
             + I++  +   GKY +         T ++ + ++++PGPP   V+ ++V  + V ++W P
Sbjct: 24369 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEP 24428

Query: 937   PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 996
             P   G   I+ Y ++K D  +  W  V     RT+  IT+L  G EY FR+F+EN  G S
Sbjct: 24429 PAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKS 24488

Query: 997   EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT--LNCSVRG 1054
               A +  ++ ++      +K P      F  +    Q LV  +       T  +   +  
Sbjct: 24489 --APLDSKAVIVQYP---FKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQ 24543

Query: 1055  NPKPKITWMKNKVAIVDDPRYR 1076
               K  I W+K     + D +++
Sbjct: 24544 KEKNSILWVKLNKTPIQDTKFK 24565



 Score =  258 bits (658), Expect = 3e-68
 Identities = 148/478 (30%), Positives = 252/478 (52%), Gaps = 12/478 (2%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PP+I LD  D    VT+ A   LRL +PI G P P+  W+R     ++ +    T SY  
Sbjct: 21857 PPEIELDA-DLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSY-- 21913

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              + L++    R DSG Y + ++N +G   A + V+V+D P PP    V EV      + W
Sbjct: 21914 -TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTW 21972

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGGS I  Y +E+++     +  +  + C +T+++  ++ EG +Y  R+ A N  
Sbjct: 21973 DPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENEY 22031

Query: 701   GISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
             GI  P+  +          PP  +T+  VT  +V++ W  P+H G + + GY++E   +G
Sbjct: 22032 GIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKG 22091

Query: 761   TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             ++ W  A    +  T+ TITGL    +   RV A N  G S+P+  S P++ K+++ PP 
Sbjct: 22092 SDKW--ATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPA 22149

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIF 879
              ++   L  T+    GE + + +PF G+P P +TW KD   + +  ++N  ++E ++++ 
Sbjct: 22150 FKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLT 22206

Query: 880   IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPK 938
             I+ A R   G Y +++         ++++ ++D+PGPP   VK+++V  +++ L+W PPK
Sbjct: 22207 IKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPK 22266

Query: 939   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 996
              DG ++I  Y ++K D  +  W  V     RT+     L  G EY FR+ +EN  G S
Sbjct: 22267 YDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKS 22324



 Score =  255 bits (651), Expect = 2e-67
 Identities = 157/482 (32%), Positives = 251/482 (52%), Gaps = 13/482 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P + LD    D  V V AG  +R+   +SG+PPP   W+  ++ + + +     E+   S
Sbjct: 16522 PDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAIS 16577

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-VGDDWCIMNW 640
             S++VI   +R   GVY +  KNEAGE   +I V V+D P P   P +   + ++ C + W
Sbjct: 16578 SSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTW 16637

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGGSPI  Y IE+++     W  + + + ++     + +I+G AY  RI A N+I
Sbjct: 16638 FSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSI 16696

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+      S   V   P+ V   P  L V  VT  TVT+ W PP + G + +  YVLE  
Sbjct: 16697 GMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESR 16756

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
               GTE +     D +   K+T+ GL        RV AVN  G  +P + ++PI  K+ + 
Sbjct: 16757 LIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA 16816

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDT 876
             PP + +    K T   RVGEA  L   + GKP+P+++W KD A++ + ++ +I+ +    
Sbjct: 16817 PPTLHLDFRDKLTI--RVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 16874

Query: 877   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENVALTWT 935
              +   KA+RS SGKY + V+           + ++DRPGPP   V  ++V  + + ++W 
Sbjct: 16875 ALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWK 16934

Query: 936   PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             PP DDG + IT Y I+K +     W  V     +T+  +++L+ G +Y FR+ +EN+ G+
Sbjct: 16935 PPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGI 16994

Query: 996   SE 997
             S+
Sbjct: 16995 SD 16996



 Score =  255 bits (651), Expect = 2e-67
 Identities = 143/470 (30%), Positives = 242/470 (51%), Gaps = 16/470 (3%)

Query: 534   TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSS----TLVIDIA 589
             T+ V AG    + +P  G P P  +WS+ D  +       RT +Y D++    +L I+ A
Sbjct: 26195 TLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-------RTRAYVDTTDSRTSLTIENA 26247

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R+DSG Y + ++N    A  ++ VKV+D P PP   TV +V  +  +++W+ P  DGG+
Sbjct: 26248 NRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGA 26307

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y IE+++     W+ +  + C   +++   + EG  Y  R+   N  G+  P+   
Sbjct: 26308 PVKNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETK 26366

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANK 769
                      SPP  L V S++  +V++ W  P+H G + +  YV+E   +G ++W+    
Sbjct: 26367 EGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC-- 26424

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 829
              +   T   ++GL  +++ F RV A N AG S+P+    P+L+KE +EPP+I +      
Sbjct: 26425 AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSH 26484

Query: 830   TYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHS 888
             T   R G  + + IP  GKP P++T  +DG  +    + N   +  +  I ++++  + +
Sbjct: 26485 TVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADA 26544

Query: 889   GKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITG 947
             G+Y++          A I+I ++DRPGPP   V I D+  E+V L W PPK DG + +T 
Sbjct: 26545 GRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTN 26604

Query: 948   YTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             Y + K +  +  W  V     RT   + +L  G EY FR+ +EN  G+S+
Sbjct: 26605 YILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISD 26654



 Score =  252 bits (644), Expect = 1e-66
 Identities = 152/470 (32%), Positives = 240/470 (51%), Gaps = 10/470 (2%)

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             D   TVT+ AG  LRL + +SG PPP   WS+    +   +    TESY   S L++D  
Sbjct: 29451 DLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY---SLLIVDKV 29507

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R D+G Y I  +N++G+  A++ VKV D P P  +  V EV  D   + WE P  DGG+
Sbjct: 29508 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 29567

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y +E K++ + R  +     C +T +    ++EG  Y  R+   N  GI +P   S
Sbjct: 29568 PVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETS 29626

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDW--IVA 767
                +   V   P  L V  VT +TVT+ W  P + G + L GYVLE C  GTE W  +V 
Sbjct: 29627 DAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVT 29686

Query: 768   NKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHL 827
              K  +   + T+T L    +   R++A N  G SEP+     + V+++   P I +    
Sbjct: 29687 LKPTV--LEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMP 29744

Query: 828   KQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERS 886
             ++T     G  V LVIP  G+P P  +W   G+++ +  ++ +        + IR+    
Sbjct: 29745 QKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIR 29804

Query: 887   HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAI 945
              +G+Y L++K      + +I + I+D+PGPP   +KI+++   ++ ++W PP+ DG A +
Sbjct: 29805 DTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPL 29864

Query: 946   TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             +GY +++ D     W  V E   R++   T L  GNEY FRV + N  G+
Sbjct: 29865 SGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGI 29914



 Score =  249 bits (636), Expect = 1e-65
 Identities = 151/508 (29%), Positives = 245/508 (48%), Gaps = 22/508 (4%)

Query: 508   YNVTLPAKVHVIDPPKIILDGLDADNT--------------VTVIAGNKLRLEIPISGEP 553
             Y V+   K  V DP +I L  L AD+               + VI  N + + +P +G P
Sbjct: 13364 YRVSAENKAGVSDPSEI-LGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYP 13422

Query: 554   PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
              P A W  GDK ++E   R++ ++    + LVI  +ER D G+Y + L+N        I 
Sbjct: 13423 RPTATWCFGDK-VLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEID 13481

Query: 614   VKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL 673
             V V+  P  P      ++  D   + WEPP  DGGSP+ GY +E+++     W ++  D 
Sbjct: 13482 VNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDF 13540

Query: 674   CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPF---VPLAVTSPPTLLTVDSVT 730
               +  F    +++G  Y  ++ A N  G  +P+    P     P  V  PP  +     T
Sbjct: 13541 VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRT 13600

Query: 731   DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFV 790
               ++ + W PP + G + + GY++E C  G++ W+   +  + +TK  +TGL        
Sbjct: 13601 ANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEP-VAETKMEVTGLEEGKWYAY 13659

Query: 791   RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPR 850
             RVKA+N  GAS+P   ++ I   +  E P+I +   L      + G  + L     GKP 
Sbjct: 13660 RVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPE 13719

Query: 851   PELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQ 909
             P++TW K    + ++ +I I N    + + I  ++RS +G Y ++        TA +++ 
Sbjct: 13720 PKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVN 13779

Query: 910   IIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 969
             ++D+PGPP    I DV  E+  LTW PP+DDG + IT Y +++    S  W  +      
Sbjct: 13780 VLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKD 13839

Query: 970   TSATITELVIGNEYYFRVFSENMCGLSE 997
             T+   T+L+   EY FRV +ENM G+ E
Sbjct: 13840 TNFKATKLIPNKEYIFRVAAENMYGVGE 13867



 Score =  247 bits (631), Expect = 4e-65
 Identities = 170/584 (29%), Positives = 278/584 (47%), Gaps = 33/584 (5%)

Query: 436   LTPLTDQTVNL--GKEICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIA 491
             L+ +  +T+++  G+ + L   I+   P    W   G  ++ES+R+ V    ++ KL I 
Sbjct: 29740 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIR 29799

Query: 492   NALTEDEGDYVFAPDAYNVTLPA----KVHVIDPP-----KIILDGLDADNTVTVIAGNK 542
                  D G+Y    +  NVT       KV ++D P      I +D +DA +        +
Sbjct: 29800 ETTIRDTGEYTL--ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPE 29857

Query: 543   LRLEIPISG-----EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
             L    P+SG         +  W    +++   + +    +  +     +    R   G Y
Sbjct: 29858 LDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 29917

Query: 598   HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
                L++E  E  +SI++     P PP    + +V  D   + W PP  DGGS + GY +E
Sbjct: 29918 ---LQSEVIECRSSIRI-----PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVE 29969

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK+ ++ RW+R+N      T +    + EG+ YE R+ A+NA G  KPS PS+P V +  
Sbjct: 29970 RKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDP 30029

Query: 718   TSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774
              +PP       VTDTT   V++ W  P+  G + + GY++E       +W   N      
Sbjct: 30030 IAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKI 30089

Query: 775   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834
              ++T+T LP  A+   RV A NA G  EP      + V E++E P   +    ++    R
Sbjct: 30090 REYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVR 30149

Query: 835   VGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894
              G  + L IP +GKP P   W K+G +I K  + I  SET T + I++A+R  SG YDL 
Sbjct: 30150 QGGVIRLTIPIKGKPFPICKWTKEGQDISKRAM-IATSETHTELVIKEADRGDSGTYDLV 30208

Query: 895   VKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 953
             ++     +   I +++I  P  P+  ++ +D+   +V ++W PP DDG A I GY +++ 
Sbjct: 30209 LENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERR 30268

Query: 954   DKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             +     W+T+      TS  +  L    EY+FRV +EN  G+S+
Sbjct: 30269 EVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISK 30312



 Score =  245 bits (626), Expect = 1e-64
 Identities = 153/493 (31%), Positives = 238/493 (48%), Gaps = 17/493 (3%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG--DKAIMEGSGRIRT 575
             +++PP+I LD       V V AG  +RL   + G P PK  W +   D  + +G    + 
Sbjct: 18600 ILEPPEIDLDA-SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG----QV 18654

Query: 576   ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
             +     + LVI  + RDDSG Y + L N AGE    + V+V+D P P     V++V    
Sbjct: 18655 DLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTS 18714

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++W PP  DGGS +  Y +E+++     W  +  ++ K+T+F    ++ G  Y  R+ 
Sbjct: 18715 CHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNLVPGNEYYFRVT 18773

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             AVN  G   P+   +P +   PL+   PP  L V  +T  + T+ W PP   G A +DGY
Sbjct: 18774 AVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 18833

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
             +  Y  E           ++      +TGL    K   RV A NA G S P+        
Sbjct: 18834 ITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEA 18893

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE-IDKNQINIRN 871
             KE + PPKI +P  +      + G+ + +     GKP P   WKK   E +  + + +  
Sbjct: 18894 KEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHK 18949

Query: 872   SETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENV 930
             +++ +I+ I+   R  SG Y L  +     +T  I + ++D PGPPQ    I D+  +  
Sbjct: 18950 ADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC 19009

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 990
             +L+W  P +DG + IT Y ++K D    +W T +    +TS  + +L+ G EY FRV +E
Sbjct: 19010 SLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAE 19069

Query: 991   NMCGLSEDATMTK 1003
             N  G+SE  T  K
Sbjct: 19070 NRFGISEPLTSPK 19082



 Score =  243 bits (621), Expect = 6e-64
 Identities = 152/515 (29%), Positives = 259/515 (50%), Gaps = 25/515 (4%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP+  LD  D   T+ + AG  +RL +P+ G PPPK  WS+ +  + +  G +  +S
Sbjct: 19687 ILIPPEGELDA-DLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIG-LDIKS 19744

Query: 578   YPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCI 637
                 + L  +   + D+G Y + L+N  G+   +I VKV+D P PPV  TV E+  D   
Sbjct: 19745 TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAY 19804

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + WEPP  DGGSPI+ Y ++++  +   W  +  + C +T+F    + EG +Y  R+FA 
Sbjct: 19805 VTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAE 19863

Query: 698   NAIGISKPSMPSRPFVPLAVTSPPTL-LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             N  GI  P   +R  V  + T  P + L V SV+ ++ ++ W+ P   G + + GYV+++
Sbjct: 19864 NEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 19922

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
               E  + W    K L    +++   L    +   RV A N  G   P   +  ++ ++ +
Sbjct: 19923 LTEENK-WQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDV 19977

Query: 817   EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-DGAEIDKNQINIRNSETD 875
               P + +       Y+ +      L IP +GKP P ++WKK +       ++++ +S  +
Sbjct: 19978 VAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVN 20037

Query: 876   TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-PPQIVKIEDVWGENVALTW 934
             T + +   ++S +GKY + +K     +  +I I+++ +PG P   +K ++V  E + L W
Sbjct: 20038 TTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKW 20097

Query: 935   TPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
              PPKDDG + IT Y ++K D  + +W T      +T+  +T L  G EY FRV +EN  G
Sbjct: 20098 APPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYG 20157

Query: 995   LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1029
             + E     K   ++AR            FD  +AP
Sbjct: 20158 VGEG---LKSEPIVAR----------HPFDVPDAP 20179



 Score =  243 bits (620), Expect = 7e-64
 Identities = 202/709 (28%), Positives = 322/709 (45%), Gaps = 69/709 (9%)

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKW----FKNGEEIIP---- 383
             S  L +REP I V ++ ED        +E++ EV+++   + W    +  G EII     
Sbjct: 16705 SEALVIREP-ITVPERPED--------LEVK-EVTKNTVTLTWNPPKYDGGSEIINYVLE 16754

Query: 384   ----GPKSRYRIRVEGK-KHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTP 438
                 G +  +++  +        ++G  + D  EY V         K S   KP+     
Sbjct: 16755 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 16814

Query: 439   LTDQTVNLGKEICLKCEISE------NIPGK------WTKNGLPVQESDRLKVVHKGRIH 486
             L   T++L     L   + E         GK      W K+   V E DR  +       
Sbjct: 16815 LAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 16874

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVIDPPKIILDGLDADNTVTVIAGNK 542
              L    A   D G Y    +  N T   K    V+V+D P   +  +  D          
Sbjct: 16875 ALEKIKAKRSDSGKYCVVVE--NSTGSRKGFCQVNVVDRPGPPVGPVSFDEVT------- 16925

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR------TESYPDSSTLVIDIAERDDSGV 596
              +  + IS +PP     S+    I+E     +      T +   ++  V  + E  D  +
Sbjct: 16926 -KDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY-I 16983

Query: 597   YHINLKNEAG--EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 651
             + I+ +N  G  +   S  +K  D    PD P  P VTEV  D  ++ W  P +DGG PI
Sbjct: 16984 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPI 17042

Query: 652   LGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
               Y +E+++  S RW R+  D +   T F    ++EG  YE R+ A N IGI  PS PS+
Sbjct: 17043 TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK 17102

Query: 711   PFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVA 767
             P     P+A  SPP        T  +V + W+PP H G + + GY++EY   G E+W  A
Sbjct: 17103 PVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRA 17162

Query: 768   NK--DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
             N   +   +TK+ +TGL        RV AVNAAG S+P +  +P+LVK+ +EPP++ +  
Sbjct: 17163 NHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDA 17222

Query: 826   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAER 885
             ++ +    +VG+ + L    +G P P++TWKK+  +    +  I  +   + + IR A  
Sbjct: 17223 NMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAP-TKARIDVTPVGSKLEIRNAAH 17281

Query: 886   SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945
                G Y L V+     +T S+ + ++D+PGPP+ +++ ++  ++  LTW  P DDG + I
Sbjct: 17282 EDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVI 17341

Query: 946   TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
             T Y +++ D  S +W  +     + S     L  GN+Y FRV +EN  G
Sbjct: 17342 TNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYG 17390



 Score =  243 bits (620), Expect = 7e-64
 Identities = 166/560 (29%), Positives = 272/560 (48%), Gaps = 26/560 (4%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH--VIDP 521
             W K+G+ ++E  R +++       L + + +  D G YV        T    V+  V+D 
Sbjct: 25823 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 25882

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + ++GL A+         +      I      K   S     I EG  ++   
Sbjct: 25883 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQM--- 25939

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEV 631
                 +S  V  + + ++  ++ +   N+   GE   S+ +K +D    P PP +  +T V
Sbjct: 25940 ----TSCKVTKLLKGNEY-IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSV 25994

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               +   + W  P  DGGS I GY IER++K S RW+R+N     +   +   + EG  YE
Sbjct: 25995 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 26054

Query: 692   VRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAG 748
              R++A NA G+S PS  S   R   P+ + SPP+   +     TT+T+ W  P   G A 
Sbjct: 26055 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 26114

Query: 749   LDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 808
             + GY +EY      DW  + + L   T++TI+GL T A+   RVK+VN  GAS+P   S 
Sbjct: 26115 ITGYTVEYKKSDDTDWKTSIQSLRG-TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 26173

Query: 809   PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN 868
             P + KE  E P   I   +++T I + G +  + +PF+G+P P + W K   ++ + +  
Sbjct: 26174 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-RTRAY 26232

Query: 869   IRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGE 928
             +  +++ T + I  A R+ SGKY L ++      + ++ ++++D PGPP  + ++DV  E
Sbjct: 26233 VDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKE 26292

Query: 929   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 988
             +  L+W  P++DG A +  Y I+K +     W +V  + +R S  +T L  G  YYFRV 
Sbjct: 26293 SAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVS 26352

Query: 989   SENMCGLSEDATMTKESAVI 1008
              EN  G+   A  TKE   I
Sbjct: 26353 GENEFGVGIPAE-TKEGVKI 26371



 Score =  241 bits (614), Expect = 4e-63
 Identities = 135/381 (35%), Positives = 198/381 (51%), Gaps = 3/381 (0%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT V  D   ++W  P  DGGSPILGY +ERK++    W  ++  L     F
Sbjct: 21259 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIF 21318

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   + +G+AYE R+ A N  G SKPS PS P + L    PP      ++T  TVT++W 
Sbjct: 21319 KSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWA 21378

Query: 740   PPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 799
              P++ G   +  Y++E        W+ AN   I + +FT++GL  DA    RV A NAAG
Sbjct: 21379 KPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAG 21438

Query: 800   A-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 858
             A S P   S  I  ++ +E PKI++    K T I + GEA  L     G+P P + W KD
Sbjct: 21439 AISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKD 21498

Query: 859   GAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
             G E++   ++ I+ ++  T +  + + R  SG Y L             +++++DRPGPP
Sbjct: 21499 GKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPP 21558

Query: 918   Q-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE 976
             +  + + +V  E   L+W PP DDG A I  Y +QK +   + W  V      T   +T+
Sbjct: 21559 EGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTK 21618

Query: 977   LVIGNEYYFRVFSENMCGLSE 997
             L+ GNEY FRV + N  G+ E
Sbjct: 21619 LLKGNEYIFRVMAVNKYGVGE 21639



 Score =  240 bits (613), Expect = 5e-63
 Identities = 159/591 (26%), Positives = 282/591 (47%), Gaps = 40/591 (6%)

Query: 429   DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
             D+KP       +  +V +G+++ ++  IS        WTK+GLP++++ R+ V     + 
Sbjct: 23231 DVKPA-----FSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT 23285

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPK--IILDGLDADNTVTVIA 539
              L I     +D G Y            A + ++     DPPK  +  D + A++      
Sbjct: 23286 TLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES------ 23339

Query: 540   GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT-----ESYPDSSTLVIDIAERDDS 594
                    I +S  PP      +    I++      T      +    +TL +   +    
Sbjct: 23340 -------ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTE 23392

Query: 595   GVYHINLKNEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
               + I  +N  G++ A     +V       P PP  P  T +  D  ++ W  P  +GGS
Sbjct: 23393 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 23452

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P++GY +ERK++ S  W ++N  +  +T F+ + + EG+ YE R++A N +G+ K S  S
Sbjct: 23453 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 23512

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANK 769
               +V      PP       V    +T++W  P + G + + GY++E        W+ A+ 
Sbjct: 23513 ECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASF 23572

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLK 828
               + +T+FT++GL  D +   RV A NAAGA S+P   + PI  K+ +E P+I +    +
Sbjct: 23573 TNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFR 23632

Query: 829   QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSH 887
              T +   GE   L     GKP P + W +   EI+++ +  I+N++   ++ ++ A R  
Sbjct: 23633 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRID 23692

Query: 888   SGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAIT 946
              G+Y L+       ++  ++++++DRPGPP+  V++  V  E  +LTW+PP  DG + I+
Sbjct: 23693 GGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDIS 23752

Query: 947   GYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
              Y ++K +   + W  V       S  +T+L+ GNEY FR+ + N  G+ E
Sbjct: 23753 HYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGE 23803



 Score =  239 bits (611), Expect = 8e-63
 Identities = 148/495 (29%), Positives = 245/495 (49%), Gaps = 10/495 (2%)

Query: 506   DAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D+  VT   K V  +  P++ +D  +   T  V AG  +RL I   G P P A+WS+ D 
Sbjct: 28338 DSCEVTGTIKAVDRLTAPELDIDA-NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDS 28396

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
              +   +    T+S+   STL ++   R+D+G Y + ++N +G    +  VKV+D P PP 
Sbjct: 28397 NLSLRADIHTTDSF---STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPG 28453

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
               T  +V      + W+ P  DGG+ I  Y +E+++     W  ++ + C    F+   +
Sbjct: 28454 PITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDL 28512

Query: 685   IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
              EGV Y  R+ AVN  G+ +P     P V     +PP  L V   + ++  + W  PDH 
Sbjct: 28513 AEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHD 28572

Query: 745   GAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
             G + + GY+LE   +G++ W+ A      +  FT+  L    +   RVKA N AG SEP+
Sbjct: 28573 GGSRITGYLLEMRQKGSDFWVEAGH--TKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPR 28630

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-D 863
                  +++KE    P   +     Q    + G    + +P  G+P P++TWK +   + +
Sbjct: 28631 EAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE 28690

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP-PQIVKI 922
              ++++I  ++  T + ++ + R  SG+Y L ++    V+T S+ + +I RPGP    +++
Sbjct: 28691 TDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEV 28750

Query: 923   EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 982
               V  E+  L+W  PKD G   IT Y ++K +  +  W  V     RT   +T L    E
Sbjct: 28751 SSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYME 28810

Query: 983   YYFRVFSENMCGLSE 997
             Y FRV SEN  G+S+
Sbjct: 28811 YSFRVSSENRFGVSK 28825



 Score =  238 bits (608), Expect = 2e-62
 Identities = 155/491 (31%), Positives = 238/491 (48%), Gaps = 15/491 (3%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++PP++ILD   A     +  G+ LRL   I G P PK  W + D+   +   + R +  
Sbjct: 17213 LEPPELILDANMAREQ-HIKVGDTLRLSAIIKGVPFPKVTWKKEDR---DAPTKARIDVT 17268

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
             P  S L I  A  +D G+Y + ++N AG    S+KV V+D P PP    V+E+  D C +
Sbjct: 17269 PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYL 17328

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              W+ P  DGGS I  Y +ER+   S++W  L+    K++ F  K + EG  Y  R+ A N
Sbjct: 17329 TWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAEN 17387

Query: 699   AIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
               G     +   P +   PL    PP  L    V  T V++ W  PD  G + + GY++E
Sbjct: 17388 QYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVE 17447

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
             Y  EGT+DWI      +   +  +TGL        RVKA N  G   P   + PI  +E 
Sbjct: 17448 YQEEGTQDWI--KFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPD-TTIPIECQEK 17504

Query: 816   IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSET 874
             + PP + +   L +  + + G  V      +G P P   W  DG+EI  ++   +     
Sbjct: 17505 LVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNF 17564

Query: 875   DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALT 933
              +++ I+   R  +G+Y + V      +T ++ + ++D PGPP   + I DV  E++ ++
Sbjct: 17565 SSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTIS 17624

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMC 993
             W PPKDDG + +  Y ++K D +   W  V     +T   I  L  G EY FRV +EN  
Sbjct: 17625 WQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKI 17684

Query: 994   GLSE--DATMT 1002
             G+    D+T T
Sbjct: 17685 GVGPPLDSTPT 17695



 Score =  238 bits (607), Expect = 2e-62
 Identities = 169/593 (28%), Positives = 282/593 (47%), Gaps = 27/593 (4%)

Query: 241   LKRMRREEKKSAAFA-------KILDPAYQVDKGGR--VRFVVELADPKLEVKWYKNGQE 291
             L   R E  KSAA         +I++P   ++   +  V F  ++    + +KW KNG+E
Sbjct: 12713 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 12772

Query: 292   IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT 351
             +    +  +     + +L I +C   D+ EY VTAG +K   EL + E P    + LED 
Sbjct: 12773 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 12832

Query: 352   TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA 411
             T    +     C++S + ANVKW++NG EI  G K  Y+   +G  H LII+     D  
Sbjct: 12833 TVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK--YKFEKDGSIHRLIIKDCRLDDEC 12890

Query: 412   EYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLP 470
             EY+      +S A+L V+  P++I+ P  D     G ++    E++ + +  +W +N + 
Sbjct: 12891 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 12950

Query: 471   VQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD 530
             V + D+ +++ +G+IH+L I +    D+G+Y F   A +    AK+ +   PKI      
Sbjct: 12951 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI--AKDKEARAKLELAAAPKI----KT 13004

Query: 531   ADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAE 590
             AD  + V  G  L + +P    P  +A W + ++ +   +     ++  + ++  I  A+
Sbjct: 13005 ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEAK 13060

Query: 591   RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + D G Y I L+N+ G+A   I +KV+D P P     VTE  D    + WE P  DGGS 
Sbjct: 13061 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSK 13120

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE-GVAYEVRIFAVNAIGISKPSMPS 709
             I+GY +ER+  +   W+ L  D  +   F    + + GV Y  R+ A N +G  +P    
Sbjct: 13121 IIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETD 13179

Query: 710   RPFVPLA---VTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV 766
              P    +   V  PP  +T+  V    V++ W PP++ G A +  YV+E   + +  W  
Sbjct: 13180 NPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDT 13239

Query: 767   ANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
             A     +    T+T +    +   RV+A N  G  +P   +  + V + IE P
Sbjct: 13240 AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERP 13292



 Score =  238 bits (607), Expect = 2e-62
 Identities = 172/634 (27%), Positives = 302/634 (47%), Gaps = 44/634 (6%)

Query: 386   KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
             K++Y+ R   +  + I   +  +D    +++         LSV +K L         TV 
Sbjct: 19259 KAQYQFRAIARTAVNISPPSEPSDPV--TILAENVPPRIDLSVAMKSLL--------TVK 19308

Query: 446   LGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              G  +CL   +  + +P   W K+G  ++ ++ +K+  +  +  L + +   +D GDY  
Sbjct: 19309 AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTI 19368

Query: 504   APDAYNVTLPA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR 561
               +  + +  A  K+ V+D P     G  A   +  +  ++  L    S EPP +   S 
Sbjct: 19369 TAENSSGSKSATIKLKVLDKP-----GPPASVKINKMYSDRAML----SWEPPLEDGGSE 19419

Query: 562   GDKAIMEGSGRIRTESYPDSSTLVI---DIAERDDSGVYHINL--KNEAGEA-----HAS 611
                 I++     R      S+T+ I    + +  +   Y   +  +N+ G         +
Sbjct: 19420 ITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPA 19479

Query: 612   IKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
             I     D P   DPPV   +T+   D   ++W+PPA DGGSPI GY +E+++ Q+  W +
Sbjct: 19480 IAKNPYDPPGRCDPPVISNITK---DHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK 19536

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLT 725
             +N     E T +   + EG  YE R+ A+N  G  KPS  S+      P     PP    
Sbjct: 19537 VNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPK 19596

Query: 726   VDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVAN-KDLIDKTKFTITGLPT 784
             V   T ++V++ W  P + G + + GY++E     +++W+  N    + KT+F +TGL  
Sbjct: 19597 VYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLME 19656

Query: 785   DAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP 844
             D +   RV AVN  G S+P         K+I+ PP+  +   L++T I R G  + L +P
Sbjct: 19657 DTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVP 19716

Query: 845   FQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 903
              +G+P P++TW K    + D+  ++I++++ DT +      +  +GKY L ++     + 
Sbjct: 19717 VKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKE 19776

Query: 904   ASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 963
              +I ++++D PGPP  V ++++  ++  +TW PP  DG + I  Y +QK D +   W TV
Sbjct: 19777 YTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTV 19836

Query: 964   IEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
                  +TS  +  L  G  Y+FRVF+EN  G+ +
Sbjct: 19837 TTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD 19870



 Score =  238 bits (606), Expect = 3e-62
 Identities = 182/680 (26%), Positives = 309/680 (45%), Gaps = 62/680 (9%)

Query: 364   EVSEDDANVKWFK----NGEEII-------PGPKSRYRIRVEGKKHILIIEGATKADAAE 412
             +VS+  A++ W K     G  ++       P    ++ I  E K    ++ G +     +
Sbjct: 24223 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 24282

Query: 413   YSVMTTG--GQSSAKL--------SVDLKPLKILTPLTDQTVNLGKEICLKCEI----SE 458
             + V      G+S  ++         + ++P  +  P    ++  G+++ ++  +      
Sbjct: 24283 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQP-SLKLPFNTYSIQAGEDLKIEIPVIGRPRP 24341

Query: 459   NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKV 516
             NI   W K+G P++++ R+ V        L I     +D G Y       A   T    V
Sbjct: 24342 NI--SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSV 24399

Query: 517   HVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              V++ P      +  D + AD  V             IS EPP      +    I+E   
Sbjct: 24400 IVLEKPGPPVGPVRFDEVSADFVV-------------ISWEPPAYTGGCQISNYIVEKRD 24446

Query: 572   RIRTESYPDSSTLV---IDIAERDDSGVYHINL--KNEAGE-AHASIKVKVVDFP----D 621
                T  +  S+T+    I I +      Y   +  +N  G+ A    K  +V +P     
Sbjct: 24447 TTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPG 24506

Query: 622   PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
             PP  P VT +  D  ++ W  P  DGG+ I+GY +E+K+K S  W++LN    ++T F+ 
Sbjct: 24507 PPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKT 24566

Query: 682   KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
               + EG+ YE ++ A N +GI KPS  S  FV      PP       +T   VT++W+ P
Sbjct: 24567 TGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKP 24626

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG-A 800
              + G + + GY++E        W+ A+   + +T+FT++GL  D +   RV A NAAG  
Sbjct: 24627 AYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNF 24686

Query: 801   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
             SEP   S  I  ++ I+ P   +    K   +   GE   L    +GKP P++ W KDG 
Sbjct: 24687 SEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGK 24746

Query: 861   EIDKN--QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 918
             E+++   ++ I+++   T + ++   R+  G+Y L++      ++  I ++++DRPGPP+
Sbjct: 24747 ELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPE 24806

Query: 919   -IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               +K+  V  E   L W PP  DG A I+ Y I+K +   + W  V       +  +T+L
Sbjct: 24807 GPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKL 24866

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + GNEY FRV + N  G+ E
Sbjct: 24867 LPGNEYIFRVMAVNKYGIGE 24886



 Score =  234 bits (598), Expect = 3e-61
 Identities = 141/476 (29%), Positives = 240/476 (50%), Gaps = 11/476 (2%)

Query: 529   LDAD--NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
             LDA+   T+ V AG  +R+ +PI G P P+  W++ +  +   +    TES+   + L+I
Sbjct: 20778 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESF---TLLII 20834

Query: 587   DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
                 R D+G + + ++N AG+    + V+V+D P P +    T++  D   ++W+ P  D
Sbjct: 20835 PECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLID 20894

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I  Y +E+++     +       C + T++   + EG  Y  R+ A N  GI +P+
Sbjct: 20895 GGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPT 20953

Query: 707   MPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV 766
               + P       SPP  L +  +T +TV++ W  P H G + + GYV+E   +G++ W  
Sbjct: 20954 ETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-- 21011

Query: 767   ANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRH 826
              +   +   +  +  L    +   +V AVN+AG S P+  S+P++VKE    P++ +   
Sbjct: 21012 THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESRPVIVKEQTMLPELDLRGI 21070

Query: 827   LKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAER 885
              ++  I + G+ + + IP  G+P+P +TWKK    + + Q +N   + T TI+ I +  R
Sbjct: 21071 YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVR 21130

Query: 886   SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAA 944
             S SG Y L  +         I IQ+ D PGPP   +K ++V  + V  +W PP++DG   
Sbjct: 21131 SDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVP 21190

Query: 945   ITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1000
             I+ Y ++     S  W  +     RT+   T L  G EY FRV ++N  G+    T
Sbjct: 21191 ISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGIT 21246



 Score =  233 bits (595), Expect = 6e-61
 Identities = 168/591 (28%), Positives = 280/591 (47%), Gaps = 38/591 (6%)

Query: 428   VDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             +DLK   +LT     T+ L  E  ++ +    +     K+   +  S R+K+  +    K
Sbjct: 18203 LDLKLSGVLTVKAGDTIRL--EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 18260

Query: 488   LVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
               +  A   D G YV      A +    A V+V+D P     G   +  +  ++ ++   
Sbjct: 18261 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP-----GPVRNLKIVDVSSDRCT- 18314

Query: 546   EIPISGEPPPKAMWSRGDKAIMEG--SGRIRTESYPDS----STLVIDIAERDDSGVYHI 599
                +  +PP           I+E   + R+   +Y  +     T V  + E ++  ++ +
Sbjct: 18315 ---VCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEY-IFRV 18370

Query: 600   NLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
               +N+ G     E+   I     D P  P  P VT+V  +   + W PP YDGG  I GY
Sbjct: 18371 RAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGY 18430

Query: 655   FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV- 713
             F+E+K+K S+RW+ +N     E   + + ++    Y+ R+ A N IGI +PS+PSRP V 
Sbjct: 18431 FLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVA 18490

Query: 714   --PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC-----FEGTEDWIV 766
               P+    PPT   V   T  ++T+ W  P + G A + GYV+E           E W  
Sbjct: 18491 KDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKR 18550

Query: 767   ANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
              N    + + +FT+T L  + +   RV A N  G   P    + I  KEI+EPP+I +  
Sbjct: 18551 CNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDA 18610

Query: 826   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE--IDKNQINIRNSETDTIIFIRKA 883
              +++  I R G  + L    +G+P P++TW+K G +  + K Q+++   +T   + I  +
Sbjct: 18611 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDL--VDTMAFLVIPNS 18668

Query: 884   ERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA 943
              R  SGKY L +      +   ++++++D PGP   +K+ DV   +  ++W PP++DG +
Sbjct: 18669 TRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGS 18728

Query: 944   AITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
              +T Y ++K +     W TV     +TS  +T LV GNEYYFRV + N  G
Sbjct: 18729 QVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYG 18779



 Score =  233 bits (594), Expect = 8e-61
 Identities = 159/513 (30%), Positives = 252/513 (49%), Gaps = 34/513 (6%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS---RGDKAIMEGSGRI--- 573
             + P++ +D + A + +   AG+++R+   I G P PK+ W    +  KA+ +G   I   
Sbjct: 15806 EEPEVFID-IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 15864

Query: 574   -RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVG 632
              + E+  +SS ++I   +R  +G Y I  KN+AG+  A+ +VKV+D P PP    V+++ 
Sbjct: 15865 AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDIT 15924

Query: 633   DDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEV 692
                C ++W+ P  DGG  I GY IE++      W ++N D C  TTF    ++    Y  
Sbjct: 15925 RGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFF 15983

Query: 693   RIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGL 749
             R+ A N  GI  P    +      P+    PP  L +  +T  TV + W+PP + G + +
Sbjct: 15984 RVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPV 16043

Query: 750   DGYVLEYCF----EGT--EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 803
               Y++E C      GT  E W   NK  +++ +FT+  L    +   RVKAVNAAG S+P
Sbjct: 16044 THYIVE-CLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKP 16102

Query: 804   KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW------KK 857
                  P   +    PP I     LK+      G  VN+V   +G P P LTW      K 
Sbjct: 16103 SATVGPCDCQRPDMPPSI----DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKP 16158

Query: 858   DGAE---IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP 914
             D  E    D +   +   +T T++ I ++ RS +G Y +    +    +  + + ++ RP
Sbjct: 16159 DNKEPVLYDTHVNKLVVDDTCTLV-IPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRP 16217

Query: 915   GPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             GPP   +K E V  + + L+W PPKDDG + IT Y I+K +     W  V       + T
Sbjct: 16218 GPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYT 16277

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1006
             I +L+ G+EY FR+ ++N  G+ E      E+A
Sbjct: 16278 IPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETA 16310



 Score =  230 bits (587), Expect = 5e-60
 Identities = 156/568 (27%), Positives = 267/568 (47%), Gaps = 24/568 (4%)

Query: 465   TKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKI 524
             +++G+P++ + R           + +  ++T D G Y       + T  A ++++     
Sbjct: 26511 SRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV----- 26565

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM---EGSGRIRTESYPDS 581
             +LD      T  V+  +     + +  EPP     S+    I+   E S  + TE     
Sbjct: 26566 VLDR-PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATV 26624

Query: 582   STLVIDIAERDDSGVYHINLKNE--------AGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             +  ++ + +      Y   +K E           A  ++K+     P PP  P VT V  
Sbjct: 26625 ARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTT-PGPPSTPWVTNVTR 26683

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             +   + W  P  +GGS ++GY +E K + S  W + N  + + T F+   +  G+ YE R
Sbjct: 26684 ESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFR 26743

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYV 753
             ++A NA G+ KPS PS P + +    PP  + +  ++  +V++ W+ P   G + + GY+
Sbjct: 26744 VYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYI 26803

Query: 754   LEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPILV 812
             +E        W  A+   + +T+F I+GL  +++   RV A NA G+ S P     PI  
Sbjct: 26804 VERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITC 26863

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
              +    P I +P    +    R G +V L     GKP P + W KD  E+  N +    +
Sbjct: 26864 IDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVEN 26923

Query: 873   ETD-TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENV 930
              TD   I I+ A+R +SG Y+L+++      +A+I +QI+D+PGPP   ++ + V  E +
Sbjct: 26924 TTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKI 26983

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 990
              L W PP DDG A IT Y ++K +   + W  V EH      T T+++ GNEY FRV + 
Sbjct: 26984 TLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAV 27043

Query: 991   NMCGLSEDATMTKESAVIARDGKIYKNP 1018
             N  G+ E     +  +V+A++  +   P
Sbjct: 27044 NKYGIGEP---LESDSVVAKNAFVTPGP 27068



 Score =  230 bits (586), Expect = 6e-60
 Identities = 161/526 (30%), Positives = 248/526 (47%), Gaps = 48/526 (9%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
             + P+I LD +     +TV AG K+ L   ++G+P PK  W++ D  I++   RI  E+ P
Sbjct: 13686 EAPEIFLD-VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM-ILKQDKRITIENVP 13743

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
               ST+ I  ++R D+G Y I   N  G A A ++V V+D P PP A  +T+V ++ C++ 
Sbjct: 13744 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLT 13803

Query: 640   WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
             W PP  DGGS I  Y +ER+   S  W +L+    K+T F+  K+I    Y  R+ A N 
Sbjct: 13804 WNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENM 13862

Query: 700   IGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
              G+ +P  + P           PPT L    +T   VT+ W  PD  G + + GY +E  
Sbjct: 13863 YGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERL 13922

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                T+ W+  NK  +  T + + GL    K   RV A N AG  +P   ++PIL+K+ I+
Sbjct: 13923 DPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID 13982

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK----DGAEIDKNQINIRNSE 873
             PP       +K                  GK    L W K     GA+I+   I +  + 
Sbjct: 13983 PPWPPGKPTVKDV----------------GKTSVRLNWTKPEHDGGAKIESYVIEMLKTG 14026

Query: 874   TDTIIFIRKAE-----------RSHSGKYDLQVK-VDKFVETASID-------IQIIDRP 914
             TD   ++R AE                +Y  +V+ V+K  E+   +        + +  P
Sbjct: 14027 TDE--WVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPP 14084

Query: 915   GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI 974
              PP+ +++ ++      L WT P+ DG + IT Y ++K D +   W TV      T  T+
Sbjct: 14085 SPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTV 14144

Query: 975   TELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1020
             T L  G+ Y FRV +EN  G S+   +  E +V+A+D      P Y
Sbjct: 14145 TPLTEGSLYVFRVAAENAIGQSDYTEI--EDSVLAKDTFTTPGPPY 14188



 Score =  230 bits (586), Expect = 6e-60
 Identities = 154/553 (27%), Positives = 257/553 (46%), Gaps = 32/553 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF--APDAYNVTLPAKVHVIDP 521
             W K+G  ++E+ R+ V     +  L I  A  ED G Y    +  A ++T+P  + V+D 
Sbjct: 25428 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 25487

Query: 522   P----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             P     I +D +  D+             I IS  PP      +    I+E      T  
Sbjct: 25488 PGPPGPIRIDEVSCDS-------------ITISWNPPEYDGGCQISNYIVEKKETTSTTW 25534

Query: 578   YPDSSTLV---IDIAERDDSGVYHINL-------KNEAGEAHASIKVKVVDFPDPPVAPT 627
             +  S  +    I I        Y   +       K+   E+ A +       P PP  P 
Sbjct: 25535 HIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPK 25594

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             V        ++ W+ P  DGGS ++GY +E K++ S  W + N  L  +T  +   + EG
Sbjct: 25595 VVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEG 25654

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
             + YE R++A N  GI K S    P        PP    V ++T  +V+++W  P + G A
Sbjct: 25655 LMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGA 25714

Query: 748   GLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA-GASEPKYY 806
              + GY++E        W+  N   I +T F +T L  D +   RV A NAA   SEP   
Sbjct: 25715 KITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSES 25774

Query: 807   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN- 865
             + PI+VK+ +EPP++ +    +   + + GE + +     G+P P ++W KDG EI++  
Sbjct: 25775 TGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERA 25834

Query: 866   QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIED 924
             +  I +++  T++ ++   R  +G+Y L +K      + +++ +++D+PGPP   ++I  
Sbjct: 25835 RTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEING 25894

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY 984
             +  E  +L+W  P++DG A I  Y ++K +   + W         TS  +T+L+ GNEY 
Sbjct: 25895 LTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYI 25954

Query: 985   FRVFSENMCGLSE 997
             FRV   N  G+ E
Sbjct: 25955 FRVTGVNKYGVGE 25967



 Score =  229 bits (583), Expect = 1e-59
 Identities = 169/620 (27%), Positives = 271/620 (43%), Gaps = 26/620 (4%)

Query: 394   EGKKHILIIEGATKADAAEYSVMTTGGQSSAKL-SVDLKPLKILTPLTDQTVNLGKEICL 452
             EGK++   +    +      S +T   +       +DLK L  L  L  +  N   +I +
Sbjct: 19947 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 20006

Query: 453   KCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTL 512
             K + + ++   W K   P+    R+ V        L++ +    D G Y         T 
Sbjct: 20007 KGKPAPSV--SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 20064

Query: 513   PA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                  + V+  P I    +  D  VT  A       + +   PP     S     I+E  
Sbjct: 20065 EGTISIKVVGKPGIPTGPIKFDE-VTAEA-------MTLKWAPPKDDGGSEITNYILEKR 20116

Query: 571   GRIRTE-----SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV-----DFP 620
               +  +     S    +T  +          + ++ +N+ G         +V     D P
Sbjct: 20117 DSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 20176

Query: 621   DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE 680
             D P  P + +V  D   + W  P   GGSPI GY +E K++ S  W R N    +   F+
Sbjct: 20177 DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFK 20236

Query: 681   PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRP 740
                + EG+ YE R+ A+N  G+ KPS+PS P V L    PP    V ++T  +VT+ W  
Sbjct: 20237 VTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTE 20296

Query: 741   PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
             P + G   L GY++E     ++ W+ AN   + +  FT+T L    K   R++A N AGA
Sbjct: 20297 PKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGA 20356

Query: 801   -SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL-VIPFQGKPRPELTWKKD 858
              S P   ++ I+ K+  E P I +   +K     + G+ + L  I   GKP P+ +W K 
Sbjct: 20357 ISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKA 20416

Query: 859   GAEIDKNQI-NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
             G +I  + I  I ++ T +++ I+ A R  +G+Y +        +   + + ++D PGPP
Sbjct: 20417 GKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPP 20476

Query: 918   QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               V+I +V  E   LTWTPP +DG + I  Y ++K +   + W  V E         T+L
Sbjct: 20477 GPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKL 20536

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + GNEY FRV + N  G  E
Sbjct: 20537 IQGNEYIFRVSAVNHYGKGE 20556



 Score =  228 bits (580), Expect = 3e-59
 Identities = 170/617 (27%), Positives = 288/617 (46%), Gaps = 47/617 (7%)

Query: 428   VDLKPLKILTPLTDQTV-NLGKEICLKCEISENIPG--KWTKNGLPVQESDRLKVVHKGR 484
             V+   +K+     D  +   G+   L+ ++S   P   +W+K+G  ++ + +L++     
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 21515

Query: 485   IHKLVIANALTEDEGDYV--------FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                LV  ++   D G Y         FA   +NV       V+D P       +    VT
Sbjct: 21516 STNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVK------VLDRP----GPPEGPLAVT 21565

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAER 591
              +   K  L    S  PP     ++ D  I++     R       S    + L +    +
Sbjct: 21566 EVTSEKCVL----SWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLK 21621

Query: 592   DDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
              +  ++ +   N+ G     E+   + V     PDPP  P VT +  D  ++ W  P  D
Sbjct: 21622 GNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSD 21681

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I+ Y +ER+ K   RW++ N     +  ++   + EG  YE RI A NA GIS PS
Sbjct: 21682 GGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 21741

Query: 707   MPSRPFVPLAVT----SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTE 762
              P+ PF     T     PP    V   + +++++ W  P + G + + GY++E      +
Sbjct: 21742 -PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEED 21800

Query: 763   DW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 821
             +W IV     +  T +TITGL  + +  +R+ A+N+ G  EP         ++ + PP+I
Sbjct: 21801 EWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEI 21860

Query: 822   RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD-GAEIDKNQINIRNSETDTIIFI 880
              +   L++    R    + L +P +G+P PE+ W +D G  +DK   +I ++ + T++ +
Sbjct: 21861 ELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDK--ASIESTSSYTLLIV 21918

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 940
                 R  SGKY L V+     ++A ++++++D PGPPQ +K+++V   +V LTW PP  D
Sbjct: 21919 GNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLD 21978

Query: 941   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL---SE 997
             G + I  Y ++K +     + TV  + H+TS  + +L  G  YYFRV +EN  G+   +E
Sbjct: 21979 GGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAE 22038

Query: 998   DATMTKESAVIARDGKI 1014
              A   K S      GKI
Sbjct: 22039 TAESVKASERPLPPGKI 22055



 Score =  228 bits (580), Expect = 3e-59
 Identities = 151/547 (27%), Positives = 256/547 (46%), Gaps = 24/547 (4%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+GLP++ES+ ++         L I NA  E  G Y    D     + +P  V  + P
Sbjct: 27597 WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 27656

Query: 522   PK-----IILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      I  D + AD+ +       L  ++P          +S   +   + + ++   
Sbjct: 27657 PSKPKGPIRFDEIKADSVI-------LSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCS 27709

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD-----FPDPPVAPTVTEV 631
             S   ++  V ++  +D    + +  +N  G +   +   +V       P PP  P +  V
Sbjct: 27710 SVARTTFKVPNLV-KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNV 27768

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               D   + W+ P YDGGS + G+ +E+K++ S  W ++N        +    ++EG+ Y+
Sbjct: 27769 TSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQ 27828

Query: 692   VRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDG 751
              R++A N+ G+S PS PS+  + ++   PP       VT  T+T++W PP   G + + G
Sbjct: 27829 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 27888

Query: 752   YVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPI 810
             Y +E   +G E W+  N   + + ++T+TGL    +   R+ A NA G  S P   S  I
Sbjct: 27889 YSIEK-RQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGII 27947

Query: 811   LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINI 869
             + ++   PP +          I + GE++ +    QG+P P +TW KDG EI+K   + I
Sbjct: 27948 MTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEI 28007

Query: 870   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP-PQIVKIEDVWGE 928
              +    T +F+R A R H G Y ++ K       A I +++ D PG     ++  ++ GE
Sbjct: 28008 TDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGE 28067

Query: 929   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 988
              + L W  P +DG A IT Y I+K +   + W  + +     S T  +L+ GNEY FRV 
Sbjct: 28068 KMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVS 28127

Query: 989   SENMCGL 995
             + N  G+
Sbjct: 28128 AVNKFGV 28134



 Score =  227 bits (578), Expect = 5e-59
 Identities = 154/500 (30%), Positives = 249/500 (49%), Gaps = 18/500 (3%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   N  + AK  +++ P+I LD +    +V   AG  +++ IP  G PPP   W R D+
Sbjct: 27253 PIEMNEPVQAK-DILEAPEIDLD-VALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDE 27309

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS-IKVKVVDFPDPP 623
               +    R   E+   SS L I    R+D+G Y + ++N  GE  +S + VKV+D P   
Sbjct: 27310 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 27369

Query: 624   VAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
                 V  V      + W+PP  DGGSPI+ Y IE++      W  ++   C  T+F+   
Sbjct: 27370 QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHK-CSSTSFKLID 27428

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             + E   +  R+ A N IGI +P   + P     V +P   L++   T T+V + W  PD 
Sbjct: 27429 LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDF 27488

Query: 744   IGAAGLDGYVLEYCFEGTEDWIVANKDLIDKT-KFTITGLPTDAKIFVRVKAVNAAGASE 802
              G + +  YV+E   +G + W  A    I KT +  ++ L   + +  RV A N  G S+
Sbjct: 27489 DGGSVITEYVVERKGKGEQTWSHAG---ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSD 27545

Query: 803   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 862
             P     PI VKE+I  P++ +          R+G  V+L +P++GKP+P ++W KDG  +
Sbjct: 27546 PVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPL 27604

Query: 863   DKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI-- 919
              +++ +    +E    + I+ A++ H GKY   V +D  V   ++ I +I   GPP    
Sbjct: 27605 KESEFVRFSKTENKITLSIKNAKKEHGGKYT--VILDNAVCRIAVPITVITL-GPPSKPK 27661

Query: 920   --VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               ++ +++  ++V L+W  P+D+G   IT Y+I+K +     W  V     RT+  +  L
Sbjct: 27662 GPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNL 27721

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             V   EY FRV +EN  G+S+
Sbjct: 27722 VKDAEYQFRVRAENRYGVSQ 27741



 Score =  226 bits (576), Expect = 9e-59
 Identities = 163/554 (29%), Positives = 261/554 (47%), Gaps = 33/554 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDP 521
             W K+ +P++++ R+          L I +A  ED G YV      A        V V+D 
Sbjct: 22181 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDK 22240

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + +D + AD+             I +S  PP     S  +  I+E      T 
Sbjct: 22241 PGPPTGPVKMDEVTADS-------------ITLSWGPPKYDGGSSINNYIVEKRDTSTTT 22287

Query: 577   SYPDSSTLVIDI--AERDDSGV---YHINLKNEAGEA-HASIKVKVVDF----PDPPVAP 626
                 S+T+      A R  +G    + I  +N  G++ + + +  V  +    P PP  P
Sbjct: 22288 WQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTP 22347

Query: 627   TVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              VT    D   + W  P  DGGS ++GY +ERK++ S  W++LN     +T F+   + E
Sbjct: 22348 VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEE 22407

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGA 746
             GV YE R+ A N +GI KPS  S  +V      PP       VT  +VT++W+ P + G 
Sbjct: 22408 GVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGG 22467

Query: 747   AGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKY 805
             + + GY++E        W+ A+   I  T F +TGL  D +   RV A NAAG  SEP  
Sbjct: 22468 SKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSE 22527

Query: 806   YSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
              +  I  ++ ++PP+I +    K T +   GE+  +     GKP P + W K   E+   
Sbjct: 22528 STGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNT 22587

Query: 866   -QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIE 923
              ++ I++++  T + ++ A R  SG Y L+ K      + +++++++DRPGPP+  V I 
Sbjct: 22588 ARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVIS 22647

Query: 924   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
              V  E   L W PP  DG + I  Y +++ +   + W  V  +    S  +T+L+ GNEY
Sbjct: 22648 GVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEY 22707

Query: 984   YFRVFSENMCGLSE 997
              FR+ + N  G+ E
Sbjct: 22708 TFRIMAVNKYGVGE 22721



 Score =  225 bits (574), Expect = 2e-58
 Identities = 142/476 (29%), Positives = 224/476 (47%), Gaps = 18/476 (3%)

Query: 573   IRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPT 627
             +   S P   T  I         V+ I  +N+ G     ++       +   P  P  PT
Sbjct: 16265 VHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPT 16324

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT----FEPKK 683
             V+ V  +   +NWE P YDGGSP+ GY++E K   S RW R+N D  K  T    ++   
Sbjct: 16325 VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTG 16384

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRP 740
             +IEG  Y+ R++A+NA G+   S+PS P     P+A   PP     D  T ++  + W P
Sbjct: 16385 LIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVTDW-TKSSADLEWSP 16443

Query: 741   PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
             P   G + + GY++EY  EG E+W       +  TK  +TGL   A    RV+AVN AG 
Sbjct: 16444 PLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGI 16503

Query: 801   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
              EP   +  I +K+ +  P +++   ++   +   G  + ++    GKP P +TW  +  
Sbjct: 16504 GEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNER 16563

Query: 861   EIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV 920
              + + +  I  +   + + I+  +RSH G Y L  K +      +I + ++D PGP    
Sbjct: 16564 TLPQ-EATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTP 16622

Query: 921   KI-EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVI 979
              +  ++  E+  LTW  P+DDG + IT Y I+K +     W  V     R +AT+  L+ 
Sbjct: 16623 FLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQ 16682

Query: 980   GNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPL 1035
             G  Y+FR+ +EN  G+      T E+ VI     + + P  ED +  E    T  L
Sbjct: 16683 GKAYFFRIAAENSIGMG-PFVETSEALVIREPITVPERP--EDLEVKEVTKNTVTL 16735



 Score =  223 bits (569), Expect = 6e-58
 Identities = 160/574 (27%), Positives = 265/574 (46%), Gaps = 34/574 (5%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHV 518
             +W K    +  + RL++        L + +A+  D G+Y+    A NV    ++   V V
Sbjct: 22576 QWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK--AKNVAGERSVTVNVKV 22633

Query: 519   IDPP-----KIILDGLDADNTVTVIA-----GNKLRLEIPISGEPPPKAMWSRGDKAIME 568
             +D P      +++ G+ A+            G    +   +      + +W+  D  +  
Sbjct: 22634 LDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQT 22693

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              S ++      +  T  I    +   G        E  E+   +       PD P AP V
Sbjct: 22694 LSCKVTKLLEGNEYTFRIMAVNKYGVG--------EPLESEPVVAKNPFVVPDAPKAPEV 22745

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV 688
             T V  D  I+ WE PA DGGS ILGY +E++ K+  RW R +  L  E       +IE  
Sbjct: 22746 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 22805

Query: 689   AYEVRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIG 745
              YE R+ A NA G+S+PS PS   +   P+    PP    V  +T ++V + W  P + G
Sbjct: 22806 DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDG 22865

Query: 746   AAGLDGYVLEYCFEGTEDWIVANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
                + GY++E C     +W +      I+KT   +  L    +   R+ A+N AG  E  
Sbjct: 22866 GCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHA 22925

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW-KKDGAEID 863
                 PI+V+E +E P I +   L++    R G ++ L +P +G+P PE+ W K DG   D
Sbjct: 22926 DVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRD 22985

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 923
                I++ +S T  +  +    R  SGKY L ++     ++A + ++++D P PP  +K+ 
Sbjct: 22986 AAIIDVTSSFTSLV--LDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVT 23043

Query: 924   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
             ++  ++V++TW PP  DG + I  Y ++K +     +  V+ + H+ S  I +L  G  Y
Sbjct: 23044 EITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSY 23103

Query: 984   YFRVFSENMCGL---SEDATMTKESAVIARDGKI 1014
             YFRV +EN  G+   ++ A   K + V    GKI
Sbjct: 23104 YFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 23137



 Score =  222 bits (566), Expect = 1e-57
 Identities = 161/583 (27%), Positives = 256/583 (43%), Gaps = 22/583 (3%)

Query: 430   LKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             L P KIL P    T+  GK++ ++  +    +   KW K    V  S  L V        
Sbjct: 18897 LLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI 18955

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPKIILDGLDADNTVTVIAGNK 542
             L+I +   +D G Y    +  + T   K+ V+      PP+   D  D D          
Sbjct: 18956 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC-----S 19010

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
             L   IP+         +      +  G       S   +S  V  +    +  ++ +  +
Sbjct: 19011 LSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEY-IFRVRAE 19069

Query: 603   NEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N  G +      K+V       P  P    VT+V  D   + W+ P  DGGSPI+GY IE
Sbjct: 19070 NRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIE 19129

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK++ S  W++ N  L + T +    ++EG+ Y  RI+A+N  G S PS P+        
Sbjct: 19130 RKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP 19189

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVAN--KDLIDKT 775
               PP    V  VT +TV++ W  P H G + + GY +E C    + W+  N     I + 
Sbjct: 19190 VDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQE 19249

Query: 776   KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 835
             ++T TGL   A+   R  A  A   S P   S P+ +     PP+I +   +K     + 
Sbjct: 19250 EYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKA 19309

Query: 836   GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQ 894
             G  V L     GKP P ++WKKDG  +   + I +        + +    R  SG Y + 
Sbjct: 19310 GTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTIT 19369

Query: 895   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954
              +     ++A+I ++++D+PGPP  VKI  ++ +   L+W PP +DG + IT Y + K +
Sbjct: 19370 AENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRE 19429

Query: 955   KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
                  W  V      TS ++ +L+ G+EY FR+ +EN  G+ +
Sbjct: 19430 TSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGD 19472



 Score =  222 bits (565), Expect = 2e-57
 Identities = 160/535 (29%), Positives = 257/535 (48%), Gaps = 52/535 (9%)

Query: 502   VFAPDAYNVTLPAKV--HVI--DP---PKIILDGLDADNTVTVIAGNKLRLEIPISGEPP 554
             V A +A  V+ P+++  +V+  DP   P I L+  D    + VI G KL + +P    P 
Sbjct: 14360 VRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD----IIVIEGEKLSIPVPFRAVPV 14415

Query: 555   PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
             P   W +  K + + S R+  ++   S+ L +  + R D+G+Y I L+N+ G A ASI V
Sbjct: 14416 PTVSWHKDGKEV-KASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINV 14474

Query: 615   KVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC 674
             KV+  P P      +++    C + WEPP +DGG+PIL Y +ER++     ++ +     
Sbjct: 14475 KVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGEN 14534

Query: 675   KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTD 731
             K  ++  K +I    Y  R+ AVN +G  +      P +   P     PP  + V + T 
Sbjct: 14535 K-LSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTA 14593

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVR 791
               +T+ W+PP + G + + GY++E   +G E W   N+ L+    +T  GL    +   R
Sbjct: 14594 EAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFR 14653

Query: 792   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 851
             V+A NAAG SEP   + P    + I+ PK+ +   L+   ++R G+ + L     G P P
Sbjct: 14654 VRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLE---VKR-GDEIALDASISGSPYP 14709

Query: 852   ELTWKKD-----GAEIDK------------------------NQINIRNSET-DTIIFIR 881
              +TW KD       EI K                         +++I NS+  ++ + +R
Sbjct: 14710 TITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVR 14769

Query: 882   KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
              + R   G Y ++V+ D  +  A   + ++D PGPP     ED+   +V   W PP DDG
Sbjct: 14770 DSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDG 14829

Query: 942   NAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
              + I  YT++K D  K   EW  V         ++T+L+ G EY FRV +EN  G
Sbjct: 14830 GSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFG 14884



 Score =  220 bits (561), Expect = 5e-57
 Identities = 176/654 (26%), Positives = 292/654 (44%), Gaps = 63/654 (9%)

Query: 380   EIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPL 439
             +++ G K  +RIR +         GA  A +     +    +  A       P  +L P 
Sbjct: 20337 DLVEGGKYEFRIRAKNTA------GAISAPSESTETIICKDEYEA-------PTIVLDPT 20383

Query: 440   TDQ--TVNLGKEICLKCE--ISENIP-GKWTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                  T+  G  I L     + + +P   W+K G  ++ SD  ++        L I  A 
Sbjct: 20384 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 20443

Query: 495   TEDEGDY-VFAPDAYNVTLP-AKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              +D G+Y + A + +   +   KV V+D P     G      ++ ++  K  L    +  
Sbjct: 20444 RKDAGEYTITATNPFGTKVEHVKVTVLDVP-----GPPGPVEISNVSAEKATL----TWT 20494

Query: 553   PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK----NE---- 604
             PP +   S     I+E           ++S L+  +   D     H+  K    NE    
Sbjct: 20495 PPLEDGGSPIKSYILEKR---------ETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFR 20545

Query: 605   --------AGEAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILG 653
                      GE   S  VK+VD    P PP  P V+ V  +   ++W+ P  DGGS I G
Sbjct: 20546 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 20605

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV 713
             Y +ER++K+S RW+R       +   +   + EG  YE R+ A N  GI  PS  S   +
Sbjct: 20606 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 20665

Query: 714   PLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV-ANK 769
                   PP   +   VTDTT    ++ W  P + G   + GYV+E+   G E WI     
Sbjct: 20666 MKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTG 20725

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 829
               +  T+F +  L T  K   R+ A+N AG  EP       +V+  + P    +   L++
Sbjct: 20726 TALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPD-FELDAELRR 20784

Query: 830   TYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG 889
             T + R G ++ + +P +G+P PE+TW KD   + KN+ NI N+E+ T++ I +  R  +G
Sbjct: 20785 TLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIENTESFTLLIIPECNRYDTG 20843

Query: 890   KYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYT 949
             K+ + ++     ++  ++++++D PGP   ++  D+  ++V L W  P  DG + IT Y 
Sbjct: 20844 KFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYI 20903

Query: 950   IQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             ++K +     + T     H+ +  +T L  G EY+FRV +EN  G+ E    T+
Sbjct: 20904 VEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTE 20957



 Score =  218 bits (554), Expect = 3e-56
 Identities = 159/598 (26%), Positives = 266/598 (44%), Gaps = 55/598 (9%)

Query: 434   KILTPLTDQTVNLGKEICLKCEISENIPG----------KWTKNGLPVQESDRLKVVHKG 483
             K++ P  +  V L + + +K   +   P           KWT +G  ++  +   V    
Sbjct: 17504 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 17563

Query: 484   RIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVID---PPKIILDGLDADNTVTVI 538
                 L I N L  D G+Y       A + T+   + V+D   PP   ++ LD        
Sbjct: 17564 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPE---- 17619

Query: 539   AGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAERDD 593
                     + IS +PP     S     I+E     +       S    + L I   ++  
Sbjct: 17620 -------HMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 17672

Query: 594   SGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
               V+ +  +N+ G     ++  ++       P PP  P VT++ ++   ++W  P  DGG
Sbjct: 17673 EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGG 17732

Query: 649   SPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             SPI GY++ER++  + +W+R+N     +  F    + EG  YE R+FA N  G+SKPS  
Sbjct: 17733 SPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 17791

Query: 709   SRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
             S P     P+    PP    +   +  T  + W  P   G + + GYV+E    GT  W 
Sbjct: 17792 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWN 17851

Query: 766   VANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIP 824
               NKD LI +  F + GL    +   R+KA N  G  EP+  ++ ++ K+I+ PP++ + 
Sbjct: 17852 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 17911

Query: 825   RHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI------- 877
                +     RVG+ + ++   +G+P P++TW K+G      ++ +R    D I       
Sbjct: 17912 VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG------KVLVREKRVDLIQDLPRVE 17965

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 937
             + I++A R+  GKY +  K        S  + ++DRPGP Q +K+ +V  EN  ++W  P
Sbjct: 17966 LQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENP 18025

Query: 938   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
              D+G + IT + ++        W  V     +       L+  NEYYFRV +EN  G+
Sbjct: 18026 LDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIK-ANLLANNEYYFRVCAENKVGV 18082



 Score =  214 bits (544), Expect = 5e-55
 Identities = 128/407 (31%), Positives = 204/407 (50%), Gaps = 22/407 (5%)

Query: 611   SIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
             S KV + D    P PP  P V        +++W PP  +GGSPI GY++E++++ S  W 
Sbjct: 15587 SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWS 15646

Query: 668   RLNFDLC-----KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             R++         K   F   +++EGV Y+ R  A+NA GI  PS PS P V   P+    
Sbjct: 15647 RVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPG 15706

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKD--LIDKTKF 777
             PP+   V   T +++++ W+PP   G + + GY++E   EGT DW   N+   LI   + 
Sbjct: 15707 PPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCEC 15766

Query: 778   TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 837
              +  L    K   RVKAVN AG SEP   +  I   +I E P++ I    +   + + G 
Sbjct: 15767 VVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGS 15826

Query: 838   AVNLVIPFQGKPRPELTWK---------KDGAEIDKNQINIRNSETDTIIFIRKAERSHS 888
              + +    +G+P P+ +W+         KDG         +  +E  ++I I + +RSH+
Sbjct: 15827 QIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT 15886

Query: 889   GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 948
             GKY +  K     +TA+  ++++D PGPP+ +K+ D+   +  L+W  P DDG   I GY
Sbjct: 15887 GKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGY 15946

Query: 949   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
              I+K       W  V      T+  + +L+   +Y+FRV +EN  G+
Sbjct: 15947 VIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGI 15993



 Score =  214 bits (544), Expect = 5e-55
 Identities = 163/595 (27%), Positives = 269/595 (45%), Gaps = 44/595 (7%)

Query: 443   TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T+  G ++ L   +      K  WTK    +   +++ + + G+    VI      D G 
Sbjct: 29058 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGK 29117

Query: 501   YVFAPDAYNVT--LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP---- 554
             Y       + T  +   V V+D P     G     TV+ +   K  L   +  E      
Sbjct: 29118 YTLTVKNASGTKAVSVMVKVLDSP-----GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 29172

Query: 555   -----PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                   +   SR +  I+EG     T SY      V+    +++  ++ +   N+ G   
Sbjct: 29173 THYIVERRETSRLNWVIVEGE--CPTLSY------VVTRLIKNNEYIFRVRAVNKYGPGV 29224

Query: 607   --EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
               E+   +       P PP  P     G +  I+ W  P  DGG+ I  Y +++++K+S 
Sbjct: 29225 PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSL 29284

Query: 665   RWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTS 719
             RW R+N D +  +T  +   ++EG  Y+ R+ AVNA G S+PS  S  F+    P     
Sbjct: 29285 RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASN-FISCREPSYTPG 29343

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI-VANKDLIDKTKFT 778
             PP+   V   T  ++++ W  P + G   + GYVLE   + T+ W  V     I  T+FT
Sbjct: 29344 PPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFT 29403

Query: 779   ITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEA 838
             +  L    K   RV AVN  G SE       I   E IE P + +   LK+T   R G +
Sbjct: 29404 VPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGAS 29463

Query: 839   VNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVD 898
             + L++   G+P P +TW K G ++    I I  +E+ +++ + K  R  +GKY ++ +  
Sbjct: 29464 LRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSLLIVDKVNRYDAGKYTIEAENQ 29522

Query: 899   KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 958
                ++A++ +++ D PGP   VK+++V  ++V +TW  P  DG A +  Y ++K +    
Sbjct: 29523 SGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMR 29582

Query: 959   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKESAVI 1008
              + TV     +T   I+ LV G  YYFRV  EN+ G+ E     DA +  E  ++
Sbjct: 29583 AFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLV 29637



 Score =  213 bits (543), Expect = 6e-55
 Identities = 156/581 (26%), Positives = 275/581 (47%), Gaps = 32/581 (5%)

Query: 444   VNLGKEICLKCEI-SENIPGK-WTKNGLPVQESD-RLKVVHKGRIHKLVIANALTEDEGD 500
             V+ G+   L+ +I  + IP   W+K+G  ++E+  R+++    +   LV+ + +  D G 
Sbjct: 24719 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 24778

Query: 501   YVFAPDAYNVT--LPAKVHVIDPP-----KIILDGLDAD------NTVTVIAGNKLRLEI 547
             Y+        T  +P  V V+D P      + + G+ A+      N      G  +   I
Sbjct: 24779 YILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYI 24838

Query: 548   PISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE 607
              I      +  W++    +   + ++ T+  P +  +   +A       Y I    E+G 
Sbjct: 24839 -IEKRETSRLSWTQVSTEVQALNYKV-TKLLPGNEYIFRVMAVNK----YGIGEPLESGP 24892

Query: 608   AHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
               A    K    P PP  P V+ +  D  ++ W  P  DGG+ I GY +E++ K+  RW 
Sbjct: 24893 VTACNPYKP---PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 24949

Query: 668   RLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVD 727
             + N     +       + EG +YE R+ A NA G+ +PS PS  +       PP   +  
Sbjct: 24950 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP 25009

Query: 728   SVTDT---TVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDL-IDKTKFTITGLP 783
              VTDT   +V++ W  P + G A + GYV+E      ++W        +   +FT+T L 
Sbjct: 25010 KVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLK 25069

Query: 784   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVI 843
              + +   R+ A+N+ G  EP      ++ +E IEPP+I +   L++  + R    + L +
Sbjct: 25070 ENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFV 25129

Query: 844   PFQGKPRPELTWKK-DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
               +G+P PE+ W+K +G   D+ QI + +S   T++ I    R  SG+Y+L ++ +   +
Sbjct: 25130 TIKGRPEPEVKWEKAEGILTDRAQIEVTSS--FTMLVIDNVTRFDSGRYNLTLENNSGSK 25187

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
             TA ++++++D P  P  + I +V  ++V L+W PP  DG A IT Y ++K +     + T
Sbjct: 25188 TAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYAT 25247

Query: 963   VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             +  +  +T+  I  L  G  YYFRV + N  G+   A  T+
Sbjct: 25248 ITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTE 25288



 Score =  213 bits (542), Expect = 8e-55
 Identities = 117/390 (30%), Positives = 208/390 (53%), Gaps = 6/390 (1%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT++  +   + W  P  DGGS I GYF+E++ K+S  W ++  +  ++T  
Sbjct: 27066 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQ 27125

Query: 680   EPKKMIEGVAYEVRIFAVNAIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             +   + E   Y+ R+ AVNA G    S+PS   +   P+    PP  + +   T +++T+
Sbjct: 27126 KVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITL 27185

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGTEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAV 795
              W  P + G + + GYV+E      E+W  V+ K  +  T++ ++ L      + RV AV
Sbjct: 27186 GWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAV 27245

Query: 796   NAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW 855
             N AG  EP   ++P+  K+I+E P+I +   L+ + I + GE V ++IPF+G+P P +TW
Sbjct: 27246 NCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTW 27305

Query: 856   KKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVD-KFVETASIDIQIIDR 913
             +KD   +  + + +I N+++ +++ I +  R+ +GKY L ++      +++++ ++++D 
Sbjct: 27306 RKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDT 27365

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             P   Q ++++ V    V L W PP  DG + I  Y I+K D     W  V      TS  
Sbjct: 27366 PAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFK 27425

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             + +L     ++FRV +EN  G+ E    T+
Sbjct: 27426 LIDLSEKTPFFFRVLAENEIGIGEPCETTE 27455



 Score =  210 bits (535), Expect = 5e-54
 Identities = 144/504 (28%), Positives = 232/504 (46%), Gaps = 21/504 (4%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
             +PP + LD +     + ++AG  LR+   ++G P P  +W++ +  +     R+  ++  
Sbjct: 15100 EPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL--DKDRVVIDNVG 15156

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
               S L+I  A R D G Y I   N  G   A+ +V+V D P P +           C++N
Sbjct: 15157 TKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLN 15216

Query: 640   WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
             W  P  DGGS I G+ IERK  +   W R   +  + +  +   ++EG  Y+ R+ A N 
Sbjct: 15217 WSDPEDDGGSEITGFIIERKDAKMHTW-RQPIE-TERSKCDITGLLEGQEYKFRVIAKNK 15274

Query: 700   IGISKPSM--PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
              G   P    P     PL   + P  LT    T +T+T+ W+ P   G + + GY++E  
Sbjct: 15275 FGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKR 15334

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                  D+   NK L   T F +  L        RVKAVN  G SEP      +++++   
Sbjct: 15335 RHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPS-LPLNVVIQDDEV 15393

Query: 818   PPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-------NQINI 869
             PP I++   ++   I+ + GE V++     G P P++ W K+   I+K        +  +
Sbjct: 15394 PPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEV 15453

Query: 870   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 929
               SE  T + I KA R   G Y +           ++ +++ DRP PP+ + + D+  E+
Sbjct: 15454 SRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAES 15513

Query: 930   VALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 987
               LTW  P D+G + IT Y I K D  +K  EW  V          I +L+   +Y FRV
Sbjct: 15514 CYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRV 15573

Query: 988   FSENMCGLSEDATMTKESAVIARD 1011
              + N  G+S++    K   V+ +D
Sbjct: 15574 RAVNKYGISDEC---KSDKVVIQD 15594



 Score =  209 bits (533), Expect = 9e-54
 Identities = 155/595 (26%), Positives = 276/595 (46%), Gaps = 28/595 (4%)

Query: 420   GQSSAKLSVDLKPLKILTPLTDQ-TVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDR 476
             G  +AK  V+L  + +     D   VN G+   L+ ++  + +P  +W +    ++ES R
Sbjct: 23612 GPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESAR 23671

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNT 534
              ++ +      L++ +A+  D G Y+      A + + P  V V+D P       +    
Sbjct: 23672 CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQ 23727

Query: 535   VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIA 589
             VT +   K  L    +  PP +   S     ++E     R       S   +++L +   
Sbjct: 23728 VTGVTSEKCSL----TWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKL 23783

Query: 590   ERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPA 644
                +  V+ I   N+   GE   S  V + +    P PP +  VT +  D   + W  P 
Sbjct: 23784 LEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPD 23843

Query: 645   YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
              DGGS I+GY +E++ +   RW++ N     +       + E   YE R+ A NA G+ +
Sbjct: 23844 SDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGE 23903

Query: 705   PSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
             PS  +   +   P+    PPT   +   T  ++T+ W  P + G + + GYV+E C    
Sbjct: 23904 PSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADE 23963

Query: 762   EDW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             E+W IV  +  +  T+F I+ L    +  +RV A+N  G  E       +  ++ +E P+
Sbjct: 23964 EEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPE 24023

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFI 880
             + +   L++  + R G +  + IPF+G+P PE+TW ++  E   +++ I      T + I
Sbjct: 24024 LDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFT-DKVQIEKGVNYTQLSI 24082

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 940
                +R+ +GKY L+++     ++A + ++++D PGPPQ + +++V  ++  L W PP  D
Sbjct: 24083 DNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIID 24142

Query: 941   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             G A +  Y I K +     +  V     +TS  +  L  G  YYFRV +EN  G+
Sbjct: 24143 GGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 24197



 Score =  207 bits (528), Expect = 3e-53
 Identities = 124/404 (30%), Positives = 206/404 (50%), Gaps = 10/404 (2%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP A  V +V      + WEPP  DGG PI  Y IE+K++  +RW++       +  F
Sbjct: 14184 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 14243

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTM 736
                 +IEG   + ++ A N  G+  PS P+       P +  SPP  L V       + +
Sbjct: 14244 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 14303

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT-GLPTDAKIFVRVKAV 795
              W+PP+  G + + GY +E C  GTE W+  N   I   KF +  G+  D +  +RV+AV
Sbjct: 14304 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 14363

Query: 796   NAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW 855
             NA G SEP   S+ ++ K+    P I +  H     I   GE +++ +PF+  P P ++W
Sbjct: 14364 NAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSW 14420

Query: 856   KKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP 914
              KDG E+   +++ ++N      + + K+ R+ +G Y + ++      TASI++++I  P
Sbjct: 14421 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP 14480

Query: 915   GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI 974
             GP + +K  D+   +  LTW PP+ DG   I  Y +++ +     +  V+   ++ S T+
Sbjct: 14481 GPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTV 14540

Query: 975   TELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1018
              +L+   EY+FRV + N  G  E   +  ++ VIA+D K   +P
Sbjct: 14541 KDLIPNGEYFFRVKAVNKVGGGEYIEL--KNPVIAQDPKQPPDP 14582



 Score =  205 bits (522), Expect = 2e-52
 Identities = 140/501 (27%), Positives = 228/501 (45%), Gaps = 20/501 (3%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP++ LD +   + +TV  G  +R+   + G P P   W++  K ++      R + 
Sbjct: 17902 ILHPPEVELD-VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK---RVDL 17957

Query: 578   YPDSSTLVIDIAE--RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
               D   + + I E  R D G Y I+ KN +G A  S  V V+D P P     VT V  + 
Sbjct: 17958 IQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKEN 18017

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++WE P  +GGS I  + +E +K     W  +  D+ K        ++    Y  R+ 
Sbjct: 18018 CTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYFRVC 18075

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             A N +G+        P +   P+     P  L +     T V ++WR PD+ G +    Y
Sbjct: 18076 AENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSY 18135

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
              +E   +G++DW   +K  I +T + +     +     RV+  N  G S+    ++ ++V
Sbjct: 18136 HVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESD-WVKTEEVVV 18194

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ---INI 869
             KE ++ P + +   L      + G+ + L    +GKP PE+ W KD    D  +   + I
Sbjct: 18195 KEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKI 18252

Query: 870   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 929
                   +   + KA+RS  GKY +          A   + ++D+PGP + +KI DV  + 
Sbjct: 18253 DTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDR 18312

Query: 930   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 989
               + W PP+DDG   I  Y ++K + K M W T          T+T L+ GNEY FRV +
Sbjct: 18313 CTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRA 18372

Query: 990   ENMCGLSEDATMTKESAVIAR 1010
             EN  G       T+   VIA+
Sbjct: 18373 ENKIGTGPP---TESKPVIAK 18390



 Score =  204 bits (520), Expect = 3e-52
 Identities = 148/557 (26%), Positives = 258/557 (46%), Gaps = 31/557 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVI 519
             W K+G+ +++   +++        L + +A  +  G  V+  +A N +  AK    V V 
Sbjct: 27992 WFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG--VYTVEAKNASGSAKAEIKVKVQ 28049

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRL--EIPISGEPPP-------KAMWSRGDKAIMEGS 570
             D P  ++  +   N    I G K+ L  + P++    P       K   SR   A++E  
Sbjct: 28050 DTPGKVVGPIRFTN----ITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIED- 28104

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGV--YHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              +   +SY     +  +  +   S V  + +    ++    A I+  V   PD P  P  
Sbjct: 28105 -KCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTV---PDAPGIPEP 28160

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR-LNFDLCKETTFEPKKMIEG 687
             + +  +   + W  P  DGGS I  Y +ER++K+S+RW++ ++     ET F+   + EG
Sbjct: 28161 SNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEG 28220

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               YE  + A NA G+   S  SR      P+    PPT++ V   + TTV++ W  P   
Sbjct: 28221 NEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFD 28280

Query: 745   GAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
             G   + GY++E C     DW   N +   KT++T+T L    +   RV A+N AG  +  
Sbjct: 28281 GGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSC 28340

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK 864
               +  I   + +  P++ I  + KQT++ R G ++ L I +QG+P P   W K  + +  
Sbjct: 28341 EVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL 28400

Query: 865   NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIED 924
              + +I  +++ + + +    R+ +GKY L V+ +   ++ +  ++++D PGPP  +  +D
Sbjct: 28401 -RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKD 28459

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY 984
             V   +  L W  P  DG A I  Y ++K +     W  + E   R    + +L  G  YY
Sbjct: 28460 VTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYY 28519

Query: 985   FRVFSENMCGLSEDATM 1001
             FRV + N  G+ E   M
Sbjct: 28520 FRVSAVNEYGVGEPYEM 28536



 Score =  203 bits (517), Expect = 6e-52
 Identities = 137/482 (28%), Positives = 227/482 (47%), Gaps = 20/482 (4%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P  P  P V  V  +   + WE P +DGGS I+GY++E+K++ +  W++ N   C E  +
Sbjct: 28841 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 28900

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   ++EG+ Y+ R +A+NA G+SK S  SRP +       P    V  VT +TV++ W 
Sbjct: 28901 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 28960

Query: 740   PPDHIGAAGLDGYVLE---YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN 796
              P + G + + GY++E       G   W+  N  ++    FT+T L        RV A N
Sbjct: 28961 APAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKN 29020

Query: 797   AAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELT 854
             AAG  S+    + P+  ++   PPK  +   L    +  R G  + L     GKP P++ 
Sbjct: 29021 AAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKII 29080

Query: 855   WKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 913
             W K   E+D   +++++ +       I+  +RS SGKY L VK     +  S+ ++++D 
Sbjct: 29081 WTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDS 29140

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             PGP   + +  V  E   L W+ P++DG A IT Y +++ +   + W  V       S  
Sbjct: 29141 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYV 29200

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP--VYEDFDFSEAPM- 1030
             +T L+  NEY FRV + N  G        +   ++AR+     +P  + E+    +  + 
Sbjct: 29201 VTRLIKNNEYIFRVRAVNKYG---PGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHII 29257

Query: 1031  --FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFSNQGVCTLE 1087
               +T+P  +     G N   N  V    K  + W + NK  +V D R ++ S    C  +
Sbjct: 29258 IQWTKPESD-----GGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQ 29312

Query: 1088  IR 1089
              R
Sbjct: 29313 FR 29314



 Score =  200 bits (509), Expect = 5e-51
 Identities = 218/906 (24%), Positives = 364/906 (40%), Gaps = 113/906 (12%)

Query: 263   QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             +V +   V F  E+     + KW++N + I  S+KYI   K     L I +  + D + Y
Sbjct: 12650 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 12709

Query: 323   YVTAGDE-----KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKN 377
              V+  +      K +  L V E  + + + L+D      + V   C+V+  +  +KW KN
Sbjct: 12710 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 12769

Query: 378   GEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILT 437
             GEE+    +  YR  V+  KH+L I+     D  EY V     +S A+L +   P + + 
Sbjct: 12770 GEEVPFDNRVSYR--VDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 12827

Query: 438   PLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTE 496
              L DQTV    +    C++S E    KW +NG  ++E  + K    G IH+L+I +   +
Sbjct: 12828 HLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLD 12887

Query: 497   DEGDYVFAPD-----AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISG 551
             DE +Y    +     A        V +I PP+ IL+   AD  V +   NK ++E+    
Sbjct: 12888 DECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD-VVFLAELNKDKVEV---- 12942

Query: 552   EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                    W R +  +++G               + DI  RD  G Y    K++  EA A 
Sbjct: 12943 ------QWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQ-GEYRFIAKDK--EARAK 12993

Query: 612   IKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF-IERKKKQSSRWMRLN 670
             +++          AP +     D  +        D G P+      +   K  + W + N
Sbjct: 12994 LELAA--------APKIKTADQDLVV--------DVGKPLTMVVPYDAYPKAEAEWFKEN 13037

Query: 671   FDL--------CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPT 722
               L         ++T+F   +  +G     +I   N  G ++  +  +    + V  P  
Sbjct: 13038 EPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV---IDVPGPVR 13094

Query: 723   LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGL 782
              L V    D  V++ W  P   G + + GYV+E      + W++A  D  +  +FT+TGL
Sbjct: 13095 NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLAT-DRAESCEFTVTGL 13153

Query: 783   PTDAKIFV-RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 841
                   ++ RV A N  G  EP     P+  +   + P                G  +N+
Sbjct: 13154 QKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP----------------GPPLNV 13197

Query: 842   VIPFQGKPRPELTWKKD----GAEIDKNQINIRNSET---DTIIFIRKAERS-------H 887
              I    +    LTW+      GAEI    I +R+  +   DT + +R  + S        
Sbjct: 13198 TITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVE 13257

Query: 888   SGKYDLQVKVDKFV-----ETASIDIQI---IDRPGPPQIVKIEDVWGENVALTWTPPKD 939
               +Y  +V+    +       A+  +++   I+RP PP  +   D    +V L W PP  
Sbjct: 13258 GQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLK 13317

Query: 940   DGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSED 998
             DG + I GY I++ ++    W    ++     +  +T L  GN+Y +RV +EN  G+S+ 
Sbjct: 13318 DGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDP 13377

Query: 999   ATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNA-TLNCSVRGNPK 1057
             + +                P+  D  F E  M      +   +   N  T+     G P+
Sbjct: 13378 SEIL--------------GPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPR 13423

Query: 1058  PKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLE 1117
             P  TW      +    R +M +      L I      D G Y  K  N + T+  E  ++
Sbjct: 13424 PTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGE--ID 13481

Query: 1118  VKVIAQ 1123
             V VIA+
Sbjct: 13482 VNVIAR 13487



 Score =  198 bits (503), Expect = 3e-50
 Identities = 173/674 (25%), Positives = 288/674 (42%), Gaps = 74/674 (10%)

Query: 373   KWFKNGEEIIP-----------GPKSRYRIRVEGKKHILIIEGATKA-------DAAEYS 414
             +W +  E ++P           G + ++R+R E    I     AT         DA +  
Sbjct: 14625 RWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI 14684

Query: 415   VMTT-----GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC---------EISENI 460
             + T+     G + +   S+   P   +T + D+ V + +EI  +          E+ E  
Sbjct: 14685 LRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEE 14744

Query: 461   PGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN--VTLPAKVHV 518
             P       LP+ +   +    KG   +L + ++L  D G Y+   +  +     P  V V
Sbjct: 14745 PFV-----LPLTQRLSIDNSKKGE-SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +D P   ++ +  D   T +             EPP       G   I+  +   + ++ 
Sbjct: 14799 LDTPGPPINFVFEDIRKTSVL---------CKWEPP----LDDGGSEIINYTLEKKDKTK 14845

Query: 579   PDSSTLVIDIAERD-----------DSGVYHINLKNEAGEAHASIKVKVVDF-----PDP 622
             PDS  +V+    R               ++ +  +N  G     +   +V       PD 
Sbjct: 14846 PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDA 14905

Query: 623   PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPK 682
             P  P V +V  +  ++ W  P  D GSPILGY++E+++  S+ W R+N  L         
Sbjct: 14906 PDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVD 14964

Query: 683   KMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP--PTLLTVDSVTDTTVTMRWRP 740
              ++EG+ Y  R+ A NA G  K S PS P       SP  P +  V   + TT+ + W P
Sbjct: 14965 GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEP 15024

Query: 741   PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
             P   G   + GY ++    GT +W    + +I   ++T+  +   A   +RV AVNAAG 
Sbjct: 15025 PAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGE 15084

Query: 801   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
               P   +QP+ V E  EPP + +   +K       G+ + +     G+P P   W K+  
Sbjct: 15085 GPPG-ETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEG 15143

Query: 861   EIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV 920
             E+DK+++ I N  T + + I+ A R   G+Y +        + A+  +++ D PGP   +
Sbjct: 15144 ELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDL 15203

Query: 921   KIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIG 980
             K      +   L W+ P+DDG + ITG+ I++ D K   W   IE   R+   IT L+ G
Sbjct: 15204 KPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEG 15262

Query: 981   NEYYFRVFSENMCG 994
              EY FRV ++N  G
Sbjct: 15263 QEYKFRVIAKNKFG 15276



 Score =  192 bits (487), Expect = 2e-48
 Identities = 179/703 (25%), Positives = 312/703 (44%), Gaps = 63/703 (8%)

Query: 344   VTKQLEDTTAYCGERVELECE-VSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
             + K+++D T   GE  +L C+ V     ++KW++ G+E+I   K  Y++  +G+ H L +
Sbjct: 30535 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRK--YKMSSDGRTHTLTV 30592

Query: 403   EGATKADAAEYSVMTTGG----QSSAKLSVDLKP-LKILTPLTDQTVN-LGKEICLKCE- 455
                 + D   Y+ + T      ++S+KL +   P      PL ++    +G  + L    
Sbjct: 30593 MTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMY 30652

Query: 456   ISENIPGK-WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
             I   +P   W      +Q S+ + + +      LV+ N   +           Y V L  
Sbjct: 30653 IGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAG------KYKVQLSN 30706

Query: 515   KVHVIDPPKIILDGLDADN----TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME-- 568
                 +D    ILD    D     T  ++    L+    IS +PP     S     ++E  
Sbjct: 30707 VFGTVDA---ILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKC 30763

Query: 569   -----GSGRIRTESYPDSSTLVIDIAERDDSGVY-HINLKNEAG-----EAHASIKVKV- 616
                     ++ + +   ++  ++++ E  ++G Y  ++ +N  G     E  + + +K  
Sbjct: 30764 EAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 30821

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
              + P  P  PT+T V  D C++ W+PPA DGG+ I  Y++E+++K+ ++W+ +  +  +E
Sbjct: 30822 FEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 30881

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             T F  K +IEG+ YE R+   N  G S+ S  S P  P +          + + +  V  
Sbjct: 30882 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRY 30941

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTK-----FTITGLPTDAKIFVR 791
             +          G    ++++  +G E      K  I + K       I  +  D     +
Sbjct: 30942 QSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQ 31001

Query: 792   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV--GEAVNLVIPFQGKP 849
             V+A N  G+             E+  P KI +P+ L+         GE V++ IPF GKP
Sbjct: 31002 VRATNQGGSVSGT------ASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 31055

Query: 850   RPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 906
              P +TW+K    ID N   Q+ +  S T +++F    ER  +G Y +  K    ++  ++
Sbjct: 31056 DPVITWQKGQDLIDNNGHYQVIVTRSFT-SLVFPNGVERKDAGFYVVCAKNRFGIDQKTV 31114

Query: 907   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 966
             ++ + D P PP+ VK+ DV  ++V LTWT P  DG + IT Y ++K    +  W  V   
Sbjct: 31115 ELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRV-GQ 31173

Query: 967   YHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKE 1004
                T  T+  L     Y FRV +EN  GLS+     + T+TKE
Sbjct: 31174 ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 31216



 Score =  182 bits (462), Expect = 2e-45
 Identities = 204/892 (22%), Positives = 360/892 (40%), Gaps = 91/892 (10%)

Query: 270  VRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDE 329
            + F V +    +  KW KNG EI+ + K     K     L I N    D ++Y   AG  
Sbjct: 2986 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 3045

Query: 330  KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRY 389
              +  L+V    I   K ++D      +R   ECEVSE D  V+W K+ +E+      R 
Sbjct: 3046 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRI 3103

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
            +I+ E   H L+I     +DA +Y+V+  G  S+AKL V+ + ++I +   +  V   + 
Sbjct: 3104 KIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3163

Query: 450  ICLKCEISE-NIPGKWTKNGLPV--QESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD 506
              ++ E++E ++   W K+G+ +  Q  +R K V + RIH++ I+     D G+Y F   
Sbjct: 3164 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3223

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                ++   V+  +PP++    L     VTV +G   R    ISG P PK  W + ++ +
Sbjct: 3224 RNRSSVTLYVNAPEPPQV----LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL 3279

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG----EAHASIKVKVVDFPD- 621
              G  + +        TL++  A  +D+ VY    KN+ G     A  S++V  V  PD 
Sbjct: 3280 STGF-KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3338

Query: 622  --PPVAPTVTEVGDDWCIMNWEPPAY----DGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
              P   P +     D      +P  +     G    + ++ + KK + SR+ R+      
Sbjct: 3339 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM------ 3392

Query: 676  ETTFEPKKMIE-GVAY-----EVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSV 729
             T FE    +E   AY          A NA+G    +        L++ +P ++L     
Sbjct: 3393 -TQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSST------ANLSLEAPESILHERIE 3445

Query: 730  TDTTVTMRWRPPDHIGAAGLD---GYVLEYCFEGTE------DWIVANKDLIDKTKFTIT 780
             +  + M+  P        L+   G++ ++  E          W  A +++ +  K +I 
Sbjct: 3446 QEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIR 3505

Query: 781  GLPTDAKIFVRVKAVNAAGASEPKYYSQ--------PILVKEIIEPPKIRIPRHLKQTYI 832
                 + + +    V   G    K  ++         + V E   P  +  P+ L     
Sbjct: 3506 SSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTF-- 3563

Query: 833  RRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKY 891
              VG+A   +    G P  E  W+KDGA +  +    I ++E   I+ +        G Y
Sbjct: 3564 --VGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVY 3621

Query: 892  DLQVKVDKFVETASIDIQIIDRPG-PPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTI 950
              +       +    ++ IID+P    ++  ++    + V L     +D           
Sbjct: 3622 SCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDED----------- 3670

Query: 951  QKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA--VI 1008
                K ++ W          S    +L  G +Y    F + +  L       K+S   V 
Sbjct: 3671 ---RKVTVTW----------SKDGQKLPPGKDYKI-CFEDKIATLEIPLAKLKDSGTYVC 3716

Query: 1009 ARDGKIYKNPVYEDFDFSEAPMFTQPLVNTY-AIAGYNATLNCSVRGNPKPKITWMKNKV 1067
                +   +         E P F + +  +Y  + G +A L+C ++G+P  ++TW KN  
Sbjct: 3717 TASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNK 3776

Query: 1068 AIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
             + +    RM+       L+I      D G+Y C+AVND+G+     ++ +K
Sbjct: 3777 ELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIK 3828



 Score =  181 bits (460), Expect = 3e-45
 Identities = 166/686 (24%), Positives = 284/686 (41%), Gaps = 75/686 (10%)

Query: 350   DTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
             D    CGE V E + EV+  +   KW+             YR++   +      +GA+K 
Sbjct: 13632 DKWVACGEPVAETKMEVTGLEEG-KWYA------------YRVKALNR------QGASKP 13672

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTK 466
                   +     Q + ++ +D+K L  LT      V  G +I L   ++     K  WTK
Sbjct: 13673 SRPTEEIQAVDTQEAPEIFLDVKLLAGLT------VKAGTKIELPATVTGKPEPKITWTK 13726

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHVIDP- 521
               + +++  R+ + +  +   + I ++   D G Y+   +A NV    T   +V+V+D  
Sbjct: 13727 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII--EAVNVCGRATAVVEVNVLDKP 13784

Query: 522   -PKIILDGLDADNTVTVIAGNKLR-------LEIPISGEPPPKAMWSRGDKAIMEGSGRI 573
              P    D  D  N   ++  N  R           +        +W +    + + + + 
Sbjct: 13785 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFK- 13843

Query: 574   RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
              T+  P+   +    AE     +Y +    +A    A  +    D P PP     +++  
Sbjct: 13844 ATKLIPNKEYIFRVAAE----NMYGVGEPVQASPITAKYQ---FDPPGPPTRLEPSDITK 13896

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             D   + W  P  DGGSPI GY++ER    + +W+R N    K+TT+  K +     Y  R
Sbjct: 13897 DAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFR 13956

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + A N  G  KPS  + P +   P+    PP   TV  V  T+V + W  P+H G A ++
Sbjct: 13957 VLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE 14016

Query: 751   GYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPI 810
              YV+E    GT++W+   +  +  T+  + GL    +   RV+AVN AG SEP   S P+
Sbjct: 14017 SYVIEMLKTGTDEWVRVAEG-VPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPV 14075

Query: 811   LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP------------ELTWKKD 858
             L +E + PP    PR L+   I +    +   +P +    P               W+  
Sbjct: 14076 LCREKLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV 14133

Query: 859   GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 918
                +   +  +      ++   R A  +  G+ D        +E + +       PGPP 
Sbjct: 14134 DTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTE-----IEDSVLAKDTFTTPGPPY 14188

Query: 919   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY-HRTSATITEL 977
              + + DV   +V L W PPK+DG   I  Y I+K ++    W    +      +  +T++
Sbjct: 14189 ALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDV 14248

Query: 978   VIGNEYYFRVFSENMCGLSEDATMTK 1003
             + G E  F+V +EN  G+   +  T+
Sbjct: 14249 IEGTEVQFQVRAENEAGVGHPSEPTE 14274



 Score =  167 bits (423), Expect = 5e-41
 Identities = 128/513 (24%), Positives = 216/513 (42%), Gaps = 72/513 (14%)

Query: 28   AGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLL 87
            AG+   K    ++  P    A + A     + F+ +PQ   V      TFIAKV  + + 
Sbjct: 8424 AGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPI- 8482

Query: 88   RKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYK 147
              P +KW KGKW  L       +        H +    +++I       +G YRC    +
Sbjct: 8483 --PNVKWTKGKWRQLNQGGRVFI--------HQKGDEAKLEIRDTTKTDSGLYRCVAFNE 8532

Query: 148  DKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREV--KQQEEE 205
                  + +L+V E                    +++  E D   +LK+  +  K   EE
Sbjct: 8533 HGEIESNVNLQVDERK------------------KQEKIEGDLRAMLKKTPILKKGAGEE 8574

Query: 206  PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLK-------------------RLKRMRR 246
             ++D+ ELLKN  P EYEK A  YGITD RG+L+                    ++R  R
Sbjct: 8575 EEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIERSER 8634

Query: 247  EEKKSAAFAKIL-------DPAYQV----------DKGGRVRFVVELADPKLEVKWYKNG 289
            +EK+       +       +P   +          D        +++  P++++ WYK  
Sbjct: 8635 DEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGT 8694

Query: 290  QEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLE 349
            +++ PS K+     G +  L + NCQ+ D   Y +  G    S +L V EP     + L+
Sbjct: 8695 EKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEP--AWERHLQ 8752

Query: 350  DTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKAD 409
            D T   G+   + C+ S  +   +WF+NG   I  P+ R++  VE K H L I      D
Sbjct: 8753 DVTLKEGQTCTMTCQFSVPNVKSEWFRNGR--ILKPQGRHKTEVEHKVHKLTIADVRAED 8810

Query: 410  AAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNG 468
              +Y+      ++SA+L ++ +P++    + +  V+  +    +CE+S ++    W K  
Sbjct: 8811 QGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGP 8870

Query: 469  LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
              + ES +    + GR H + I N   +DEG Y
Sbjct: 8871 TELTESQKYNFRNDGRCHYMTIHNVTPDDEGVY 8903



 Score =  162 bits (411), Expect = 1e-39
 Identities = 110/364 (30%), Positives = 175/364 (48%), Gaps = 16/364 (4%)

Query: 264   VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
             V  G    F  EL+   + V+WY  G+++ PS K +   +G    L + + ++ D  E  
Sbjct: 12207 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 12266

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
             +TA D K    LFV+EPP+  TK LED T   G    LECEVS ++A VKWFKNG EI+ 
Sbjct: 12267 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 12326

Query: 384   GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
               K  Y I  +G+   L+I   T  D   Y+      ++S  L+V    ++ L PLTD  
Sbjct: 12327 SKK--YEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ 12384

Query: 444   VNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
             V   +    +CE+S EN   KW K+G  +++  +  ++ KG +  LVI   L +DE +Y 
Sbjct: 12385 VREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY- 12443

Query: 503   FAPDAYNVTLPAKVHVIDPPKII---LDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
              + +         + V++   +    L  ++   T T+    KL  E+    +P  + +W
Sbjct: 12444 -SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTI----KLVCEV---SKPGAEVIW 12495

Query: 560   SRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
              +GD+ I+E +GR    +      LVI  A  +D+G Y+  L +   +    +     +F
Sbjct: 12496 YKGDEEIIE-TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEF 12554

Query: 620   PDPP 623
                P
Sbjct: 12555 ISKP 12558



 Score =  157 bits (398), Expect = 4e-38
 Identities = 105/308 (34%), Positives = 159/308 (51%), Gaps = 19/308 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +DPP+I +D    D T+ V AG   +++  I G+P P   W +GD+ +   + R+  +S 
Sbjct: 22538 VDPPRISMDPKYKD-TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKST 22595

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV-TEVGDDWCI 637
               +++L +  A R DSG Y +  KN AGE   ++ VKV+D P PP  P V + V  + C 
Sbjct: 22596 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCT 22655

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL----CKETTFEPKKMIEGVAYEVR 693
             + W+PP  DGGS I+ Y +ER++     W  ++ ++    CK T     K++EG  Y  R
Sbjct: 22656 LAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVT-----KLLEGNEYTFR 22710

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             I AVN  G+ +P + S P V   P  V   P    V +VT  ++ + W  P   G + + 
Sbjct: 22711 IMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEIL 22769

Query: 751   GYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPI 810
             GYVLE   +    W   +K LI + +  +TGL  +     RV A NAAG SEP   S P 
Sbjct: 22770 GYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEP---SPPS 22826

Query: 811   LVKEIIEP 818
               ++  +P
Sbjct: 22827 AYQKACDP 22834



 Score =  157 bits (398), Expect = 4e-38
 Identities = 101/319 (31%), Positives = 164/319 (51%), Gaps = 7/319 (2%)

Query: 506   DAYNVTLPAKV-HVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D   + LP  +   ++PP+I +    + +TV V AG+ L+++IPISG+P PK   SR D 
Sbjct: 26457 DPRELLLPVLIKEQLEPPEIDMKNFPS-HTVYVRAGSNLKVDIPISGKPLPKVTLSR-DG 26514

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R  TE   ++ T+ +  +   D+G Y I   N +G   A I + V+D P PP 
Sbjct: 26515 VPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPT 26574

Query: 625   APTV-TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P V +++ ++   + WEPP YDGGS +  Y + +++  ++ W  ++  + + T  +  K
Sbjct: 26575 GPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVAR-TMMKVMK 26633

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  GIS    S      +P     PP+   V +VT  ++T+ W  P
Sbjct: 26634 LTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 26693

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 801
                G + + GY LE     +  W  ANK +I  T F +T +        RV A NAAG  
Sbjct: 26694 VSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVG 26753

Query: 802   EPKYYSQPILVKEIIEPPK 820
             +P + S+P+L  +  EPP+
Sbjct: 26754 KPSHPSEPVLAIDACEPPR 26772



 Score =  157 bits (397), Expect = 5e-38
 Identities = 212/890 (23%), Positives = 342/890 (38%), Gaps = 93/890 (10%)

Query: 267   GGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA 326
             G  V F+ EL   K+EV+W +N   +    K+    +G    L I + +  D  EY   A
Sbjct: 12926 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIA 12985

Query: 327   GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGP 385
              D++   +L +   P + T   +D     G+ + +         A  +WFK  E     P
Sbjct: 12986 KDKEARAKLELAAAPKIKTAD-QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENE-----P 13039

Query: 386   KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLT--DQT 443
              S   I    ++    I  A K D   Y ++       A+  ++LK + +  P+   + T
Sbjct: 13040 LSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVT 13099

Query: 444   VNLGKEICLKCEISENIPGKWTKN-GLPVQESD---RLKVVHKGRIHKLVIA-NALTEDE 498
                  E+ L  E  E +    +K  G  V+  D   +  V+   R          L +  
Sbjct: 13100 ETFDGEVSLAWE--EPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGG 13157

Query: 499   GDYVFAPDAYNVTLPAKVHVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEP 553
              +Y+F   A N     +    D P     K  + G   + T+T +     R  + ++ EP
Sbjct: 13158 VEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN----RFGVSLTWEP 13213

Query: 554   PPKAMWSRGDKAIMEGSGRIR-------TESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
             P     +     ++E   +         T    D S  V D+ E  +   + +  +N  G
Sbjct: 13214 PEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYS-FRVRAQNRIG 13272

Query: 607   EAHASIK---VKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660
                 S     VKV D    P PPV  T ++       + WEPP  DGGSPILGY IER +
Sbjct: 13273 VGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCE 13332

Query: 661   KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS----------------K 704
             +    W+R N  L  E T++   + +G  Y  R+ A N  G+S                +
Sbjct: 13333 EGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVE 13392

Query: 705   PSMPSRPF---VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
             P+M    F   + + V +P T+L V S      T  W   D +   G    V        
Sbjct: 13393 PTMDLSAFKDGLEVIVPNPITIL-VPSTGYPRPTATWCFGDKVLETG--DRVKMKTLSAY 13449

Query: 762   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 821
              + +++  +  DK  +T+       K+  RVK ++  G  +    ++P   KE+      
Sbjct: 13450 AELVISPSERSDKGIYTL-------KLENRVKTIS--GEIDVNVIARPSAPKELKFGDIT 13500

Query: 822   RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR 881
             +   HL        G +       + +     TW K    +   +  + +         +
Sbjct: 13501 KDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFK 13560

Query: 882   KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
                R+  G  +    VD+ V  ++        P PP+ VK  D    ++ LTW PPK+DG
Sbjct: 13561 VCARNKCGPGE-PAYVDEPVNMSTPATV----PDPPENVKWRDRTANSIFLTWDPPKNDG 13615

Query: 942   NAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATM 1001
              + I GY +++  + S +W    E    T   +T L  G  Y +RV + N  G S+ +  
Sbjct: 13616 GSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRP 13675

Query: 1002  TKESAVIARDGKIYKNPVYEDFDFSEAP---MFTQPLVNTYAIAGYNATLNCSVRGNPKP 1058
             T+E   +               D  EAP   +  + L      AG    L  +V G P+P
Sbjct: 13676 TEEIQAV---------------DTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEP 13720

Query: 1059  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
             KITW K  + +  D R  + +     T+ I      D GTY  +AVN  G
Sbjct: 13721 KITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG 13770



 Score =  157 bits (397), Expect = 5e-38
 Identities = 146/550 (26%), Positives = 232/550 (42%), Gaps = 42/550 (7%)

Query: 360   ELEC-EVSEDDANVKWFK----NGEEII-----------PGPKSRYRIRVEGKKHILIIE 403
             ELE   +S+D   ++W K     G+EI+              K   + R++ K+    I 
Sbjct: 30436 ELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ--FTIG 30493

Query: 404   GATKADAAEYSVMT---TGGQSSAKLSVDLKPLK-------ILTPLTDQTVNLGKEICLK 453
             G  +A   E+ V     TG     + ++ +K          I   + D T  LG+   L 
Sbjct: 30494 GLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLS 30553

Query: 454   CEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYN 509
             C+I    +P  KW + G  + +S + K+   GR H L +     EDEG Y  +   +   
Sbjct: 30554 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 30613

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             V   +K+ +   P+    G           G+ LRL +   G P P   W  G K +++ 
Sbjct: 30614 VETSSKLLLQATPQFH-PGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK-LLQN 30671

Query: 570   SGRIRTESYPDSSTLVI-DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
             S  I  E+    + LV+ ++  +  +G Y + L N  G   A + V++ D PD P  P V
Sbjct: 30672 SENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV 30731

Query: 629   TE-VGDDWCIMNWEPPAYDGGSPILGYFIER-KKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              E +  +  +++W+PPA DGGS I  Y +E+ + K+ + W  ++  +   TT     + E
Sbjct: 30732 IEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAI-SVTTCRIVNLTE 30790

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
                Y  R+ A N  GIS P   S   +   P      P   T+ +VT  +  + W+PP  
Sbjct: 30791 NAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPAS 30850

Query: 744   IGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 803
              G A +  Y LE   +    WI    + I +T F++  L    +   RVK  N  G SE 
Sbjct: 30851 DGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEW 30910

Query: 804   KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEID 863
                S+PI  K  +          L+   +R    A  LV    G P+P + W + G EI 
Sbjct: 30911 SEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNA-TLVCKVTGHPKPIVKWYRQGKEII 30969

Query: 864   KNQINIRNSE 873
              + +  R  E
Sbjct: 30970 ADGLKYRIQE 30979



 Score =  156 bits (395), Expect = 9e-38
 Identities = 103/340 (30%), Positives = 163/340 (47%), Gaps = 15/340 (4%)

Query: 491   ANALTEDEGDYVFAPDAYNVT---LPAKVHVIDPPKIILDGLDA----DNTVTVIAGNKL 543
             A  LTE + +Y F   A N      P+++ V+    ++   LD     D        +  
Sbjct: 19942 AKDLTEGK-EYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF 20000

Query: 544   RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN 603
             RL+IPI G+P P   W +G+  +   + R+  ES   ++TL++   ++ D+G Y I LKN
Sbjct: 20001 RLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKN 20059

Query: 604   EAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
              AG    +I +KVV  P  P  P    EV  +   + W PP  DGGS I  Y +E++   
Sbjct: 20060 VAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSV 20119

Query: 663   SSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             +++W+       ++TTF   ++ EG+ Y  R+ A N  G+ +  + S P V   P  V  
Sbjct: 20120 NNKWVTCA-SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPD 20177

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTI 779
              P    +  V   +V++ W  P   G + + GY LE+    +  W  ANK  I    F +
Sbjct: 20178 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKV 20237

Query: 780   TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
             TGL    +   RV A+N AG  +P   S+P++  + I+PP
Sbjct: 20238 TGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 20277



 Score =  155 bits (391), Expect = 3e-37
 Identities = 98/310 (31%), Positives = 156/310 (50%), Gaps = 8/310 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P++ L G+     V   AG+ +++EIP+ G P P   W +GD+ I++ + R+  E+   S
Sbjct: 21063 PELDLRGI-YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQ-ILKQTQRVNFETTATS 21120

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             + L I+   R DSG Y +  +N  GE    I ++V D P PP  P    EV  D+   +W
Sbjct: 21121 TILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSW 21180

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGG PI  Y +E ++  S+ W+ L   + + TT++  ++  G+ Y+ R+ A N  
Sbjct: 21181 DPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRY 21239

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+  P + S   V   P  V  PP    V +VT  ++T+ W  P   G + + GY +E  
Sbjct: 21240 GVG-PGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERK 21298

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                   W   +K L+    F  +GL        RV A N AG S+P   S+P+L  + I+
Sbjct: 21299 ERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPID 21358

Query: 818   PPKIRIPRHL 827
             PP   +P ++
Sbjct: 21359 PPGKPVPLNI 21368



 Score =  154 bits (389), Expect = 5e-37
 Identities = 103/318 (32%), Positives = 157/318 (49%), Gaps = 10/318 (3%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   +V + AK  VI P   +L      NT TV+AG  L++++P  G P P   W + D 
Sbjct: 22132 PRQLSVPVIAKDLVIPPAFKLLF-----NTFTVLAGEDLKVDVPFIGRPTPAVTWHK-DN 22185

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R+  ES  ++S L I  A R+D G Y + L N AGEA  ++ V V+D P PP 
Sbjct: 22186 VPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPT 22245

Query: 625   APT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P  + EV  D   ++W PP YDGGS I  Y +E++   ++ W  ++  + + TT +  +
Sbjct: 22246 GPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVAR-TTIKACR 22304

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  G S    S P+    P  V  PP    V   +  ++ ++W  P
Sbjct: 22305 LKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEP 22364

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 801
                G + + GY LE     +  W+  NK  I +TKF  TGL    +   RV A N  G  
Sbjct: 22365 ISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIG 22424

Query: 802   EPKYYSQPILVKEIIEPP 819
             +P   S+  + ++  +PP
Sbjct: 22425 KPSKVSECYVARDPCDPP 22442



 Score =  150 bits (380), Expect = 5e-36
 Identities = 211/898 (23%), Positives = 350/898 (38%), Gaps = 95/898 (10%)

Query: 254  FAKILDPAYQVDKGGRVRFVVELA-DPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFIN 312
            F K L+P+  V +    R+  ++   P+++V WYK+  EI+ S+K+         +L ++
Sbjct: 7307 FIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMH 7366

Query: 313  NCQMTDDSEY----YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SE 367
            N  + D  +Y    +  AG    ST L V+EPPI   K+        G  V LECE+   
Sbjct: 7367 NLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIF-RKKPHPIETLKGADVHLECELQGT 7425

Query: 368  DDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG--GQSSAK 425
               +V W+K+  E+  G K  Y+I  E     + I     AD  EY    T   G  +  
Sbjct: 7426 PPFHVSWYKDKRELRSGKK--YKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCV 7483

Query: 426  LSVDLK-PLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKN-GLPVQESDRLKVVH 481
             S+ LK P + +  L+D +  +GKE+ L+  I  +E I   W K+ G  V+ESD + + +
Sbjct: 7484 GSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY 7543

Query: 482  KGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIA 539
               I  L  +     + G Y      DA      A + V++P  I+    +   ++ V  
Sbjct: 7544 SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIV----EKPESIKVTT 7599

Query: 540  GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            G+   LE  ++G P     W +  K  +    + +   +   S L I      DSGVY  
Sbjct: 7600 GDTCTLECTVAGTPELSTKWFKDGKE-LTSDNKYKISFFNKVSGLKIINVAPSDSGVYSF 7658

Query: 600  NLKNEAGEAHASIKVKVVDFPDPP--VAPTVTEVGDDWCIMNWEPPAYDGGSPI-LGYFI 656
             ++N  G+   +  ++V D   PP          G     +  E   Y G  PI + +F 
Sbjct: 7659 EVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVY-GSPPISVSWFH 7717

Query: 657  ERKKKQSSRWMR--LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVP 714
            E  +  S R  +  L  + C  T      + E  + +    A N  G  + S       P
Sbjct: 7718 EGNEISSGRKYQTTLTDNTCALTV---NMLEESDSGDYTCIATNMAGSDECS------AP 7768

Query: 715  LAVTSPPTLL----TVDSVTDTTVT----MRWRPPDHIGAAGLDGYVL--EYCFEGTEDW 764
            L V  PP+ +     +D +T T VT    ++  PP  +        ++  + C    ED 
Sbjct: 7769 LTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLED- 7827

Query: 765  IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIP 824
             VA  +L D      T    +    V  +A  A+  +     +    VK +         
Sbjct: 7828 SVAELELFD----VDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRL--------- 7874

Query: 825  RHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKA 883
                  Y    G+ + L   F G P   +TWKK+G  +  +Q  NI  +E   I+ I  +
Sbjct: 7875 ----NDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSS 7930

Query: 884  ERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-----PPQIVKIEDVWGENVALTWTPPK 938
                +G+Y+  ++     ++ S  I I++ P       P  V + D       L  TP  
Sbjct: 7931 TVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPE- 7989

Query: 939  DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSED 998
                    G +  K D K     T   H+    AT+            VF++     S +
Sbjct: 7990 -------IGVSWYKGDTKLRPTTTYKMHFRNNVATL------------VFNQVDINDSGE 8030

Query: 999  ATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1058
                 E++V    G++  +      +    P F++ L +     G     +C++ G+   
Sbjct: 8031 YICKAENSV----GEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPI 8086

Query: 1059 KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
             ++W K+   + D P  +        TL I K      G Y C A N +G+     +L
Sbjct: 8087 SVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARL 8144



 Score =  149 bits (375), Expect = 2e-35
 Identities = 97/304 (31%), Positives = 142/304 (46%), Gaps = 5/304 (1%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ID P   LD    D  + V AG    LE  I G+P P  +WS+  K + E + R+  +S 
Sbjct: 24702 IDAPNASLDPKYKD-VIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 24760

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCI 637
                +TLV+    R D G Y + L N  G     I VKV+D P PP  P  VT V  + C 
Sbjct: 24761 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 24820

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + W PP  DGG+ I  Y IE+++     W +++ ++ +   ++  K++ G  Y  R+ AV
Sbjct: 24821 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAV 24879

Query: 698   NAIGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             N  GI +P  S P     P     PP+   V ++T  ++ + W  P   G   ++GY+LE
Sbjct: 24880 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILE 24939

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
                +    W   NK  +   +  +TGL        RV A NAAG  EP   S      + 
Sbjct: 24940 KRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDA 24999

Query: 816   IEPP 819
             + PP
Sbjct: 25000 LYPP 25003



 Score =  147 bits (372), Expect = 4e-35
 Identities = 207/916 (22%), Positives = 365/916 (39%), Gaps = 118/916 (12%)

Query: 249  KKSAAFAKILDPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
            ++  +F K +DP+Y +  G   R   +L   P ++V W+KN +E+  S          + 
Sbjct: 3734 REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEA 3793

Query: 308  ILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
            IL I + ++ D   Y   A    G + CSTE+ ++EPP  + K LE      G    L+C
Sbjct: 3794 ILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFI-KTLEPADIVRGTNALLQC 3852

Query: 364  EVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE--GATKADAAEYSVMTTG- 419
            EVS      + WFK+ ++I    +S  + R+  +K ++ +E      AD  EY  +    
Sbjct: 3853 EVSGTGPFEISWFKDKKQI----RSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANE 3908

Query: 420  -GQSSAKLSVDLKPLKILTPLTDQTVNLGKE-ICLKCEI--SENIPGKWTKNGLPVQESD 475
             G+     +  LK         D  + LG + + L+  +  SE I   W K    ++E  
Sbjct: 3909 VGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDG 3968

Query: 476  RLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADN 533
            ++K+     +  L+I +      G Y    +  A + T   ++ V +P KII    +   
Sbjct: 3969 KIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKII----ERAE 4024

Query: 534  TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
             + V AG+   LE  ++G P  K  W +  + ++  S + R     + + L    AE  D
Sbjct: 4025 LIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLV-ASKKYRISFKNNVAQLKFYSAELHD 4083

Query: 594  SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAP----TVTEVGDDWCIMNWEPPAYDGGS 649
            SG Y   + NE G +       V+D    P        V  V +  C ++ +     G  
Sbjct: 4084 SGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCK---IAGSL 4140

Query: 650  PI-LGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
            P+ + +F + K+  +S   R+ F +    + E  ++    A      A N++G SK S  
Sbjct: 4141 PMRVSWFKDGKEIAASDRYRIAF-VEGTASLEIIRVDMNDAGNFTCRATNSVG-SKDSSG 4198

Query: 709  SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG----TEDW 764
            +     L V  PP+ +T     D             G+A      L+  F+G    T  W
Sbjct: 4199 A-----LIVQEPPSFVTKPGSKDVLP----------GSA----VCLKSTFQGSTPLTIRW 4239

Query: 765  IVANKDLIDKTKFTIT--GLPTDAKIFV---------RVKAVNAAGASEPK---YYSQPI 810
               NK+L+      IT   L +  ++++           K  N AG  E     +  +P 
Sbjct: 4240 FKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPA 4299

Query: 811  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINI 869
               E +EP ++     LK+      G+A  L     G P  ++TW  +  EI + ++  +
Sbjct: 4300 TFVEKLEPSQL-----LKK------GDATQLACKVTGTPPIKITWFANDREIKESSKHRM 4348

Query: 870  RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP------GPPQIVKIE 923
               E+  ++ +       SG+Y  + + +   +  S  + + + P       P +++K  
Sbjct: 4349 SFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEY 4408

Query: 924  DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
            DV      +  TPP +     IT +      +   ++ T I+  H  S  I + V  +  
Sbjct: 4409 DVM-LLAEVAGTPPFE-----ITWFKDNTILRSGRKYKTFIQD-HLVSLQILKFVAADA- 4460

Query: 984  YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1043
                  E  C ++ +   +  SA +                  E P F + + +T ++ G
Sbjct: 4461 -----GEYQCRVTNEVGSSICSARVT---------------LREPPSFIKKIESTSSLRG 4500

Query: 1044 YNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1103
              A    +++G+    +TW+K+   I +D   RM     V +L +        G Y C+A
Sbjct: 4501 GTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQA 4560

Query: 1104 VNDLGTVEIECKLEVK 1119
             ND G       L VK
Sbjct: 4561 KNDAGIQRCSALLSVK 4576



 Score =  146 bits (369), Expect = 9e-35
 Identities = 189/864 (21%), Positives = 334/864 (38%), Gaps = 120/864 (13%)

Query: 272   FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
             F VEL+   + VKW+KN Q +  +     + +G    +   +  + D S+  V A     
Sbjct: 11948 FTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSS 12007

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
               +L V E     T +L+D T    + V L+CE+S+ DA VKWFK+G+EI P   +   I
Sbjct: 12008 EAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNA--VI 12065

Query: 392   RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             + +GKK +LI++ A K+D  +Y+      ++S KL ++ + +K++ PL    V   +   
Sbjct: 12066 KADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETAR 12125

Query: 452   LKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
              + EISE +I   W   G  + ++   ++  +G+IH LV+ N   +  G   F   A NV
Sbjct: 12126 FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANV 12183

Query: 511   TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                A + V   P++I   L     VTV AG     +  +S E  P   + +G K  +E S
Sbjct: 12184 KSSAHLRV--KPRVI-GLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKK--LEPS 12238

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
              ++   S     TL +   + +D+G   +  K+    A+  +K   V+F  P    TV E
Sbjct: 12239 DKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEE 12298

Query: 631   VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE------PKKM 684
                             G + +L   + R+  +  +W +   ++ K   +E       +K+
Sbjct: 12299 ----------------GATAVLECEVSRENAK-VKWFKNGTEILKSKKYEIVADGRVRKL 12341

Query: 685   I--EGVAYEVRIFAVNA--------IGISKPSMP-SRPFVPLAVTSPPTLLTVDSVTDTT 733
             +  +    +++ +  +A        + +  P +   RP   L V           ++   
Sbjct: 12342 VIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSREN 12401

Query: 734   VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 793
               ++W      GA    G   +   +G    +V NK L+D           +A+    V+
Sbjct: 12402 AKVKWFKD---GAEIKKGKKYDIISKGAVRILVINKCLLD----------DEAEYSCEVR 12448

Query: 794   AVNAAG----ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 849
                 +G      E   +++ +   E+ E   I++   +                    KP
Sbjct: 12449 TARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEV-------------------SKP 12489

Query: 850   RPELTWKKDGAE-IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV---KVDKFVETAS 905
               E+ W K   E I+  +  I       I+ I+ A    +G Y+ ++   + D  V+   
Sbjct: 12490 GAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHE 12549

Query: 906   IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ-KADKKSMEWFTVI 964
             +  + I +P   +I++     GE      +  K+        + +Q K D K++E     
Sbjct: 12550 LAAEFISKPQNLEILE-----GEKAEFVCSISKE-------SFPVQWKRDDKTLE----- 12592

Query: 965   EHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFD 1024
                            G++Y      +    + +DAT+      +   G            
Sbjct: 12593 --------------SGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAA---RAAAHLT 12635

Query: 1025  FSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVC 1084
               E      PL +T          NC V      K  W +N+ AI D  +Y +     V 
Sbjct: 12636 VIEKLRIVVPLKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSKYIILQKDLVY 12694

Query: 1085  TLEIRKPSPYDGGTYCCKAVNDLG 1108
             TL IR     D   Y     N  G
Sbjct: 12695 TLRIRDAHLDDQANYNVSLTNHRG 12718



 Score =  146 bits (369), Expect = 9e-35
 Identities = 96/339 (28%), Positives = 169/339 (49%), Gaps = 21/339 (6%)

Query: 496   EDEGDYVF---APDAYNVTLPAK----VHVID---PPKIILDGLDADNTVTVIAGNKLRL 545
             E++  Y F   A  A N++ P++    V ++    PP+I L  +   + +TV AG  + L
Sbjct: 19257 EEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS-VAMKSLLTVKAGTNVCL 19315

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
             +  + G+P P   W + D  +++ +  I+     +  TL +    R DSG Y I  +N +
Sbjct: 19316 DATVFGKPMPTVSWKK-DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSS 19374

Query: 606   GEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSR 665
             G   A+IK+KV+D P PP +  + ++  D  +++WEPP  DGGS I  Y +++++     
Sbjct: 19375 GSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPN 19434

Query: 666   WMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGI-----SKPSMPSRPFVPLAVTSP 720
             W +++  +   T+   +K+IEG  Y+ RI A N  G+     ++P++   P+ P     P
Sbjct: 19435 WAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 19493

Query: 721   PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT 780
             P    + ++T   +T+ W+PP   G + + GY+LE       +W   N+  I +     T
Sbjct: 19494 P---VISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKAT 19550

Query: 781   GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
             GL    +   RV A+N AG  +P   S+    ++   PP
Sbjct: 19551 GLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP 19589



 Score =  145 bits (365), Expect = 3e-34
 Identities = 110/374 (29%), Positives = 173/374 (46%), Gaps = 19/374 (5%)

Query: 263   QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             QV +    RF  EL+    +VKW+K+G EI+   KY    KG  RIL IN C + D++EY
Sbjct: 12384 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 12443

Query: 323   YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII 382
                    + S  L V E   + TK L +      + ++L CEVS+  A V W+K  EEII
Sbjct: 12444 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 12503

Query: 383   PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 442
                  RY I  EG+K IL+I+ A   DA  Y+      ++  K+ V     + ++   + 
Sbjct: 12504 --ETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL 12561

Query: 443   TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
              +  G++    C IS E+ P +W ++   ++  D+  V+  G+   LV+ +A  +D G Y
Sbjct: 12562 EILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTY 12621

Query: 502   VF----APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKA 557
             V     A  A ++T+  K+ ++ P K        D  V          E+   G    KA
Sbjct: 12622 VVMVGAARAAAHLTVIEKLRIVVPLK--------DTRVKEQQEVVFNCEVNTEG---AKA 12670

Query: 558   MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV 617
              W R ++AI + S  I  +      TL I  A  DD   Y+++L N  GE   S    +V
Sbjct: 12671 KWFRNEEAIFDSSKYIILQK-DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV 12729

Query: 618   DFPDPPVAPTVTEV 631
             +  D  +   + ++
Sbjct: 12730 EEEDLRIVEPLKDI 12743



 Score =  144 bits (362), Expect = 6e-34
 Identities = 89/302 (29%), Positives = 150/302 (49%), Gaps = 8/302 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P   L G+  +  +T  AG+   +++PISG P PK  W   +  + E + R+   +  D 
Sbjct: 28645 PTADLTGI-TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE-TDRVSITTTKDR 28702

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             +TL +  + R DSG Y + L+N AG    S+ V V+  P P   P  V+ V  + C+++W
Sbjct: 28703 TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSW 28762

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P   GG+ I  Y +E+++  ++ W  +N  + K T  +   + + + Y  R+ + N  
Sbjct: 28763 GEPKDGGGTEITNYIVEKRESGTTAWQLVNSSV-KRTQIKVTHLTKYMEYSFRVSSENRF 28821

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+SKP + S P +   P    S PT   V  V+   +++RW  P H G + + GY +E  
Sbjct: 28822 GVSKP-LESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKK 28880

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                T  W+  NK    +  + +TGL    +   R  A+NAAG S+    S+PI+ +  ++
Sbjct: 28881 ERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 28940

Query: 818   PP 819
              P
Sbjct: 28941 AP 28942



 Score =  142 bits (359), Expect = 1e-33
 Identities = 133/536 (24%), Positives = 207/536 (38%), Gaps = 70/536 (13%)

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
             +D P PP  PTV +VG     +NW  P +DGG+ I  Y IE  K  +  W+R+   +   
Sbjct: 13981 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTT 14040

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTT 733
                 P  M EG  Y  R+ AVN  G S+PS PS P +    L   SPP  L V ++T  T
Sbjct: 14041 QHLLPGLM-EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 14099

Query: 734   VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 793
               ++W  P+  G + +  Y++E      + W   +  + D TK T+T L   +    RV 
Sbjct: 14100 ADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKD-TKCTVTPLTEGSLYVFRVA 14158

Query: 794   AVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 853
             A NA G S+       +L K+    P                G    L +    K   +L
Sbjct: 14159 AENAIGQSDYTEIEDSVLAKDTFTTP----------------GPPYALAVVDVTKRHVDL 14202

Query: 854   TW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI 910
              W   K DG    +  +  +     T    R  +   +   D   +V   +E   +  Q+
Sbjct: 14203 KWEPPKNDGGRPIQRYVIEKKERLGT----RWVKAGKTAGPDCNFRVTDVIEGTEVQFQV 14258

Query: 911   -----------------------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITG 947
                                       P PP  + + D   +++A+ W PP+ +G + I G
Sbjct: 14259 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 14318

Query: 948   YTIQKADKKSMEWFTVIEHYHRTSATITE--LVIGNEYYFRVFSENMCGLSEDATMTKES 1005
             Y ++     + +W  V     +      E  +V   EY  RV + N  G+SE + +++  
Sbjct: 14319 YHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISEN- 14377

Query: 1006  AVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKN 1065
              V+A+D         E  D                I G   ++    R  P P ++W K+
Sbjct: 14378 -VVAKDPDCKPTIDLETHDI-------------IVIEGEKLSIPVPFRAVPVPTVSWHKD 14423

Query: 1066  KVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
                +    R  M ++     LE+ K    D G Y     N LG+      + VKVI
Sbjct: 14424 GKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSA--TASINVKVI 14477



 Score =  140 bits (352), Expect = 9e-33
 Identities = 91/298 (30%), Positives = 146/298 (48%), Gaps = 7/298 (2%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PPK  LD     + VT+ AG+ L L+  + G+P PK +W++GDK  ++   ++  +    
Sbjct: 29043 PPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKE-LDLCEKVSLQYTGK 29101

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              +T VI   +R DSG Y + +KN +G    S+ VKV+D P P    TV+ V  + C + W
Sbjct: 29102 RATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAW 29161

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGG+ I  Y +ER++     W+ +  + C   ++   ++I+   Y  R+ AVN  
Sbjct: 29162 SLPQEDGGAEITHYIVERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKY 29220

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P + S P V      + SPP +          + ++W  P+  G   +  Y+++  
Sbjct: 29221 GPGVP-VESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKR 29279

Query: 758   FEGTEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKE 814
              + +  W   NKD ++  T+  +T L        RV AVNAAG SEP   S  I  +E
Sbjct: 29280 EKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCRE 29337



 Score =  139 bits (350), Expect = 2e-32
 Identities = 158/612 (25%), Positives = 260/612 (42%), Gaps = 77/612 (12%)

Query: 267   GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
             GG +R  V +   P  EVKW K   EIR +   I +       L ++N    D  +Y +T
Sbjct: 22957 GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFTSLVLDNVNRYDSGKYTLT 23014

Query: 326   AGDEKCSTELFVR-------EPPI--MVTKQLEDTTAYCGERVELECE-------VSEDD 369
               +   +   FV         PP+   VT+  +D+ +   E   L+         V + +
Sbjct: 23015 LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKRE 23074

Query: 370   ANVKWF--------KNG---EEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
             A  K +        KN    +++  G    +R+  E +  I        A  A+   +  
Sbjct: 23075 ATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI-----GLPAQTADPIKVAE 23129

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESD 475
               Q   K++VD         +T  +V+L     E     +I + I     K+     E  
Sbjct: 23130 VPQPPGKITVD--------DVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA 23181

Query: 476   RLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN-----------VTLPAKVHVIDPPKI 524
             R+K +      + VI N LT+ E +Y+F   A N           V + AK  VI+P   
Sbjct: 23182 RVKSL------QAVITN-LTQGE-EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP--- 23230

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTL 584
               D   A ++ +V  G  L++E+PISG P P   W++ D   ++ + RI      D +TL
Sbjct: 23231 --DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTK-DGLPLKQTTRINVTDSLDLTTL 23287

Query: 585   VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPP 643
              I    +DD G Y I + N  G+  ASI++  +D PDPP  P    +V  +   ++W PP
Sbjct: 23288 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPP 23347

Query: 644   AYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
              Y GG  I  Y ++++   ++ W  ++  + + TT +  K+  G  Y+ RIFA N  G S
Sbjct: 23348 LYTGGCQITNYIVQKRDTTTTVWDVVSATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQS 23406

Query: 704   KPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
               ++ S P V   P     PP      +++  ++ ++W  P + G + + GY LE     
Sbjct: 23407 F-ALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERN 23465

Query: 761   TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             +  W   NK +I  T+F    L    +   RV A N  G  +    S+  + ++  +PP 
Sbjct: 23466 SILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPG 23525

Query: 821   IRIPRHLKQTYI 832
                P  +K+  I
Sbjct: 23526 TPEPIMVKRNEI 23537



 Score =  138 bits (347), Expect = 3e-32
 Identities = 89/302 (29%), Positives = 146/302 (48%), Gaps = 6/302 (1%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P I+  G +  + + + +G  LR++  + G P P+  W + D   +E    +       S
Sbjct: 27955 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGS 28013

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             ++L +  A RD  GVY +  KN +G A A IKVKV D P   V P   T +  +   + W
Sbjct: 28014 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWW 28073

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             + P  DG +PI  Y IE+++     W  +  D C+  ++   K+I G  Y+ R+ AVN  
Sbjct: 28074 DAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNEYQFRVSAVNKF 28132

Query: 701   GISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
             G+ +P  S P    +   V   P +    ++T  ++T+ W  P+  G + +  Y+LE   
Sbjct: 28133 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERRE 28192

Query: 759   EGTEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
             + +  W+ V +K  I +T+F +TGL    +    V A NAAG       S+ I  +E + 
Sbjct: 28193 KKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVN 28252

Query: 818   PP 819
             PP
Sbjct: 28253 PP 28254



 Score =  136 bits (343), Expect = 1e-31
 Identities = 105/376 (27%), Positives = 169/376 (44%), Gaps = 13/376 (3%)

Query: 247  EEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQ 306
            + K+   F + L      +K     F  E ++P ++VKWYK+G E+    KY        
Sbjct: 2169 QAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKV 2228

Query: 307  RILFINNCQMTDDSEY-YVTAGDE--KCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
              L I     +D  +Y  V   DE  K + +L V    +   K+L+D         ELEC
Sbjct: 2229 HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC 2288

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS 423
             VS ++   KW+ N  E+      +Y I     +  L ++  TK D  EYS +  G +++
Sbjct: 2289 IVSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT 2346

Query: 424  AKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHK 482
             KL +  +P+ IL  L+DQ V  G  + L+ ++S E++ G W K+G  VQ SDR+ +V  
Sbjct: 2347 CKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID 2406

Query: 483  GRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNK 542
             + H L+I +   ED G+Y F   A  ++   +V V       +D +     V VI G K
Sbjct: 2407 KQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-----VDVITPLKDVNVIEGTK 2461

Query: 543  LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
              LE  +S        W   D+ I +   R++         LVI+     D G Y + + 
Sbjct: 2462 AVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2520

Query: 603  NEAGEAHASI-KVKVV 617
                  + S+ K+K++
Sbjct: 2521 RVETNCNLSVEKIKII 2536



 Score =  134 bits (338), Expect = 4e-31
 Identities = 201/832 (24%), Positives = 325/832 (39%), Gaps = 120/832 (14%)

Query: 337   VREPPIMVTKQLEDTTAY-CGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
             V  P I V  + +DT     GE   LE +VS      ++W K+G+E+     ++  I++ 
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL--EGTAKLEIKIA 21513

Query: 395   GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC 454
                  L+ + +T+ D+  Y++  T     AK   ++K L    P  +  + + +    KC
Sbjct: 21514 DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP-PEGPLAVTEVTSEKC 21572

Query: 455   EISENIP-----GKWTKNGLPVQESDRL---KVVHKGRIHKLVIANALTEDEGDY-VFAP 505
              +S   P      K     +  +E+ RL    V  + ++ KL +   L  +E  + V A 
Sbjct: 21573 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV 21632

Query: 506   DAYNVTLPAKVHVI---------DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             + Y V  P +   +         DPPK        +  VT I  + +   +   G P   
Sbjct: 21633 NKYGVGEPLESEPVLAVNPYGPPDPPK--------NPEVTTITKDSM---VVCWGHPDSD 21681

Query: 557   A-------MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                     +  R DKA      +   ++  D    V  + E  +   + I  +N AG   
Sbjct: 21682 GGSEIINYIVERRDKAGQRWI-KCNKKTLTDLRYKVSGLTEGHEYE-FRIMAENAAGISA 21739

Query: 607   EAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQS 663
              +  S   K  D    P PP  P V +       + W  P YDGGS I GY +E    + 
Sbjct: 21740 PSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEE 21799

Query: 664   SRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM-PSRPFVPLAVTSPP 721
               W  +      K T++    + E   Y++RI+A+N+ G+ +P++ P  P     +  P 
Sbjct: 21800 DEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPE 21859

Query: 722   TLLTVDSVTDTT----------VTMRWRPPDHIGAAGLDGYVLEYC-FEGTEDW---IVA 767
               L  D     T          V ++ RP   +  A   G  L+    E T  +   IV 
Sbjct: 21860 IELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVG 21919

Query: 768   NKDLIDKTKF--TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII--------E 817
             N +  D  K+  T+         FV V+ ++  G        Q + VKE+         +
Sbjct: 21920 NVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPP------QDLKVKEVTKTSVTLTWD 21973

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI 877
             PP +     +K  YI    E+             + +WK D  +           E  + 
Sbjct: 21974 PPLLDGGSKIKN-YIVEKRESTRKAYSTVATNCHKTSWKVDQLQ-----------EGCSY 22021

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 937
              F   AE  +         +    ETA   ++  +RP PP  + + DV   +V+L+W  P
Sbjct: 22022 YFRVLAENEYG--------IGLPAETAE-SVKASERPLPPGKITLMDVTRNSVSLSWEKP 22072

Query: 938   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             + DG + I GY ++   K S +W T       T ATIT L+ G EY FRV ++N  G+S+
Sbjct: 22073 EHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFRVSAQNEKGISD 22131

Query: 998   DATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNP 1056
                ++    VIA+D  I              P   + L NT+ + AG +  ++    G P
Sbjct: 22132 PRQLSVP--VIAKDLVI--------------PPAFKLLFNTFTVLAGEDLKVDVPFIGRP 22175

Query: 1057  KPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              P +TW K+ V +    R    S +    L I+     D G Y  K  N  G
Sbjct: 22176 TPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG 22227



 Score =  133 bits (334), Expect = 1e-30
 Identities = 211/901 (23%), Positives = 358/901 (39%), Gaps = 95/901 (10%)

Query: 254  FAKILDPAYQVDKGGRVRFVVELA-DPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFIN 312
            F K L+ +  V  G   R   ++A  P++ V W++N  E+  S KY         ++ +N
Sbjct: 5425 FVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMN 5484

Query: 313  NCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            N    D  ++   A    G   CST++ V+EPP+  +      T    E V LECE+S  
Sbjct: 5485 NLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAE-VSLECELSGT 5543

Query: 369  DA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG--GQSSAK 425
                V W+K+  ++    K  Y+I  +     + I     +D  EY        G  +  
Sbjct: 5544 PPFEVVWYKDKRQLRSSKK--YKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCV 5601

Query: 426  LSVDLK-PLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPV-QESDRLKVVH 481
             +V LK P + ++ L   TV  G+   L+  I  ++ I  +W K    V +ES+ +++  
Sbjct: 5602 CTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITF 5661

Query: 482  KGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIA 539
               +  L  A A   + G Y+     D       A + V++P  I+    +    +TV  
Sbjct: 5662 VENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIV----EKAGPMTVTV 5717

Query: 540  GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            G    LE  ++G P     W +  K ++  S + +   Y   S+L I   ER D+G Y  
Sbjct: 5718 GETCTLECKVAGTPELSVEWYKDGK-LLTSSQKHKFSFYNKISSLRILSVERQDAGTYTF 5776

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-------VGDDWCIMNWEPPAYDGGSPI- 651
             ++N  G++  +    VVD  D  V P+ T        V    CI+  +     G SPI 
Sbjct: 5777 QVQNNVGKSSCT---AVVDVSDRAVPPSFTRRLKNTGGVLGASCILECK---VAGSSPIS 5830

Query: 652  LGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
            + +F E+ K  S    +  F  ++C   T +   +           A N  G  +     
Sbjct: 5831 VAWFHEKTKIVSGAKYQTTFSDNVC---TLQLNSLDSSDMGNYTCVAANVAGSDECRAVL 5887

Query: 710  RPFVPLAVTSPPTLLTV---DSVTDTTVTMRWRPPDHI----GAAGL-DGYVLEYCFEGT 761
                P +    P  L V    +VT T+V +R  PP  +    GA  L  G      FE T
Sbjct: 5888 TVQEPPSFVKEPEPLEVLPGKNVTFTSV-IRGTPPFKVNWFRGARELVKGDRCNIYFEDT 5946

Query: 762  -EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
              +  + N D+    ++T             V + NA  AS     +  + VKE     K
Sbjct: 5947 VAELELFNIDISQSGEYTC------------VVSNNAGQAS----CTTRLFVKEPAAFLK 5990

Query: 821  IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIF 879
             R+  H  +      G+++ L   + G     +TWKKDG  I  ++  NI  +E   I+ 
Sbjct: 5991 -RLSDHSVEP-----GKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILE 6044

Query: 880  IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP-GPPQIVKIEDVWGENVALTWTPPK 938
            I  + +  +G+Y  +++ +   +     +  ++ P    ++  +E   G++V+L     +
Sbjct: 6045 ILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQC---Q 6101

Query: 939  DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSED 998
              G   IT  +  K D K         ++    AT+            VF++     S +
Sbjct: 6102 VAGTPEIT-VSWYKGDTKLRPTPEYRTYFTNNVATL------------VFNKVNINDSGE 6148

Query: 999  ATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1058
             T   E+++    G      V+   +    P F + L +     G   TL C + G+   
Sbjct: 6149 YTCKAENSI----GTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPI 6204

Query: 1059 KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
            ++ W ++ V + DD   +      V TL+I +      G Y C A N LGT     +L  
Sbjct: 6205 QVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTA 6264

Query: 1119 K 1119
            +
Sbjct: 6265 R 6265



 Score =  132 bits (332), Expect = 2e-30
 Identities = 198/908 (21%), Positives = 342/908 (37%), Gaps = 94/908 (10%)

Query: 249  KKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
            K+ A F + L+P+  + KG   +   ++   P +++ W+ N +EI+ S+K+         
Sbjct: 4296 KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTA 4355

Query: 308  ILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
            +L + +  + D  EY   A    G + CS+ + V+E P   TK+ +         V L  
Sbjct: 4356 VLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYF-TKEFKPIEVLKEYDVMLLA 4414

Query: 364  EVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG--G 420
            EV+      + WFK+   +  G K  Y+  ++     L I     ADA EY    T   G
Sbjct: 4415 EVAGTPPFEITWFKDNTILRSGRK--YKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVG 4472

Query: 421  QSSAKLSVDLKPLKILTPLTDQTVNL-GKEICLKCEISENIP--GKWTKNGLPVQESDRL 477
             S     V L+         + T +L G     +  +  ++P    W K+   + E D +
Sbjct: 4473 SSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNI 4532

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKVHVIDPPKIILDGLDADNTV 535
            ++  +  +  L ++    + +G YV     DA      A + V +P  I  + +  D   
Sbjct: 4533 RMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSID--- 4589

Query: 536  TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSG 595
             V  G+   L++  SG     A W +  + +  GS + +       S L I   E+ DSG
Sbjct: 4590 -VTQGDPATLQVKFSGTKEITAKWFKDGQELTLGS-KYKISVTDTVSILKIISTEKKDSG 4647

Query: 596  VYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF 655
             Y   ++N+ G +    ++ V+D   PP      +  D       +      GS  +   
Sbjct: 4648 EYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQ 4707

Query: 656  IERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV-AYEVRIFAVNAIGISKPSMPSRPFVP 714
              +  ++ S   +  F     T F     +EG  +      A N  G ++ S        
Sbjct: 4708 WFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS------GH 4761

Query: 715  LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDL--- 771
            L V  PP  +      D     R +    +G               T  W   NK+L   
Sbjct: 4762 LTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTA----------PMTIKWFKDNKELHSG 4811

Query: 772  ------IDKTKFTI---TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR 822
                   D T  ++       TD+  ++  +  N  G +  K     + VKE   P  I+
Sbjct: 4812 AARSVWKDDTSTSLELFAAKATDSGTYI-CQLSNDVGTATSK---ATLFVKE--PPQFIK 4865

Query: 823  IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN-IRNSETDTIIFIR 881
             P       + R G++        G P+  ++W  DG EI   Q + I   +      I 
Sbjct: 4866 KP---SPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQIS 4922

Query: 882  KAERSHSGKYDLQVKVDKFVETASIDIQIIDRP------GPPQIVKIEDVWGENVALTWT 935
             A   +SG Y  + + D    + SI++++ + P       P ++VK  DV  E   +T T
Sbjct: 4923 GARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELE-CEVTGT 4981

Query: 936  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
            PP +        +     + +S + +T+ +     +  IT+    +        E  C +
Sbjct: 4982 PPFE------VTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDT------GEYQCIV 5029

Query: 996  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
            S +      S  +A                 E P F + + NT  +   +AT   +V G+
Sbjct: 5030 SNEGGSCSCSTRVA---------------LKEPPSFIKKIENTTTVLKSSATFQSTVAGS 5074

Query: 1056 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
            P   ITW+K+   + +D    +     V TL+IR       G Y C+A N+ G       
Sbjct: 5075 PPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAF 5134

Query: 1116 LEVKVIAQ 1123
            L V+  AQ
Sbjct: 5135 LLVQEPAQ 5142



 Score =  131 bits (329), Expect = 4e-30
 Identities = 135/530 (25%), Positives = 203/530 (38%), Gaps = 77/530 (14%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETT 678
             P PP  P V +       ++W  PAYDGGSPI+GY +E K+  S  W+R N     ++T 
Sbjct: 19589 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 19648

Query: 679   FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPP----------TLLTVDS 728
             FE   ++E   Y+ R++AVN IG S PS       P  +  PP          TL+    
Sbjct: 19649 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 19708

Query: 729   VT-DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAK 787
             VT    V ++ RPP  I                   W   N +L D+    I    TD  
Sbjct: 19709 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKS--TDFD 19748

Query: 788   IFVRVKAVNAAGASE----------PKYYSQPILVKEIIEPP-KIRIPRHLKQT------ 830
              F+R + VN   A +           K Y+  + V +   PP  + +    K +      
Sbjct: 19749 TFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWE 19808

Query: 831   --YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHS 888
                I      +N V+  Q +     +W     E  K    + N E     F R    +  
Sbjct: 19809 PPIIDGGSPIINYVV--QKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEY 19866

Query: 889   GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 948
             G  D     D         ++    PGP   +K+  V   + ++ W  P  DG + I GY
Sbjct: 19867 GIGDPGETRDA--------VKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGY 19918

Query: 949   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1008
              +    +++ +W  V++       +  +L  G EY FRV +EN  G    + +T    V+
Sbjct: 19919 VVDFLTEEN-KWQRVMKSL-SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT----VV 19972

Query: 1009  ARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVA 1068
             ARD     + V  D D    P          A    N  L   ++G P P ++W K +  
Sbjct: 19973 ARD-----DVVAPDLDLKGLPDLCY-----LAKENSNFRLKIPIKGKPAPSVSWKKGEDP 20022

Query: 1069  IVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             +  D R  + S+    TL +      D G Y     N  GT E    ++V
Sbjct: 20023 LATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKV 20072



 Score =  130 bits (328), Expect = 5e-30
 Identities = 80/234 (34%), Positives = 120/234 (51%), Gaps = 8/234 (3%)

Query: 272  FVVELADPKLE-VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            F VEL  P ++ V+W KNG  +  + KY    KG    L I NC + D+S Y    G   
Sbjct: 2726 FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2785

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S  L V    + + K+ +D TA     V  E  VS D   VKWF    EI P  K  +R
Sbjct: 2786 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK--HR 2841

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            +  E K H L+++  + +DA EY+ +   GQ   K  + ++ L I   + +  V   K  
Sbjct: 2842 LVSERKVHKLMLQNISPSDAGEYTAVV--GQLECKAKLFVETLHITKTMKNIEVPETKTA 2899

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              +CE+S  N+P  W KNG+ ++ S++ K+V +G++H+L+I N  TED  +Y F
Sbjct: 2900 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF 2953



 Score =  129 bits (324), Expect = 2e-29
 Identities = 123/461 (26%), Positives = 196/461 (42%), Gaps = 58/461 (12%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVID 520
             KWTK G  +  S R  +       +LVI  A   D G Y  V         +  KV VI 
Sbjct: 30169 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIG 30226

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP------------------PKAMWSRG 562
              P      L+ D+             + +S  PP                  PKA W   
Sbjct: 30227 SPNSPEGPLEYDDIQV--------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTI 30278

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKV- 616
             D        R+R       ++LV+   + +    + ++ +N+ G     ++   +  K  
Sbjct: 30279 DS-------RVR------GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP 30325

Query: 617   VDFPDPPV-APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
             ++ P+PP   P V +V      ++W  P  DGGS + GY+IERK+  + +W+R N     
Sbjct: 30326 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 30385

Query: 676   ETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDT 732
              T +    ++    Y+ RI A N +G+S+ S  S P V   P    S P  L + S++  
Sbjct: 30386 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 30445

Query: 733   TVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 792
             +VT++W  P+  G   + GY +EY   G   W  +NK+ I   +FTI GL    +   RV
Sbjct: 30446 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRV 30505

Query: 793   KAVNAAGASEPKYYSQPILVKEII-EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 851
              A N  G S P+  +  I  K    E P IR  + +K     ++GEA  L     G+P P
Sbjct: 30506 FAENETGLSRPRRTAMSIKTKLTSGEAPGIR--KEMKDV-TTKLGEAAQLSCQIVGRPLP 30562

Query: 852   ELTWKKDGAEIDKNQINIRNSETDT-IIFIRKAERSHSGKY 891
             ++ W + G E+ +++    +S+  T  + +   E+   G Y
Sbjct: 30563 DIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 30603



 Score =  128 bits (322), Expect = 3e-29
 Identities = 199/880 (22%), Positives = 337/880 (38%), Gaps = 84/880 (9%)

Query: 279  PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTE 334
            P + V W+  G EI    KY          L +N  + +D  +Y   A    G ++CS  
Sbjct: 7709 PPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAP 7768

Query: 335  LFVREPPIMVTKQLEDTTAYCGERVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRV 393
            L VREPP  V K  +      G  V     V      +V WFK   E++PG   R  + +
Sbjct: 7769 LTVREPPSFVQKP-DPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPG--DRCNVSL 7825

Query: 394  EGKKHILIIEGATKADAAEYS--VMTTGGQSSAKLSVDLK-PLKILTPLTDQTVNLGKEI 450
            E     L +     + + EY+  V    G++S    + +K P K +  L D ++  GK +
Sbjct: 7826 EDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPL 7885

Query: 451  CLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDA 507
             L+   +   P    W KNG+ V  S R  +    +   L I ++  ED G Y  +  +A
Sbjct: 7886 ILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENA 7945

Query: 508  YNV-TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                +  A++ +++PP  +         V V  G+   L+  ++G P     W +GD   
Sbjct: 7946 SGKDSCSAQILILEPPYFV----KQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTK- 8000

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPP-VA 625
            +  +   +     + +TLV +  + +DSG Y    +N  GE  AS  + V +   PP  +
Sbjct: 8001 LRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFS 8060

Query: 626  PTVTEVGDDWCIMNWEPPAYDGGSPI-LGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
              + +V +   +      A  G  PI + ++ + K  + S  ++ +F L    T    K 
Sbjct: 8061 RQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSF-LDNTATLNIFKT 8119

Query: 685  IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               +A +    A N IG              + +S   L+  +        +R  P D +
Sbjct: 8120 DRSLAGQYSCTATNPIG--------------SASSSARLILTEGKNPPFFDIRLAPVDAV 8165

Query: 745  GAAGLDGYVLEYCFEGTE----DWIVANKDLIDKTKFTITGLPTDAKIFV---------- 790
                 D    E    GT+     W   ++++    K+ I+ L   A + V          
Sbjct: 8166 VGESAD---FECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQ 8222

Query: 791  -RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 849
                AVN  G       +  + +KE + PP     + L +T     G +  L     G  
Sbjct: 8223 YTCYAVNEVGKDS---CTAQLNIKERLIPPS--FTKRLSETVEETEGNSFKLEGRVAGSQ 8277

Query: 850  RPELTWKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDI 908
               + W K+  EI   +   I       ++ +RKA  + +G Y  +V  D      +  I
Sbjct: 8278 PITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSI 8337

Query: 909  QIIDRPGPPQIVKIEDVWGENVALTWTP-PKDDGNAAITGYTIQKADKKSMEWFTV---I 964
             I +   PP       V+ +++    TP    +G        +Q ++   ++W      I
Sbjct: 8338 VIKEPKKPP-------VFDQHL----TPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREI 8386

Query: 965  EHYHRTS---ATITELVIGNEYYFRVFSENMCGLSEDA-TMTKESAVIARDGKIYKNPVY 1020
            +   R S   A+ T ++   +       + +C  S  A + T +S V  +D K    P  
Sbjct: 8387 KPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKD-KPAVAPAT 8445

Query: 1021 EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1080
            +         F     +   +    AT    V G+P P + W K K   ++    R+F +
Sbjct: 8446 KKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGG-RVFIH 8504

Query: 1081 Q--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
            Q      LEIR  +  D G Y C A N+ G +E    L+V
Sbjct: 8505 QKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQV 8544



 Score =  128 bits (322), Expect = 3e-29
 Identities = 101/352 (28%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 264   VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
             V +G    FV EL+  K+ V W+KN  ++  S   +   +G    L +    + D S+  
Sbjct: 11585 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 11644

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
                 +   + +L V E     T +L D TA   + + L+CEVS+ D  VKWFK+GEEI+P
Sbjct: 11645 AQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWFKDGEEIVP 11703

Query: 384   GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
              PK  Y I+ +G + IL I+ A   D  EY       ++ A ++V+ + +K+  PL    
Sbjct: 11704 SPK--YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVE 11761

Query: 444   VNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
             V +G+    + E+SE ++ G+W   G P+  S   +++  G+ H L++ N      G+  
Sbjct: 11762 VFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVS 11821

Query: 503   FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
             F   A N    A + V + P I +  L   + V V   ++ + E  +S E P    W +G
Sbjct: 11822 F--QAANAKSAANLKVKELPLIFITPL---SDVKVFEKDEAKFECEVSRE-PKTFRWLKG 11875

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
              + I  G  R          ++VI  A  +D   Y      EA + H S K+
Sbjct: 11876 TQEI-TGDDRFELIKDGTKHSMVIKSAAFEDEAKYMF----EAEDKHTSGKL 11922



 Score =  127 bits (320), Expect = 5e-29
 Identities = 123/540 (22%), Positives = 217/540 (40%), Gaps = 60/540 (11%)

Query: 597   YHINLKNEAG---EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             Y +  +N AG    +  S  ++  D    P PP  P + + G     + W  P +DGG+P
Sbjct: 26055 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 26114

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
             I GY +E KK   + W + +    + T +    +  G  Y  R+ +VN +G S PS  S 
Sbjct: 26115 ITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 26173

Query: 711   PFVPLAVTSPP----------TLLTVDSVTDT-TVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             P +       P          TL+     + T TV  R RP  ++  +  D  +    + 
Sbjct: 26174 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYV 26233

Query: 760   GTED----WIVANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK 813
              T D      + N +  D  K+T+T   + + A + + VK ++  G          I V+
Sbjct: 26234 DTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTN------ITVQ 26287

Query: 814   EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSE 873
             ++ +   +     L        G A       + +   +  W       ++    + N +
Sbjct: 26288 DVTKESAV-----LSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQ 26342

Query: 874   TDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALT 933
                I + R      SG+ +  V +    ET    ++I ++P PP+ + +  +  ++V+LT
Sbjct: 26343 EGAIYYFRV-----SGENEFGVGIP--AETKE-GVKITEKPSPPEKLGVTSISKDSVSLT 26394

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWF--TVIEHYHRTSATITELVIGNEYYFRVFSEN 991
             W  P+ DG + I  Y ++  +K    W    V +  H   + + E    +EY+FRVF+EN
Sbjct: 26395 WLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRE---NSEYFFRVFAEN 26451

Query: 992   MCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCS 1051
               GLS+   +            +    + E  +  E  M   P    Y  AG N  ++  
Sbjct: 26452 QAGLSDPREL------------LLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIP 26499

Query: 1052  VRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVE 1111
             + G P PK+T  ++ V +    R+         T+ +++    D G Y   A N  GT +
Sbjct: 26500 ISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTK 26559



 Score =  127 bits (318), Expect = 8e-29
 Identities = 238/1136 (20%), Positives = 423/1136 (37%), Gaps = 133/1136 (11%)

Query: 27   EAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTV-KVGEDITFIAKVKAED 85
            + GT  +K    V+ PP                FI+KP    V + G+  TF  ++    
Sbjct: 4845 DVGTATSKATLFVKEPPQ---------------FIKKPSPVLVLRNGQSTTFECQITGTP 4889

Query: 86   LLRKPTIKWF-KGKWMDLASKAG-KHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCE 143
             +R   + W+  G  +    K G   +    TF           QI  A+   +G Y CE
Sbjct: 4890 KIR---VSWYLDGNEITAIQKHGISFIDGLATF-----------QISGARVENSGTYVCE 4935

Query: 144  VTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQE----DAGELDFSGLLKRREV 199
                    SCS +L+V E       +      K S    E         + + L   RE+
Sbjct: 4936 ARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREI 4995

Query: 200  KQQEE---EPQVDVWEL-LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFA 255
            +  ++     +V V+ L +    PS+  +  +Q  +++  G      R+  +E  S  F 
Sbjct: 4996 RSSKKYTLTDRVSVFNLHITKCDPSDTGE--YQCIVSNEGGSCSCSTRVALKEPPS--FI 5051

Query: 256  KILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQ 315
            K ++    V K            P + + W K+ Q +                L I +  
Sbjct: 5052 KKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVD 5111

Query: 316  MTDDSEYYVTA----GDEKCSTELFVREPPIMVTK-QLEDTTAYCGERVELECEVS-EDD 369
                  Y   A    G E+C   L V+EP  +V K +  D T    + + LEC V+   +
Sbjct: 5112 NGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVTE--KDPMTLECVVAGTPE 5169

Query: 370  ANVKWFKNGEEIIPGPKSRY-RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
              VKW K+G++I+P   SRY  +  E       I+   K D+ +Y+        S+    
Sbjct: 5170 LKVKWLKDGKQIVP---SRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDA 5226

Query: 429  DLK------PLKILTPLTDQTVNLGKEICLKCEISENIP--GKWTKNGLPVQESDRLKVV 480
             L+      P      LT     LG  I ++C++S ++P   +W K+G  +  S + ++V
Sbjct: 5227 YLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLV 5286

Query: 481  HKGRIHKLVIANALTEDEGDY------VFAPDAYNVTLPAKVHVIDPPKIILDGLDADNT 534
               R   L + N   ED  +Y      V   DA +  L  K    +PP  ++        
Sbjct: 5287 CHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVK----EPPSFLV----KPGR 5338

Query: 535  VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDS 594
               I  + +  +  + G PP K  W + D  ++ G  +        +S L +   +   +
Sbjct: 5339 QQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGP-KCFIGLEGSTSFLNLYSVDASKT 5397

Query: 595  GVYHINLKNEAGEAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 651
            G Y  ++ N+ G    +  + V +   F     A  + + GD   +          GSP 
Sbjct: 5398 GQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRL-----ECKIAGSPE 5452

Query: 652  LG--YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
            +   +F    +  +S   R+ F +      +   +    + +    A N  G +  S   
Sbjct: 5453 IRVVWFRNEHELPASDKYRMTF-IDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKV 5511

Query: 710  RPFVPLAVTSPPTLLTVDSVTDTTVTMRWR----PPDHIGAAGLDGYVLEYCFEGTEDWI 765
                P   +S P +  V+++ +  V++       PP  +       Y  +     ++ + 
Sbjct: 5512 IVKEPPVFSSFPPI--VETLKNAEVSLECELSGTPPFEV-----VWYKDKRQLRSSKKYK 5564

Query: 766  VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
            +A+K+    T   I  + T        KA N  G+         +   ++ EPP+  + +
Sbjct: 5565 IASKNF--HTSIHILNVDTSDIGEYHCKAQNEVGS------DTCVCTVKLKEPPRF-VSK 5615

Query: 826  HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR--KA 883
                T +   GE   L    +G     + W K+  E+ +   NIR +  + +  ++  KA
Sbjct: 5616 LNSLTVV--AGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKA 5673

Query: 884  ERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA 943
            E +++GKY  Q+K D  +      + +++    P ++ +E      V +        G  
Sbjct: 5674 EPANAGKYICQIKNDGGMRENMATLMVLE----PAVI-VEKAGPMTVTV--------GET 5720

Query: 944  AITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
                  +    + S+EW+   +    TS+   +      +Y ++ S  +  +      T 
Sbjct: 5721 CTLECKVAGTPELSVEWYK--DGKLLTSSQKHKF----SFYNKISSLRILSVERQDAGTY 5774

Query: 1004 ESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWM 1063
               V    GK     V +  D +  P FT+ L NT  + G +  L C V G+    + W 
Sbjct: 5775 TFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWF 5834

Query: 1064 KNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              K  IV   +Y+   +  VCTL++      D G Y C A N  G+ E    L V+
Sbjct: 5835 HEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQ 5890



 Score =  125 bits (315), Expect = 2e-28
 Identities = 87/266 (32%), Positives = 123/266 (46%), Gaps = 11/266 (4%)

Query: 247   EEKKSAAFAKIL--DPAYQV---DKGGRVRFVVEL---ADPKLEVKWYKNGQEIRPSTKY 298
             +E  S A  K+L  DP + V   DK    +  + L       + VKW+K+G+EI PS KY
Sbjct: 11648 KELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKY 11707

Query: 299   IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGER 358
               +  G +RIL I    + D  EY    G +K    + V    I V K L     + GE 
Sbjct: 11708 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGET 11767

Query: 359   VELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
                E E+SE D + +W   G+ +   P     I  +GKKHILI+         E S    
Sbjct: 11768 AHFEIELSEPDVHGQWKLKGQPLTASPDC--EIIEDGKKHILILHNCQLGMTGEVSFQAA 11825

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
               +S+A L V   PL  +TPL+D  V    E   +CE+S E    +W K    +   DR 
Sbjct: 11826 NAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRF 11885

Query: 478   KVVHKGRIHKLVIANALTEDEGDYVF 503
             +++  G  H +VI +A  EDE  Y+F
Sbjct: 11886 ELIKDGTKHSMVIKSAAFEDEAKYMF 11911



 Score =  123 bits (309), Expect = 9e-28
 Identities = 196/916 (21%), Positives = 335/916 (36%), Gaps = 106/916 (11%)

Query: 253  AFAKILDPAYQVDKGGRVRFVVE---------LADPKLEVKWYKNGQEIRPSTKYIFEHK 303
            A   +L+PA  V+K   ++                P+L  KW+K+G+E+    KY     
Sbjct: 7578 ATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFF 7637

Query: 304  GCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFV--REPPIMVTKQLEDTTAYCGE 357
                 L I N   +D   Y        G + C+  L V  R  P   T++L++T    G 
Sbjct: 7638 NKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGS 7697

Query: 358  RVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVM 416
             V +EC+V      +V WF  G EI  G K  Y+  +      L +    ++D+ +Y+ +
Sbjct: 7698 SVVMECKVYGSPPISVSWFHEGNEISSGRK--YQTTLTDNTCALTVNMLEESDSGDYTCI 7755

Query: 417  TTGGQSSAKLSVDL---KPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPV 471
             T    S + S  L   +P   +       V  G  +     +    P    W K    +
Sbjct: 7756 ATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSEL 7815

Query: 472  QESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVIDPPKIILDGL 529
               DR  V  +  + +L + +  T   G+Y  + + +A   +    +++  P K +    
Sbjct: 7816 VPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFV---- 7871

Query: 530  DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
               N  ++  G  L LE   +G PP    W +    +   S R    +   S+ L I  +
Sbjct: 7872 KRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTP-SQRCNITTTEKSAILEIPSS 7930

Query: 590  ERDDSGVYHINLKNEAGEAHASIKVKVVDFPD--PPVAPTVTEVGDDWCIMNWEPPAYDG 647
              +D+G Y+  ++N +G+   S ++ +++ P     + P    VGD   +          
Sbjct: 7931 TVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQ-----CQLA 7985

Query: 648  GSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM 707
            G+P +G            W + +  L   TT++           V     N + I+    
Sbjct: 7986 GTPEIGV----------SWYKGDTKLRPTTTYKMH-----FRNNVATLVFNQVDIND--- 8027

Query: 708  PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP-------DHIGAAGLDGYVLEYCFEG 760
             S  ++  A  S   +  V + T  TV  +  PP       D     GL   V +    G
Sbjct: 8028 -SGEYICKAENS---VGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLP-VVFDCAISG 8082

Query: 761  TE----DWIVANKDLID----KTKF-----TITGLPTDAKIFVRVK--AVNAAGASEPKY 805
            +E     W    K L D    +T F     T+    TD  +  +    A N  G++    
Sbjct: 8083 SEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASS-- 8140

Query: 806  YSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
             S  +++ E   PP   I           VGE+ +      G    +++W KD  EI   
Sbjct: 8141 -SARLILTEGKNPPFFDIRLAPVDAV---VGESADFECHVTGTQPIKVSWAKDSREIRSG 8196

Query: 866  -QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIED 924
             +  I   E    + + K ++  SG+Y      +   ++ +  + I +R  PP   K   
Sbjct: 8197 GKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTK--- 8253

Query: 925  VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-TVIEHYHRTSATITELVIGNEY 983
                   L+ T  + +GN+      +  +   ++ W+   IE    ++  IT        
Sbjct: 8254 ------RLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVL 8307

Query: 984  YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1043
              R    N  GL          + +     + K P        + P+F Q L       G
Sbjct: 8308 QVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEP-------KKPPVFDQHLTPVTVSEG 8360

Query: 1044 YNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1103
                L+C V+G+   +I W+K    I    R       G   LE+R  +  D G Y CKA
Sbjct: 8361 EYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKA 8420

Query: 1104 VNDLGTVEIECKLEVK 1119
             N  G+   + K+ +K
Sbjct: 8421 SNVAGSDTTKSKVTIK 8436



 Score =  122 bits (306), Expect = 2e-27
 Identities = 197/849 (23%), Positives = 321/849 (37%), Gaps = 123/849 (14%)

Query: 319   DSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAY-CGERVELECEV-SEDDANVKWFK 376
             DS   +TA DE       V  P I +  +  DT     GE   LE +V  +    ++W +
Sbjct: 23609 DSTGPITAKDE-------VELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 23661

Query: 377   NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL 436
               +EI     +R  I+    K +LI++ A + D  +Y +  +    S    V++K L   
Sbjct: 23662 GDKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 23719

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKL-------- 488
              P  +  V +      KC ++ + P +    G  +       VV K    +L        
Sbjct: 23720 GP-PEGPVQVTGVTSEKCSLTWSPPLQ--DGGSDISHY----VVEKRETSRLAWTVVASE 23772

Query: 489   VIANALTEDE----GDYVF---APDAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAG 540
             V+ N+L   +     +YVF   A + Y V  P +   V+     +L G      VT IA 
Sbjct: 23773 VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAK 23832

Query: 541   NKLRLEIPISGEPPPKAMWSRGDKA--------IMEGSGRIRTESYPDSSTLVIDIAER- 591
             + + +             W+R D          I+E   R        +   + D+  R 
Sbjct: 23833 DSMTV------------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 23880

Query: 592   -----DDSGVYHINLKNEAGEAH---ASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNW 640
                  D    + ++ +N AG      A++  K  D    P PP    + +   +   + W
Sbjct: 23881 TGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 23940

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNA 699
               P YDGGS ILGY +E  K     W  +      + T FE  K+ E   Y++R+ A+N 
Sbjct: 23941 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 24000

Query: 700   IGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMR------------WRPPDHIGAA 747
             +G+ + +       P      P L  +DS     + +R             RP   I  +
Sbjct: 24001 VGLGEATSVPGTVKPEDKLEAPEL-DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWS 24059

Query: 748   GLDG-YVLEYCFEGTEDWI---VANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGAS 801
               +G +  +   E   ++    + N D  D  K+ +           FV VK ++  G  
Sbjct: 24060 REEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPP 24119

Query: 802   EPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE 861
                   Q + VKE+ +     +    +   I    +  N VI  +   R    +    ++
Sbjct: 24120 ------QNLAVKEVRKDSAFLV---WEPPIIDGGAKVKNYVIDKRESTRK--AYANVSSK 24168

Query: 862   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 921
               K    + N     I + R    +  G       V   VET    ++  + P PP  V 
Sbjct: 24169 CSKTSFKVENLTEGAIYYFRVMAENEFG-------VGVPVETVDA-VKAAEPPSPPGKVT 24220

Query: 922   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 981
             + DV   + +L W  P+ DG + + GY ++   K + +W  V E     +A +T L  G 
Sbjct: 24221 LTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAVVTGLSSGQ 24279

Query: 982   EYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1041
             EY FRV + N  G S+   +     VIA+D  I              P    P  NTY+I
Sbjct: 24280 EYQFRVKAYNEKGKSDPRVLGVP--VIAKDLTIQ-------------PSLKLPF-NTYSI 24323

Query: 1042  -AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
              AG +  +   V G P+P I+W+K+   +    R  +        L I++ +  D G Y 
Sbjct: 24324 QAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYT 24383

Query: 1101  CKAVNDLGT 1109
               A N  GT
Sbjct: 24384 VTATNSAGT 24392



 Score =  121 bits (304), Expect = 3e-27
 Identities = 185/870 (21%), Positives = 323/870 (37%), Gaps = 146/870 (16%)

Query: 313   NCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDA 370
             N     DS   +TA DE       +  P   +  + +D    + GE   LE ++  +   
Sbjct: 24685 NFSEPSDSSGAITARDE-------IDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIP 24737

Query: 371   NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSV 428
             +V W K+G+E+     +R  I+   +K  L+++   + D  +Y   +   GG  S  ++V
Sbjct: 24738 DVVWSKDGKEL-EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITV 24796

Query: 429   DLK--------PLKIL------------TPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
              +         PLK+              PL D   N+   I  K E S      WT+  
Sbjct: 24797 KVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL---SWTQVS 24853

Query: 469   LPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVHVID----- 520
               VQ  +        ++ KL+  N       +Y+F   A + Y +  P +   +      
Sbjct: 24854 TEVQALNY-------KVTKLLPGN-------EYIFRVMAVNKYGIGEPLESGPVTACNPY 24899

Query: 521   -----PPKIILDGLDADNTVTVIA------GNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
                  P    +  +  D+ V   A      G ++   I +         W++ +K  +  
Sbjct: 24900 KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI-LEKRDKEGVRWTKCNKKTLTD 24958

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE-AHASIKVKVVDF---PDPPVA 625
               R+R     +  +    +A  + +GV         GE +  S+  +  D    P PP  
Sbjct: 24959 L-RLRVTGLTEGHSYEFRVAAENAAGV---------GEPSEPSVFYRACDALYPPGPPSN 25008

Query: 626   PTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT------F 679
             P VT+       + W  P YDGG+P+ GY +E K+  +  W       C   T      F
Sbjct: 25009 PKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-----CTPPTGLQGKQF 25063

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTL-----------LTVDS 728
                K+ E   Y  RI A+N+ G+ +P+      V      PP +           L   +
Sbjct: 25064 TVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASA 25123

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYC-FEGTEDW---IVANKDLIDKTKFTIT--GL 782
                  VT++ RP   +     +G + +    E T  +   ++ N    D  ++ +T    
Sbjct: 25124 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENN 25183

Query: 783   PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 842
                   FV V+ +++  A        P+ +  I E  K  +    +   I    +  N +
Sbjct: 25184 SGSKTAFVNVRVLDSPSA--------PVNLT-IREVKKDSVTLSWEPPLIDGGAKITNYI 25234

Query: 843   IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
             +  +   R       +     K    I N +     + R      S +Y + +  +    
Sbjct: 25235 VEKRETTRKAYATITNNCT--KTTFRIENLQEGCSYYFRVLA---SNEYGIGLPAE---- 25285

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
               +  +++ + P PP  V + DV      + W  P+ DG + ITGY ++   K S +W T
Sbjct: 25286 -TTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST 25344

Query: 963   VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYED 1022
               +      ATI+ L  G EY FRV + N  G S+   +     VIARD +I        
Sbjct: 25345 CTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP--VIARDIEI-------- 25393

Query: 1023  FDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1082
                   P    P       A     ++   +G P+  + W K+   + +  R  + S++ 
Sbjct: 25394 -----KPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKT 25448

Query: 1083  VCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1112
             V +L I++ S  D GTY     N  G++ +
Sbjct: 25449 VTSLSIKEASKEDVGTYELCVSNSAGSITV 25478



 Score =  120 bits (302), Expect = 6e-27
 Identities = 142/561 (25%), Positives = 214/561 (38%), Gaps = 83/561 (14%)

Query: 597   YHINLKNEAGEAHASIKVKVVDF------PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + ++ +NE G    S   K V        P PPV P   +   +   + W+PP +DGGS 
Sbjct: 17084 FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSK 17143

Query: 651   ILGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             ILGY +E +K     W R N   + C ET ++   + +G  Y+ R+ AVNA G S P+  
Sbjct: 17144 ILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHV 17203

Query: 709   SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTE----DW 764
               P +      PP L     + D  +        HI     D   L    +G       W
Sbjct: 17204 PEPVLVKDRLEPPEL-----ILDANMARE----QHIKVG--DTLRLSAIIKGVPFPKVTW 17252

Query: 765   IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG----ASEPKYYSQPILVKEIIEPPK 820
                ++D   K +  +T  P  +K+ +R  A    G      E    S+ + VK ++   K
Sbjct: 17253 KKEDRDAPTKARIDVT--PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD-K 17309

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK---DGAEIDKNQINIRNSETD-- 875
                PR L+ + IR              K    LTWK+   DG  +  N +  R       
Sbjct: 17310 PGPPRDLEVSEIR--------------KDSCYLTWKEPLDDGGSVITNYVVERRDVASAQ 17355

Query: 876   -TIIFIRKAERSHSGKY-------------DLQVKVDKFVETASIDIQIIDR---PGPPQ 918
              + +     ++SH  K+             + Q     FVET    I+ +D    PGPP+
Sbjct: 17356 WSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPK-PIKALDPLHPPGPPK 17414

Query: 919   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 978
              +   DV    V+L W  P  DG + ITGY ++  ++ + +W    +        +T L 
Sbjct: 17415 DLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-FKTVTNLECVVTGLQ 17473

Query: 979   IGNEYYFRVFSENMCGLS-EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1037
              G  Y FRV +EN+ GL   D T+  E        K+    V  D    E  +       
Sbjct: 17474 QGKTYRFRVKAENIVGLGLPDTTIPIEC-----QEKLVPPSVELDVKLIEGLVVK----- 17523

Query: 1038  TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1097
                 AG        +RG P P   W  +   I  D  Y + ++     L I+     D G
Sbjct: 17524 ----AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTG 17579

Query: 1098  TYCCKAVNDLGTVEIECKLEV 1118
              Y     N  G+  +   L V
Sbjct: 17580 EYQITVSNAAGSKTVAVHLTV 17600



 Score =  120 bits (301), Expect = 7e-27
 Identities = 130/513 (25%), Positives = 208/513 (40%), Gaps = 41/513 (7%)

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KG+W+    + GKHL L       S  +   + I   K +  G Y    TYK      S 
Sbjct: 2649 KGEWL----RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSA 2700

Query: 156  DLEVH--ESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWEL 213
             L+V   +   T  N+ +          +     +     +K   V +  E+  + V   
Sbjct: 2701 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV--- 2757

Query: 214  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVD--KGGRVR 271
                K + Y        I D      RL R+    +      KI+     V   +   V 
Sbjct: 2758 ----KGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVA 2813

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F V ++   + VKW+    EI+PS K+    +     L + N   +D  EY    G  +C
Sbjct: 2814 FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLEC 2873

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +LFV    + +TK +++      +    ECEVS  +    W KNG EI    K  ++I
Sbjct: 2874 KAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK--FKI 2929

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             V+GK H LII   +  D+AEY+ +    Q SA L+V   P+ I + L D  +N  ++  
Sbjct: 2930 VVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMITSMLKD--INAEEKDT 2985

Query: 452  LKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD-- 506
            +  E++ N  G   KW KNG+ ++ +D+ ++  K   H L I N    D  DY F     
Sbjct: 2986 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 3045

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                TL  +   I+  K I D       + V+   +   E  +S EP     W + D+  
Sbjct: 3046 TSTATLYVEARHIEFRKHIKD-------IKVLEKKRAMFECEVS-EPDITVQWMKDDQE- 3096

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            ++ + RI+ +       L+I      D+G Y +
Sbjct: 3097 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3129



 Score =  120 bits (301), Expect = 7e-27
 Identities = 89/317 (28%), Positives = 143/317 (45%), Gaps = 11/317 (3%)

Query: 256   KILDPAYQVD--KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINN 313
             K++ P + V+  +    RF  E+++  +   W   G+ +  +     + +G    L ++N
Sbjct: 12108 KLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHN 12167

Query: 314   CQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVK 373
             C++         A + K S  L V+   I + + L+D T   GE    +CE+S +D  V+
Sbjct: 12168 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 12227

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL 433
             W+  G+++ P  K     R EGK H L +      DA E  +     ++ A L V   P+
Sbjct: 12228 WYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPV 12285

Query: 434   KILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
             +   PL DQTV  G    L+CE+S EN   KW KNG  + +S + ++V  GR+ KLVI +
Sbjct: 12286 EFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 12345

Query: 493   ALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
                ED   Y    DA +      ++V+ P    L  L     + V      R E  +S E
Sbjct: 12346 CTPEDIKTYTC--DAKDFKTSCNLNVVPPHVEFLRPL---TDLQVREKEMARFECELSRE 12400

Query: 553   PPPKAMWSRGDKAIMEG 569
                K  W +    I +G
Sbjct: 12401 -NAKVKWFKDGAEIKKG 12416



 Score =  119 bits (298), Expect = 2e-26
 Identities = 113/439 (25%), Positives = 181/439 (41%), Gaps = 46/439 (10%)

Query: 596   VYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF 655
             V  INL      +  S  V  +D  DPP  P V  +  +   + W  P YDGG  + GY 
Sbjct: 20250 VMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYI 20309

Query: 656   IERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVP 714
             +E++   S  WM+ N     E  F    ++EG  YE RI A N  G IS PS  +   + 
Sbjct: 20310 VEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIIC 20369

Query: 715   LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774
                   PT++   ++ D  +T++      + A  + G  L         W  A KD+   
Sbjct: 20370 KDEYEAPTIVLDPTIKD-GLTIKAGDTIVLNAISILGKPLP-----KSSWSKAGKDIRPS 20423

Query: 775   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834
                 IT  PT + + ++      AG       + P   K            H+K T +  
Sbjct: 20424 DITQITSTPTSSMLTIKYATRKDAG-EYTITATNPFGTK----------VEHVKVTVLDV 20472

Query: 835   VGEAVNLVIPFQGKPRPELTWK---KDGAEIDKNQINIRNSETDTIIFIRKAERSHS--- 888
              G    + I      +  LTW    +DG    K+ I +   ET  +++   +E   S   
Sbjct: 20473 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYI-LEKRETSRLLWTVVSEDIQSCRH 20531

Query: 889   --------GKYDLQVKV----DKFVETASIDIQIIDR---PGPPQIVKIEDVWGENVALT 933
                      +Y  +V       K     S  ++++DR   PGPP+  ++ +V      ++
Sbjct: 20532 VATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVS 20591

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIE-HYHRTSATITELVIGNEYYFRVFSENM 992
             W  P DDG + ITGY +++ +KKS+ W   I+         +T L  G+ Y FRV +EN 
Sbjct: 20592 WKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENR 20651

Query: 993   CGL-----SEDATMTKESA 1006
              G+     + D+ + K++A
Sbjct: 20652 AGIGPPSEASDSVLMKDAA 20670



 Score =  117 bits (294), Expect = 5e-26
 Identities = 236/1136 (20%), Positives = 404/1136 (35%), Gaps = 174/1136 (15%)

Query: 60   FIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERH 119
            F + P    V  G  +TF + ++     +   +KWFKG   +L      ++ L++     
Sbjct: 6836 FEQTPDSVEVLPGMSLTFTSVIRGTPPFK---VKWFKGS-RELVPGESCNISLED----- 6886

Query: 120  SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSG 179
               +  E+++ + +   +G+Y C VT      SC+  L V E           +  KR  
Sbjct: 6887 ---FVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPA---------TFVKRLA 6934

Query: 180  EGQEDAG-----ELDFSGL-------LKRREVKQQEEEPQVDVWE--LLKNAKPSEYEKI 225
            +   + G     E  ++G        +K   +  Q E   + + E   +     S  E  
Sbjct: 6935 DFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDY 6994

Query: 226  AFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVEL--------- 276
            A QY           L      +    A   +L+P Y ++    V  V+           
Sbjct: 6995 A-QYSC---------LIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVD 7044

Query: 277  ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
              P++ + WYK   ++R +  Y  + K     L IN    +D  EY   A    G    S
Sbjct: 7045 GTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASS 7104

Query: 333  TELFV--REPPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRY 389
              L +  R+ P    ++L+D     G  V  EC ++  +   V W+K+G  ++    +  
Sbjct: 7105 AVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDG--VLLKDDANL 7162

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTG----GQSSAKLSV---------DLKPLKIL 436
            +         L I    ++   +Y+   +       SSAKL +         DLKP+ + 
Sbjct: 7163 QTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSV- 7221

Query: 437  TPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                   + LG+    KC ++   P K  W K+   ++     K+        L +    
Sbjct: 7222 ------DLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVG 7275

Query: 495  TEDEGDYV-FAPD-AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              D G Y  +A + A   +  A++ V +PP+ I      + +  V      R E  I G 
Sbjct: 7276 KGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFI---KKLEPSRIVKQDEFTRYECKIGGS 7332

Query: 553  PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASI 612
            P  K +W + +  I E S + R       + L +     +DSG Y     N AG A +S 
Sbjct: 7333 PEIKVLWYKDETEIQE-SSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSST 7391

Query: 613  KVKVVDFPDPPV-----APTVTEVGDD---WCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
             +KV    +PP+      P  T  G D    C +   PP +      + ++ ++++ +S 
Sbjct: 7392 SLKV---KEPPIFRKKPHPIETLKGADVHLECELQGTPPFH------VSWYKDKRELRSG 7442

Query: 665  RWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV-------PLAV 717
            +              + K M E     + I  V+A  I +    +   V        +A+
Sbjct: 7443 K--------------KYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIAL 7488

Query: 718  TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVL-----EYCFEGTEDWIVANKDLI 772
             +PP  +   S   T V    +    I  A     V      E   E    WI  +++ I
Sbjct: 7489 KAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSEN-I 7547

Query: 773  DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI-RIPRHLKQTY 831
               +F+        K   ++K  N AG  E            ++EP  I   P  +K T 
Sbjct: 7548 ATLQFSRVEPANAGKYTCQIK--NDAGMQE------CFATLSVLEPATIVEKPESIKVT- 7598

Query: 832  IRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGK 890
                G+   L     G P     W KDG E+   N+  I      + + I     S SG 
Sbjct: 7599 ---TGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGV 7655

Query: 891  YDLQVKVDKFVETASIDIQIIDRPGPPQIV-KIEDVWGENVALTWTPPKDDGNAAITGYT 949
            Y  +V+     ++ +  +Q+ DR  PP    K+++  G +           G++ +    
Sbjct: 7656 YSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLS-----------GSSVVMECK 7704

Query: 950  IQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA--V 1007
            +  +   S+ WF      H  +    E+  G +Y     ++N C L+ +     +S    
Sbjct: 7705 VYGSPPISVSWF------HEGN----EISSGRKYQ-TTLTDNTCALTVNMLEESDSGDYT 7753

Query: 1008 IARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKV 1067
                     +         E P F Q       + G N T    V+G P   ++W K   
Sbjct: 7754 CIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSS 7813

Query: 1068 AIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
             +V   R  +     V  LE+        G Y C   N+ G       L +K  A+
Sbjct: 7814 ELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAK 7869



 Score =  116 bits (291), Expect = 1e-25
 Identities = 187/859 (21%), Positives = 324/859 (37%), Gaps = 143/859 (16%)

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDANVKWFKNGEEI 381
             +TA DE       V  P I +  + +DT   + GE  +++ ++  +    ++W K  +E+
Sbjct: 22532 ITARDE-------VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 22584

Query: 382   IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
                  +R  I+       L ++ A + D+  Y +          ++V++K L    P   
Sbjct: 22585 --SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 22642

Query: 442   QTVNLGKEICLKCEISENIPGKWTKNGLPVQE--SDRLKVVHKGR-----IHKLVIANAL 494
               V  G     KC ++      W     P+Q+  SD +  + + R     +  +V AN  
Sbjct: 22643 PVVISGVT-AEKCTLA------WKP---PLQDGGSDIINYIVERRETSRLVWTVVDANVQ 22692

Query: 495   TED-------EG-DYVF---APDAYNVTLPAKVH--VIDPPKIILDGLDADNTVTVIAGN 541
             T         EG +Y F   A + Y V  P +    V   P ++ D   A    TV   +
Sbjct: 22693 TLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDS 22752

Query: 542   KLRL-EIPISG------------EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDI 588
              + + E P S                    W+R  K ++ G  R+R          V  +
Sbjct: 22753 MIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLI-GELRLR----------VTGL 22801

Query: 589   AERDDSGVYHINLKNEAGEAHAS---IKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEP 642
              E  D   + ++ +N AG +  S      K  D    P PP  P V ++      ++W  
Sbjct: 22802 IENHDYE-FRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSK 22860

Query: 643   PAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIG 701
             P YDGG  I GY +E+       W          +T  E +K++E   Y  RI A+N  G
Sbjct: 22861 PIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAG 22920

Query: 702   ISKPSMPSRPFVPLAVTSPPTL-----------LTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + + +    P +       P +           +         V ++ RP   +    +D
Sbjct: 22921 VGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVD 22980

Query: 751   GYVLEYCF----EGTEDWIVANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPK 804
             G + +             ++ N +  D  K+T+T          FV V+ ++    S P 
Sbjct: 22981 GEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTP--SPPV 23038

Query: 805   YYSQPILVKEII----EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
                   + K+ +    EPP +     +K   + +                 E T K   A
Sbjct: 23039 NLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK----------------REATRKSYAA 23082

Query: 861   EID---KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
              +    KN   I   +     + R    +  G       +    +TA   I++ + P PP
Sbjct: 23083 VVTNCHKNSWKIDQLQEGCSYYFRVTAENEYG-------IGLPAQTAD-PIKVAEVPQPP 23134

Query: 918   QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               + ++DV   +V+L+WT P+ DG + I  Y ++   K S +W +         A IT L
Sbjct: 23135 GKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW-SECARVKSLQAVITNL 23193

Query: 978   VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1037
               G EY FRV + N  G S+  ++     ++A+D  I  +               +P  +
Sbjct: 23194 TQGEEYLFRVVAVNEKGRSDPRSLAVP--IVAKDLVIEPD--------------VKPAFS 23237

Query: 1038  TYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG 1096
             +Y++  G +  +   + G PKP ITW K+ + +    R  +  +  + TL I++    DG
Sbjct: 23238 SYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDG 23297

Query: 1097  GTYCCKAVNDLG--TVEIE 1113
             G Y     N +G  T  IE
Sbjct: 23298 GQYGITVANVVGQKTASIE 23316



 Score =  116 bits (290), Expect = 1e-25
 Identities = 241/1144 (21%), Positives = 409/1144 (35%), Gaps = 166/1144 (14%)

Query: 44   GEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLA 103
            G ++ +     Q    F+++P+   V  G+++TF + ++     +   + WF+G   +L 
Sbjct: 5879 GSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFK---VNWFRGA-RELV 5934

Query: 104  SKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHEST 163
                 ++  ++T          E+++     + +G Y C V+      SC+  L V E  
Sbjct: 5935 KGDRCNIYFEDTVA--------ELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPA 5986

Query: 164  GTTPNIDIRSAFKRSGEGQEDA--GELDFSGLLKRREVKQQEEEP-------QVDVWELL 214
                 +   S         E    G L  S   K+        E        +  + E+L
Sbjct: 5987 AFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEIL 6046

Query: 215  KNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA--AFAKILDPAYQVDK------ 266
             + K     + A QY              +  E  +    A    L+P Y V +      
Sbjct: 6047 NSTK-----RDAGQYSC-----------EIENEAGRDVCGALVSTLEPPYFVTELEPLEA 6090

Query: 267  --GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
              G  V    ++A  P++ V WYK   ++RP+ +Y          L  N   + D  EY 
Sbjct: 6091 AVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYT 6150

Query: 324  VTA------GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFK 376
              A         K    +  R+ P    +QL+D     G  V L C ++      V W++
Sbjct: 6151 CKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYR 6210

Query: 377  NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG----GQSSAKLSV---- 428
            +G  ++   ++     V+    + I++    + + +YS   +       SSA+L+     
Sbjct: 6211 DG-VLLRDDENLQTSFVDNVATLKILQ-TDLSHSGQYSCSASNPLGTASSSARLTAREPK 6268

Query: 429  -----DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVH 481
                 D+KP+ I        V  G+    +C ++   P +  W+K+   ++      +  
Sbjct: 6269 KSPFFDIKPVSI-------DVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITC 6321

Query: 482  KGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIA 539
             G    L I      D G Y      D       A++ V +PPK +   L+A        
Sbjct: 6322 VGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFV-KKLEASKVAK--Q 6378

Query: 540  GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            G  ++LE  ISG P  K  W R D  + E S +         + L I+ A  +DSG Y  
Sbjct: 6379 GESIQLECKISGSPEIKVSWFRNDSELHE-SWKYNMSFINSVALLTINEASAEDSGDYIC 6437

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPV-----APTVTEVGDD---WCIMNWEPPAYDGGSPI 651
               N  G+A  S  + V     PPV     +P     G D    C ++  PP        
Sbjct: 6438 EAHNGVGDASCSTALTV---KAPPVFTQKPSPVGALKGSDVILQCEISGTPPFE------ 6488

Query: 652  LGYFIERKKKQSSRWMRL---NFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
            + +  +RK+ ++S+  ++   +FD    T+     +      E    A N +G    S  
Sbjct: 6489 VVWVKDRKQVRNSKKFKITSKHFD----TSLHILNLEASDVGEYHCKATNEVGSDTCSCS 6544

Query: 709  SRPFVP---LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
             +   P   +   S  + L  D+V    +   ++P   +        + E     +E+  
Sbjct: 6545 VKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRE-----SENTR 6599

Query: 766  VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK-IRIP 824
            ++  D I   +          K   ++K  N AG  E         V  ++EP + I  P
Sbjct: 6600 ISFIDNIATLQLGSPEASNSGKYICQIK--NDAGMRECS------AVLTVLEPARIIEKP 6651

Query: 825  RHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI---DKNQINIRNSETDTIIFIR 881
              +  T     G    L     G P     W KDG E+    K+ I   N      + I 
Sbjct: 6652 EPMTVT----TGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVAS--LKIP 6705

Query: 882  KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV-KIEDVWGENVALTWTPPKDD 940
             AE S  G Y  +VK        ++ + + DR  PP  + K++DV   N  L        
Sbjct: 6706 CAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDV---NAIL-------- 6754

Query: 941  GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1000
            G + +    +  +   S+ WF              E+V G +     FSEN+C L+    
Sbjct: 6755 GASVVLECRVSGSAPISVGWF----------QDGNEIVSGPKCQ-SSFSENVCTLNLSLL 6803

Query: 1001 MTKESAVIARDGKIYKNPVYED-----FDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
               ++ +      +  N    D         E P F Q   +   + G + T    +RG 
Sbjct: 6804 EPSDTGIYT---CVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGT 6860

Query: 1056 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
            P  K+ W K    +V      +     V  LE+ +  P + G Y C   ND G+      
Sbjct: 6861 PPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTH 6920

Query: 1116 LEVK 1119
            L VK
Sbjct: 6921 LFVK 6924



 Score =  115 bits (287), Expect = 3e-25
 Identities = 101/370 (27%), Positives = 158/370 (42%), Gaps = 34/370 (9%)

Query: 266  KGGRVRFVVELAD-----------------PKLEVKWYKNGQEIRPSTKYIFEHKGCQRI 308
            +G  V FV EL D                   +E KWY N  E++ + KY    +  ++ 
Sbjct: 2263 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2322

Query: 309  LFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            L + +    D  EY      +K + +L ++  PI + + L D     G+ V+LE +VS +
Sbjct: 2323 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE 2382

Query: 369  DANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
                 W K+G+E+   P  R  I ++ + H+L+IE  TK DA  YS        S    V
Sbjct: 2383 SVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV 2440

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIH 486
             +  + ++TPL D  V  G +  L+C++S  +    KW  N   ++  DR++ + KG   
Sbjct: 2441 SVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ 2500

Query: 487  KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLE 546
            +LVI      DEG Y              V  I     I+ GL  D T T        +E
Sbjct: 2501 RLVINRTHASDEGPYKLIVGRVETNCNLSVEKIK----IIRGL-RDLTCTETQNVVFEVE 2555

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            +  SG      +W+  DK I + S + + E++     L +    +DD G Y       AG
Sbjct: 2556 LSHSG---IDVLWNFKDKEI-KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAG 2607

Query: 607  EAHASIKVKV 616
            E   S K+ V
Sbjct: 2608 ENMTSGKLTV 2617



 Score =  115 bits (287), Expect = 3e-25
 Identities = 182/792 (22%), Positives = 302/792 (38%), Gaps = 105/792 (13%)

Query: 373   KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKP 432
             KW  +G EI       Y +  +    +L I+   + D  EY +  +    S  ++V L  
Sbjct: 17543 KWTTDGSEI--KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 17600

Query: 433   LKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESDRLK----VVHKGRI 485
             L +  P T     L    + + +  +  ++  G    N + V++ D  K    VV  G  
Sbjct: 17601 LDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYI-VEKQDTRKDTWGVVSSGSS 17659

Query: 486   H-KLVIANALTEDEGDYVFAPDAYNV---------TLPAKVHVIDPPKIILDGLDADNTV 535
               KL I +   +   +YVF   A N          T     H   PP            V
Sbjct: 17660 KTKLKIPHL--QKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP-----PGKPVV 17712

Query: 536   TVIAGNKLRLE--IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERD- 592
             T I  N   +   +P S    P   +    + +     R+      D    V  + E + 
Sbjct: 17713 TDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNT 17772

Query: 593   -DSGVYHINLKNEAGEAHASIKVKV---VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
              +  V+  NL   +  + +S  +K    +  P PP+ P + +   +   + W  P  DGG
Sbjct: 17773 YEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGG 17832

Query: 649   SPILGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM 707
             SPILGY +E +K  +++W R+N D L ++  F    +IEG  Y  RI A N +G  +P  
Sbjct: 17833 SPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRE 17892

Query: 708   PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVA 767
              +   +   +  PP +  +D      +T+R      I  A + G       E    W   
Sbjct: 17893 LAESVIAKDILHPPEV-ELDVTCRDVITVRVGQTIRI-LARVKGRP-----EPDITWTKE 17945

Query: 768   NKDLI-DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKY---------YSQPILVKEIIE 817
              K L+ +K    I  LP      V ++   A  A   KY         ++Q   +  +++
Sbjct: 17946 GKVLVREKRVDLIQDLPR-----VELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD 18000

Query: 818   PPKIRIPRHLKQTYIRRVG--------------EAVNLVIPFQGKPRPELTWKKDGAEID 863
              P     ++LK T + +                E  N ++ ++ KP  +  W    +++ 
Sbjct: 18001 RPGPC--QNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR-KPNQK-GWSIVASDVT 18056

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--IDIQIIDRPGPPQIVK 921
             K  I       +   F   AE         +V V   +ET +  + I  IDRPG P+ + 
Sbjct: 18057 KRLIKANLLANNEYYFRVCAEN--------KVGVGPTIETKTPILAINPIDRPGEPENLH 18108

Query: 922   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 981
             I D     V L W  P  DG +    Y +++  K S +W  V +   + +  + +  + N
Sbjct: 18109 IADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVEN 18168

Query: 982   EYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYA 1040
             + Y FRV ++N  G S+   +  E  V+  D               + P+    L     
Sbjct: 18169 QIYEFRVQTKNEGGESD--WVKTEEVVVKED--------------LQKPVLDLKLSGVLT 18212

Query: 1041  I-AGYNATLNCSVRGNPKPKITWMKNKVA--IVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1097
             + AG    L   VRG P P++ W K+K A  +   PR ++ +        + K    DGG
Sbjct: 18213 VKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGG 18272

Query: 1098  TYCCKAVNDLGT 1109
              Y   A N  G+
Sbjct: 18273 KYVVTATNTAGS 18284



 Score =  112 bits (281), Expect = 2e-24
 Identities = 184/898 (20%), Positives = 332/898 (36%), Gaps = 146/898 (16%)

Query: 281  LEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY--YVT--AGDEKCSTELF 336
            +++ W K+ +EIRP   Y          L +      D  +Y  Y +  AG + CS +L 
Sbjct: 7241 IKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLG 7300

Query: 337  VREPPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            V+EPP  + K          E    EC++    +  V W+K+  EI     S++R+    
Sbjct: 7301 VQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEI--QESSKFRMSFVD 7358

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLK----PLKILTPLTDQTVNLGKEIC 451
               +L +   +  D+ +Y+        SA  S  LK    P+    P   +T+  G ++ 
Sbjct: 7359 SVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLK-GADVH 7417

Query: 452  LKCEISENIPG--KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DA 507
            L+CE+    P    W K+   ++   + K++ +  +  + I N    D G+Y      D 
Sbjct: 7418 LECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDV 7477

Query: 508  YNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             + T    + +  PP+ +    D    ++ + G +++L+  I G  P   +W +    I+
Sbjct: 7478 GSDTCVGSIALKAPPRFVKKLSD----ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIV 7533

Query: 568  EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--EAHASIKV----KVVDFPD 621
              S  I      + +TL     E  ++G Y   +KN+AG  E  A++ V     +V+ P+
Sbjct: 7534 RESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPE 7593

Query: 622  PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
                 ++     D C +         G+P L          S++W +   +L  +  ++ 
Sbjct: 7594 -----SIKVTTGDTCTLE----CTVAGTPEL----------STKWFKDGKELTSDNKYK- 7633

Query: 682  KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
                  +++  ++  +  I ++        F         +      V+D TV     PP
Sbjct: 7634 ------ISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTV-----PP 7682

Query: 742  DHI----GAAGLDG--YVLEYCFEGTE----DWIVANKDLIDKTKFTITGLPTDAKIFVR 791
                      GL G   V+E    G+      W     ++    K+  T       + V 
Sbjct: 7683 SFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVN 7742

Query: 792  VK-----------AVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVN 840
            +            A N AG+ E    S P+ V+E   P  ++ P  +        G  V 
Sbjct: 7743 MLEESDSGDYTCIATNMAGSDE---CSAPLTVRE--PPSFVQKPDPMDVL----TGTNVT 7793

Query: 841  LVIPFQGKPRPELTWKKDGAEI---DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKV 897
                 +G P   ++W K  +E+   D+  +++ +S  +  +F    + S SG+Y   V  
Sbjct: 7794 FTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELF--DVDTSQSGEYTCIVSN 7851

Query: 898  D----------------KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
            +                KFV+  + D  I    G P I++        +++TW   K +G
Sbjct: 7852 EAGKASCTTHLYIKAPAKFVKRLN-DYSI--EKGKPLILEGTFTGTPPISVTW---KKNG 7905

Query: 942  NAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATM 1001
               I     Q+ +  + E   ++E        I    + +   +  + EN  G       
Sbjct: 7906 ---INVTPSQRCNITTTEKSAILE--------IPSSTVEDAGQYNCYIENASG------- 7947

Query: 1002 TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKIT 1061
                          K+         E P F + L       G +A+L C + G P+  ++
Sbjct: 7948 --------------KDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVS 7993

Query: 1062 WMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
            W K    +     Y+M     V TL   +    D G Y CKA N +G V     L V+
Sbjct: 7994 WYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQ 8051



 Score =  112 bits (280), Expect = 2e-24
 Identities = 102/419 (24%), Positives = 166/419 (39%), Gaps = 35/419 (8%)

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFT 778
             SP   L  D +   +V + WRPP   G A + GY+LE        W   +   +  T   
Sbjct: 30230 SPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGTSLV 30288

Query: 779   ITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEA 838
             + GL  + +   RV A N  G S+P    +P+  K  + PP+   P       +     +
Sbjct: 30289 VKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPE---PPSNPPEVLDVTKSS 30345

Query: 839   VNLVIPFQGKPRPELTWKKDGAEIDKNQIN----IRNSETD-TIIFIRKAERSHSGKYDL 893
             V+L      +P+ +   +  G  I++ + +    +R+++T  T             +Y  
Sbjct: 30346 VSLS---WSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQF 30402

Query: 894   QVKVDKFV---ETASIDIQII-----DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945
             ++     V   ET+     ++     D+P  P  ++I  +  ++V L W  P+ DG   I
Sbjct: 30403 RIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI 30462

Query: 946   TGYTIQKADKKSMEWF-TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKE 1004
              GY ++        W  +  E       TI  L+   EY FRVF+EN  GLS        
Sbjct: 30463 LGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMS 30522

Query: 1005  SAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK 1064
                    G              EAP   + + +     G  A L+C + G P P I W +
Sbjct: 30523 IKTKLTSG--------------EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR 30568

Query: 1065  NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
                 ++   +Y+M S+    TL +      D G Y C A N++G VE   KL ++   Q
Sbjct: 30569 FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQ 30627



 Score =  111 bits (278), Expect = 3e-24
 Identities = 200/932 (21%), Positives = 349/932 (37%), Gaps = 128/932 (13%)

Query: 239  KRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTK 297
            +R+++    E K+A   K      +V  G   +F  E+   P +  +W+K G+EI  S K
Sbjct: 3442 ERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDK 3501

Query: 298  YIFEHKGCQRILFINNCQMTDDSEYYVTAGDE----KCSTELFVRE--PPIMVTKQLEDT 351
                       L I   Q+ D  EY   A +E     C+  L V E  PP  +++  +  
Sbjct: 3502 CSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRP-KSL 3560

Query: 352  TAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
            T + G+  +  C V+        W K+G  + P P   +RI     KHIL +   T  D 
Sbjct: 3561 TTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSP--NWRISDAENKHILELSNLTIQDR 3618

Query: 411  AEYSVMTTGGQSS----AKLSVDLKP--LKILTPLTDQTVNLGKEICLKCEISEN--IPG 462
              YS   +    +    A+L +  KP  +K L P+      + K++ L+C++ E+  +  
Sbjct: 3619 GVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSA---INKKVHLECQVDEDRKVTV 3675

Query: 463  KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVID 520
             W+K+G  +      K+  + +I  L I  A  +D G YV   + +A + +  A V V +
Sbjct: 3676 TWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVRE 3735

Query: 521  PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
            PP  +      D +  ++ G   RL   + G P  +  W + +K + E S  +R      
Sbjct: 3736 PPSFV---KKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSE-SNTVRMYFVNS 3791

Query: 581  SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD----DWC 636
             + L I   + +DSG Y     N+ G    S ++ +    +PP      E  D       
Sbjct: 3792 EAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVI---KEPPSFIKTLEPADIVRGTNA 3848

Query: 637  IMNWEPPAYDGGSPI-LGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
            ++  E     G  P  + +F ++K+ +SS+  RL         F  K ++      + IF
Sbjct: 3849 LLQCE---VSGTGPFEISWFKDKKQIRSSKKYRL---------FSQKSLV-----CLEIF 3891

Query: 696  AVNAIGISKPSMPSRPFVPLA-------VTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAG 748
            + N+  + +        V          +  PPT +              +  D + A G
Sbjct: 3892 SFNSADVGEYECVVANEVGKCGCMATHLLKEPPTFV--------------KKVDDLIALG 3937

Query: 749  LDGYVLEYCFEGTE----DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG----A 800
                 L+    G+E     W+   + + +  K  ++     A + +    ++  G     
Sbjct: 3938 GQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCL 3997

Query: 801  SEPKYYSQPILVKEII-EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDG 859
            +E +  SQ  + + I+ EP KI     L Q      G+   L     G P  +  W KDG
Sbjct: 3998 AENEAGSQTSVGELIVKEPAKIIERAELIQV---TAGDPATLEYTVAGTPELKPKWYKDG 4054

Query: 860  AEI---DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP 916
              +    K +I+ +N+      +   AE   SG+Y  ++  +    +      ++DR   
Sbjct: 4055 RPLVASKKYRISFKNNVAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFTVLDR--- 4109

Query: 917  PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE 976
                        ++A  +T P  + ++ + G    + D K      +   + +    I  
Sbjct: 4110 ------------DIAPFFTKPLRNVDSVVNGTC--RLDCKIAGSLPMRVSWFKDGKEIA- 4154

Query: 977  LVIGNEYYFRVFSENMCGLS------EDA---TMTKESAVIARDGKIYKNPVYEDFDFSE 1027
                ++ Y   F E    L        DA   T    ++V ++D               E
Sbjct: 4155 ---ASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSS-------GALIVQE 4204

Query: 1028 APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
             P F     +   + G    L  + +G+    I W K    +V      +       +LE
Sbjct: 4205 PPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLE 4264

Query: 1088 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
            +      D GTY CK  N  G VE    L VK
Sbjct: 4265 LYLVKTSDSGTYTCKVSNVAGGVECSANLFVK 4296



 Score =  111 bits (277), Expect = 4e-24
 Identities = 171/794 (21%), Positives = 305/794 (38%), Gaps = 96/794 (12%)

Query: 356   GERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHI--LIIEGATKADAAE 412
             G  V+L   +S   A  ++W+K+ +E+    ++   + VE    +  ++I+ A + ++  
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKDDKEL----QTNALVCVENTTDLASILIKDADRLNSGC 26942

Query: 413   YSVMTTGGQSSAKLSVDL----KPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
             Y +       SA  ++ +    KP     P+  +TV   K   L    +++   K T   
Sbjct: 26943 YELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYI 27002

Query: 469   LPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH-VIDPPK 523
             +  +E+ R+   +    + + +I         +Y+F   A + Y +  P +   V+    
Sbjct: 27003 VEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNA 27062

Query: 524   IILDGLDADNTVTVIAGNKLRL----EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
              +  G      VT I  N + +     I   G         + DK  + G  ++  E+  
Sbjct: 27063 FVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSL-GWFKVLKETIR 27121

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGE---AHASIKVKVVDFPDPPVAPTVTEVGDDW- 635
             D+   V  + E  D   Y +   N AG+   +  S   K  D  DPP  P    + D   
Sbjct: 27122 DTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 27180

Query: 636   --CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETTFEPKKMIEGVAYEV 692
                 + W  P YDGGS + GY +E ++ +   W  ++     + T +    +  GV Y  
Sbjct: 27181 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 27240

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R+ AVN  G  +P   + P     +   P +       D  V +R      I  AG D  
Sbjct: 27241 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEI-------DLDVALR---TSVIAKAGEDVQ 27290

Query: 753   VLEYCFEG----TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN-----------A 797
             VL   F+G    T  W    K+L    +++I    TD+   + +  V             
Sbjct: 27291 VL-IPFKGRPPPTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQVTRNDTGKYILTIE 27347

Query: 798   AGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTYIRRVGE---------AVNLVIPF 845
              G  EPK  S  + VK +  P    K+++ +H+ +  +  + +          +N VI  
Sbjct: 27348 NGVGEPK--SSTVSVKVLDTPAACQKLQV-KHVSRGTVTLLWDPPLIDGGSPIINYVI-- 27402

Query: 846   QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 905
             + +   + TW     +       + +    T  F R    +  G       + +  ET  
Sbjct: 27403 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIG-------IGEPCETTE 27455

Query: 906   IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 965
               ++  + P P + + ++D    +V L+WT P  DG + IT Y +++  K    W +   
Sbjct: 27456 -PVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW-SHAG 27513

Query: 966   HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDF 1025
                     +++L   +   FRVF++N  GLS+  T+          G I    V E    
Sbjct: 27514 ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI----------GPI---TVKELIIT 27560

Query: 1026  SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCT 1085
              E  +   P        G+N  L    +G PKP I+W+K+ + + +    R    +   T
Sbjct: 27561 PEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT 27620

Query: 1086  LEIRKPSPYDGGTY 1099
             L I+      GG Y
Sbjct: 27621 LSIKNAKKEHGGKY 27634



 Score =  110 bits (276), Expect = 6e-24
 Identities = 178/826 (21%), Positives = 314/826 (38%), Gaps = 118/826 (14%)

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
             T   G  + L+  V  + +  + W K  +E+    K    ++  GK+   +I+   ++D+
Sbjct: 29058 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK--VSLQYTGKRATAVIKFCDRSDS 29115

Query: 411   AEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIP-----GKWT 465
              +Y++       +  +SV +K L    P    TV+   +   KC ++ ++P      + T
Sbjct: 29116 GKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQE--KCTLAWSLPQEDGGAEIT 29173

Query: 466   KNGLPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH---- 517
                +  +E+ RL  V+ +G    L           +Y+F   A + Y   +P +      
Sbjct: 29174 HYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA 29233

Query: 518   ----VIDPPKIILDGLDADNTVTVI--------AGNKLRLEIPISGEPPPKAMWSRGDKA 565
                  I  P  I + +       +I         GN++   + +         W+R +K 
Sbjct: 29234 RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYL-VDKREKKSLRWTRVNKD 29292

Query: 566   IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF-PDPPV 624
              +    R++  S  +       +   + +G       +E  EA   I  +   + P PP 
Sbjct: 29293 YVVYDTRLKVTSLMEGCDYQFRVTAVNAAG------NSEPSEASNFISCREPSYTPGPPS 29346

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC-KETTFEPKK 683
             AP V +       + W  P YDGG+ I+GY +E ++K + +W R++ +   + T F    
Sbjct: 29347 APRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPD 29406

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTT---------- 733
             +  G  Y  R+ AVN  G+S+ S       P+     P L   D +  T           
Sbjct: 29407 LKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRL 29466

Query: 734   -VTMRWRPPDHI--GAAGLDGYVLEYCFEGTEDW---IVANKDLIDKTKFTITGLPTDAK 787
              V++  RPP  I     G+D        + TE +   IV   +  D  K+TI        
Sbjct: 29467 MVSVSGRPPPVITWSKQGID-LASRAIIDTTESYSLLIVDKVNRYDAGKYTI-------- 29517

Query: 788   IFVRVKAVNAAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTY-----IRRV--GE 837
                  +A N +G       S  +LVK    P   P +++    + +      I  +  G 
Sbjct: 29518 -----EAENQSGKK-----SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 29567

Query: 838   AVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKV 897
              VN  I  + +      +K    +  K    I      T+ + R    +  G       +
Sbjct: 29568 PVNNYI-VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYG-------I 29619

Query: 898   DKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKS 957
              +  ET+   + + + P  P  +++ DV    V L W  P  DG + +TGY ++     +
Sbjct: 29620 GEPCETSDA-VLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGT 29678

Query: 958   MEWF-------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIAR 1010
               W        TV+EH      T+T L  G +Y FR+ ++N  G+SE       +AV  +
Sbjct: 29679 ERWMKVVTLKPTVLEH------TVTSLNEGEQYLFRIRAQNEKGVSEPRETV--TAVTVQ 29730

Query: 1011  DGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
             D ++         D S     T P    +  AG    L   + G P P  +W      + 
Sbjct: 29731 DLRVLPT-----IDLS-----TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR 29780

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
             +  R  + ++  V  L IR+ +  D G Y  +  N  GT     K+
Sbjct: 29781 ESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKV 29826



 Score =  110 bits (275), Expect = 7e-24
 Identities = 108/438 (24%), Positives = 170/438 (38%), Gaps = 62/438 (14%)

Query: 702   ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
             + KP +P+ P            +  D VT   +T++W PP   G + +  Y+LE      
Sbjct: 20073 VGKPGIPTGP------------IKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVN 20120

Query: 762   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-----SEPKYYSQPILVKEII 816
               W+      + KT F +T L    +   RV A N  G      SEP     P  V +  
Sbjct: 20121 NKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAP 20179

Query: 817   EPPKIRIPRH----LKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
              PP I   RH    L  T  ++ G +       + K R  L WK+     +K  I +R+ 
Sbjct: 20180 PPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKR----ANKTPIRMRDF 20235

Query: 873   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------IDIQIIDRPGPPQIVKIED 924
             +   +        +   +Y+ +V                  + +  ID PG P+++ I  
Sbjct: 20236 KVTGL--------TEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITR 20287

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE-HYHRTSATITELVIGNEY 983
                 +V L WT PK DG   +TGY ++K D  S  W      +    + T+T+LV G +Y
Sbjct: 20288 ---NSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKY 20344

Query: 984   YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-- 1041
              FR+ ++N  G     + + E+ +I +D            ++    +   P +       
Sbjct: 20345 EFRIRAKNTAGAISAPSESTET-IICKD------------EYEAPTIVLDPTIKDGLTIK 20391

Query: 1042  AGYNATLNC-SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
             AG    LN  S+ G P PK +W K    I      ++ S      L I+  +  D G Y 
Sbjct: 20392 AGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYT 20451

Query: 1101  CKAVNDLGTVEIECKLEV 1118
               A N  GT     K+ V
Sbjct: 20452 ITATNPFGTKVEHVKVTV 20469



 Score =  109 bits (273), Expect = 1e-23
 Identities = 118/440 (26%), Positives = 185/440 (42%), Gaps = 69/440 (15%)

Query: 597   YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
             Y +N    +  + AS  +   +  D P  P VT+V      + W  PAYDGGS ++GY I
Sbjct: 28916 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYII 28975

Query: 657   ERK---KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPF 712
             ERK   +    RW++ N+ +  +  F    + EG  YE R+ A NA G ISK S  + P 
Sbjct: 28976 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 29035

Query: 713   VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTED----WIVAN 768
                   +PP       +    VT+R         AG D  VL+    G  +    W   +
Sbjct: 29036 TCRDEYAPPKAELDARLHGDLVTIR---------AGSD-LVLDAAVGGKPEPKIIWTKGD 29085

Query: 769   K--DLIDKTKFTITGLPTDAKIFVRVKA------VNAAGASEPKYYSQPILVKEIIEPPK 820
             K  DL +K     TG    A I    ++      +    AS  K  S  ++VK +  P  
Sbjct: 29086 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVS--VMVKVLDSP-- 29141

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW----KKDGAEI--------DKNQIN 868
                            G    L +    + +  L W    +  GAEI        + +++N
Sbjct: 29142 ---------------GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLN 29186

Query: 869   --IRNSETDTIIFIRKAERSHSGKYDLQVK-VDKFVETASIDIQ-IIDR-----PGPPQI 919
               I   E  T+ ++       + +Y  +V+ V+K+     ++ + I+ R     P PP I
Sbjct: 29187 WVIVEGECPTLSYV-VTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGI 29245

Query: 920   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY--HRTSATITEL 977
              +      E++ + WT P+ DG   I+ Y + K +KKS+ W  V + Y  + T   +T L
Sbjct: 29246 PEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSL 29305

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + G +Y FRV + N  G SE
Sbjct: 29306 MEGCDYQFRVTAVNAAGNSE 29325



 Score =  109 bits (272), Expect = 2e-23
 Identities = 92/363 (25%), Positives = 161/363 (44%), Gaps = 18/363 (4%)

Query: 269  RVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGD 328
            R  F  E+++P + V+W K+ QE++ + +   + +     L I + +M+D  +Y V AG 
Sbjct: 3074 RAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG 3133

Query: 329  EKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               + +LFV    + +    ++      +R  +E EV+EDD +  W+K+G EI    + R
Sbjct: 3134 NVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER 3193

Query: 389  YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL-KPLKILTPLTDQTVNLG 447
            ++  VE + H + I    ++DA EY+ +    +SS  L V+  +P ++L  L   TV  G
Sbjct: 3194 HKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSG 3253

Query: 448  KEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF-A 504
            K       IS     K  W K    +    + K +H G+ + L++  A  ED   Y   A
Sbjct: 3254 KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEA 3313

Query: 505  PDAYNVTLPAKVHVIDPPKIILDGLD-----------ADNTVTVIAGNKLRLEIPISGEP 553
             + Y V   +    ++ P+++    +             +TVT   G   R +  +SG  
Sbjct: 3314 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVT-SEGQPARFQCRVSG-T 3371

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
              K  W   DK I + S   R   + D+  L I  A  +D G Y     N  G+  ++  
Sbjct: 3372 DLKVSWYSKDKKI-KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3430

Query: 614  VKV 616
            + +
Sbjct: 3431 LSL 3433



 Score =  108 bits (271), Expect = 2e-23
 Identities = 224/1076 (20%), Positives = 385/1076 (35%), Gaps = 142/1076 (13%)

Query: 91   TIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKF 150
            +I+WFK      AS+       K  F  H      E+  ++  D+  G Y C  T K   
Sbjct: 4705 SIQWFKDDQEISASE-------KYKFSFHDNTAFLEISQLEGTDS--GTYTCSATNKAGH 4755

Query: 151  DSCSFDLEVHE---------STGTTPNIDIRSAFKRSGEGQ------EDAGELDFSGLLK 195
            + CS  L V E         S    PN  ++      G         +D  EL       
Sbjct: 4756 NQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAA-- 4813

Query: 196  RREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFA 255
             R V + +    ++++        +   +++   G    +  L          K+   F 
Sbjct: 4814 -RSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLF--------VKEPPQFI 4864

Query: 256  KILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNC 314
            K   P   +  G    F  ++   PK+ V WY +G EI    K+            I+  
Sbjct: 4865 KKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGA 4924

Query: 315  QMTDDSEYYV----TAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVS-EDD 369
            ++ +   Y       AG   CS EL V+EPP  + ++L+         VELECEV+    
Sbjct: 4925 RVENSGTYVCEARNDAGTASCSIELKVKEPPTFI-RELKPVEVVKYSDVELECEVTGTPP 4983

Query: 370  ANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYS--VMTTGGQSSAKLS 427
              V W KN  EI    K  Y +        L I     +D  EY   V   GG  S    
Sbjct: 4984 FEVTWLKNNREIRSSKK--YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTR 5041

Query: 428  VDLK-PLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGR 484
            V LK P   +  + + T  L      +  ++ + P    W K+   + E D + +     
Sbjct: 5042 VALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDS 5101

Query: 485  IHKLVIANALTEDEGDYVF-APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKL 543
            +  L I +      G Y   A +   V       ++  P  I   ++   +V V   + +
Sbjct: 5102 VATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQI---VEKAKSVDVTEKDPM 5158

Query: 544  RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STLVIDIAERDDSGVYHINLK 602
             LE  ++G P  K  W +  K I+    R  + S+ ++ ++  I    + DSG Y   ++
Sbjct: 5159 TLECVVAGTPELKVKWLKDGKQIV--PSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVE 5216

Query: 603  NEAGEAHASIKVKVVDFPDPP-VAPTVTEVGDDWCIMNWEPPAYDGGSPILG-YFIERKK 660
            N+ G +     ++V+D   PP     +T++               G  PI   +F + K+
Sbjct: 5217 NDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKE 5276

Query: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
              +S   RL   +C E +      +E    E+   A     +S  +        L V  P
Sbjct: 5277 ISTSAKYRL---VCHERSVS----LEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEP 5329

Query: 721  PTLLT--------VDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLI 772
            P+ L          DS  +    ++  PP  I                   W   + +L+
Sbjct: 5330 PSFLVKPGRQQAIPDSTVEFKAILKGTPPFKI------------------KWFKDDVELV 5371

Query: 773  DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKE-------IIEPPKIRIPR 825
               K  I GL      F+ + +V+A+   +   +    +  +       + EPPK    +
Sbjct: 5372 SGPKCFI-GLEGSTS-FLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPK--FVK 5427

Query: 826  HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAER 885
             L+ + I + G++  L     G P   + W ++  E+  +    R +  D++  I+    
Sbjct: 5428 KLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASD-KYRMTFIDSVAVIQMNNL 5486

Query: 886  SHSGKYDLQVKVDKFVETASIDIQIIDRPGP-----PQIVKIEDVWGENVA----LTWTP 936
            S     D   +      + S   ++I +  P     P IV  E +    V+    L+ TP
Sbjct: 5487 STEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIV--ETLKNAEVSLECELSGTP 5544

Query: 937  PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 996
            P +     +  Y  ++  + S ++    +++H TS  I  +   +   +   ++N  G  
Sbjct: 5545 PFE-----VVWYKDKRQLRSSKKYKIASKNFH-TSIHILNVDTSDIGEYHCKAQNEVGSD 5598

Query: 997  EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNP 1056
                  K                       E P F   L +   +AG  A L  S+ G  
Sbjct: 5599 TCVCTVK---------------------LKEPPRFVSKLNSLTVVAGEPAELQASIEGAQ 5637

Query: 1057 KPKITWMKNKVAIV-DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVE 1111
               + W+K K  ++ +    R+   + V TL+  K  P + G Y C+  ND G  E
Sbjct: 5638 PIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRE 5693



 Score =  107 bits (268), Expect = 5e-23
 Identities = 123/468 (26%), Positives = 198/468 (42%), Gaps = 56/468 (11%)

Query: 196  RREVKQQEEE---PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA 252
            R + K++ EE     +   EL    K   YE++  +        +L   K +  EEKK+ 
Sbjct: 1998 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRK----TKDELLHWTKELTEEEKKAL 2053

Query: 253  AF-AKILDPAYQVDK-----------------------GGRVRFVVELAD-PKLEVKWYK 287
            A   KI  P ++ DK                       G    F V +   P  E +WYK
Sbjct: 2054 AEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYK 2113

Query: 288  NGQEIRPSTK---YIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTELFVREP 340
            NG +I  S +   Y  E   C+  L I +    D +   V     AG+      L V+  
Sbjct: 2114 NGVKIERSDRIYWYWPEDNVCE--LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2171

Query: 341  PIMV-TKQLEDTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             ++  T++L+D  A   + +   ECE SE    VKW+K+G E+  G K  YR+  + K H
Sbjct: 2172 QLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK--YRMHSDRKVH 2229

Query: 399  ILIIEGATKADAAEYS---VMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
             L I     +DA +YS   V     +++AKL V+   ++ +  L D  V       L+C 
Sbjct: 2230 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2289

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S ENI GKW  N + ++ + +  +  +     L + +   ED+G+Y F  D    T   
Sbjct: 2290 VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT--C 2347

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR 574
            K+ +   P  IL GL       V  G+ ++LE+ +S E   + +W + D   ++ S R+ 
Sbjct: 2348 KLKMKPRPIAILQGLSDQK---VCEGDIVQLEVKVSLE-SVEGVWMK-DGQEVQPSDRVH 2402

Query: 575  TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                  S  L+I+   ++D+G Y   +          + V  VD   P
Sbjct: 2403 IVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITP 2450



 Score =  107 bits (268), Expect = 5e-23
 Identities = 244/1136 (21%), Positives = 420/1136 (36%), Gaps = 179/1136 (15%)

Query: 63   KPQGGTVKVGEDITFIAKVKAEDLLRKP--------------TIKWFKGKWMDLASKAGK 108
            K   G + V E  +F+ K  ++D+L                 TI+WFKG   +L S    
Sbjct: 4194 KDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGN-KELVSGGSC 4252

Query: 109  HLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN 168
            ++  KE  E      + E+ ++K  D+  G Y C+V+       CS +L V E       
Sbjct: 4253 YIT-KEALES-----SLELYLVKTSDS--GTYTCKVSNVAGGVECSANLFVKEPATFVEK 4304

Query: 169  IDIRSAFKRSGEGQ-----EDAGELDFSGLLKRREVKQQEEEPQ--VDVWELLKNAKPSE 221
            ++     K+    Q          +  +     RE+K+  +     V+   +L+      
Sbjct: 4305 LEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLR------ 4358

Query: 222  YEKIAFQYGITDLRGMLKRLKRMRREE--------KKSAAFAKILDPAYQVDKGGRVRFV 273
                    GI D    +   +     +        K+S  F K   P  +V K   V  +
Sbjct: 4359 ----LTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKP-IEVLKEYDVMLL 4413

Query: 274  VELA-DPKLEVKWYKNGQEIRPSTKY---IFEHKGCQRIL-FI------NNCQMTDDSEY 322
             E+A  P  E+ W+K+   +R   KY   I +H    +IL F+        C++T++   
Sbjct: 4414 AEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNE--- 4470

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED-DANVKWFKNGEEI 381
                G   CS  + +REPP  + K++E T++  G     +  +       V W K+ +EI
Sbjct: 4471 ---VGSSICSARVTLREPPSFI-KKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEI 4526

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG----QSSAKLSVDLKPLKILT 437
                    R+  E     L + G       +Y           + SA LSV  +P  I  
Sbjct: 4527 T--EDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVK-EPATITE 4583

Query: 438  PLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALT 495
                  V  G    L+ + S  + I  KW K+G  +    + K+     +  L I +   
Sbjct: 4584 EAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEK 4643

Query: 496  EDEGDYVF--APDAYNVTLPAKVHVID---PPKIILDGLDADNTVTVIAGNKLRLEIPIS 550
            +D G+Y F    D    +  A+++V+D   PP         D+    I G+ + LE  ++
Sbjct: 4644 KDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDS----IKGSFIDLECIVA 4699

Query: 551  GEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHA 610
            G  P    W + D+ I   S + +   + +++ L I   E  DSG Y  +  N+AG    
Sbjct: 4700 GSHPISIQWFKDDQEI-SASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQC 4758

Query: 611  SIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG-SPILGYFIERKKKQSSRWMRL 669
            S  + V + P     P   +V  +  +   +  A  GG +P+   + +  K+  S   R 
Sbjct: 4759 SGHLTVKEPPYFVEKPQSQDVNPNTRV---QLKALVGGTAPMTIKWFKDNKELHSGAARS 4815

Query: 670  NFDLCKETTFE--PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVD 727
             +     T+ E    K  +   Y  ++        SK ++  +   P  +  P  +L + 
Sbjct: 4816 VWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKE-PPQFIKKPSPVLVLR 4874

Query: 728  SVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDL--ID-KTKFTITGLPT 784
            +   TT   +          G     + +  +G E   +    +  ID    F I+G   
Sbjct: 4875 NGQSTTFECQ--------ITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARV 4926

Query: 785  DAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP 844
            +       +A N AG +         +  ++ EPP     R LK   + +  + V L   
Sbjct: 4927 ENSGTYVCEARNDAGTASCS------IELKVKEPP--TFIRELKPVEVVKYSD-VELECE 4977

Query: 845  FQGKPRPELTWKKDGAEIDKNQINIRNSETDTI----IFIRKAERSHSGKYDLQVKVDKF 900
              G P  E+TW K+  EI  ++   + + TD +    + I K + S +G+Y  Q  V   
Sbjct: 4978 VTGTPPFEVTWLKNNREIRSSK---KYTLTDRVSVFNLHITKCDPSDTGEY--QCIVSNE 5032

Query: 901  VETASIDIQIIDRPGPPQIVKIED---------------VWGENVALTWTPPKDDGNAAI 945
              + S   ++  +  P  I KIE+                    +++TW   KDD     
Sbjct: 5033 GGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWL--KDD----- 5085

Query: 946  TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE--DATMTK 1003
                 Q  D+    + + ++     +  I  +  G+   +   ++N  G+       + +
Sbjct: 5086 -----QILDEDDNVYISFVDSV--ATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQ 5138

Query: 1004 ESAVIARDGKIYKNPVYEDFDFSEA-PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1062
            E A I    K          D +E  PM                TL C V G P+ K+ W
Sbjct: 5139 EPAQIVEKAK--------SVDVTEKDPM----------------TLECVVAGTPELKVKW 5174

Query: 1063 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
            +K+   IV    + M     V +  I+     D G Y  K  ND G+   +  L V
Sbjct: 5175 LKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRV 5230



 Score =  106 bits (265), Expect = 1e-22
 Identities = 127/538 (23%), Positives = 203/538 (37%), Gaps = 68/538 (12%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P V +       + W+PPA DGGSPI GY +E +++ ++ W R+N      TT 
Sbjct: 15705 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 15764

Query: 680   E--PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTV--- 734
             E     + E   Y  R+ AVN  G S+PS  +       +   P +       D  V   
Sbjct: 15765 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKA 15824

Query: 735   --------TMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDA 786
                      ++ RP     +   DG   +   +G  D I  +  L      ++  +P   
Sbjct: 15825 GSQIRIPAVIKGRPTPK-SSWEFDGKAKKAMKDGVHD-IPEDAQLETAENSSVIIIPECK 15882

Query: 787   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP-- 844
             +      ++ A   +  K  +  + V ++  PPK      LK + I R    ++  +P  
Sbjct: 15883 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDD 15937

Query: 845   ----------FQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR-KAERSHSGKYDL 893
                        + +      W K   +       + +  ++   F R +AE     ++ +
Sbjct: 15938 DGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAEN----RFGI 15993

Query: 894   QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ-- 951
                V+    T + D   I  P PP  +KI  +    V L+W PPK+DG + +T Y ++  
Sbjct: 15994 GPPVETIQRTTARDP--IYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECL 16051

Query: 952   ---KADKKSMEWFTVIEH-YHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAV 1007
                    K   W    +        T+ +LV G EY FRV + N  G+S+ +        
Sbjct: 16052 AWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDC 16111

Query: 1008  IARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK--- 1064
                D      P  +  +F E               G N  +   ++G P P +TW K   
Sbjct: 16112 QRPD----MPPSIDLKEFMEVE------------EGTNVNIVAKIKGVPFPTLTWFKAPP 16155

Query: 1065  ----NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                 NK  ++ D           CTL I +    D G Y   AVN+LGT   E +L V
Sbjct: 16156 KKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 16213



 Score =  106 bits (264), Expect = 1e-22
 Identities = 184/906 (20%), Positives = 335/906 (36%), Gaps = 132/906 (14%)

Query: 266  KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
            +G   RF   ++   L+V WY   ++I+PS  +          L I      D+  Y   
Sbjct: 3358 EGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFV 3417

Query: 326  A----GDEKCSTELFVREPPI------------------MVTKQLEDTTAYCGERVELEC 363
            A    G    +  L +  P                    ++ +++E      G   +  C
Sbjct: 3418 ASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTC 3477

Query: 364  EV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE--GATKADAAEYSVMTTGG 420
            E+ S  +   +WFK G EI    K   R      K+I  +E       D  EY+   +  
Sbjct: 3478 EIQSAPNVRFQWFKAGREIYESDKCSIR----SSKYISSLEILRTQVVDCGEYTCKASNE 3533

Query: 421  QSSAKLSVDLK-----PLKILTPLTDQTVNLGKEICLKCEISEN--IPGKWTKNGLPVQE 473
              S   +  L      P   L+     T  +GK     C ++    I   W K+G  +  
Sbjct: 3534 YGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSP 3593

Query: 474  SDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYNVTL-PAKVHVIDPPKIILDGLDA 531
            S   ++      H L ++N   +D G Y   A + +   +  A++ +ID P  I +    
Sbjct: 3594 SPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPV 3653

Query: 532  DNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTESYPDSSTLVIDIAE 590
             + +      K+ LE  +  +      WS+  + +  G   +I  E     +TL I +A+
Sbjct: 3654 QSAI----NKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFED--KIATLEIPLAK 3707

Query: 591  RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD---G 647
              DSG Y     NEAG +  S  V V    +PP    V +V   + ++  E         
Sbjct: 3708 LKDSGTYVCTASNEAGSSSCSATVTV---REPP--SFVKKVDPSYLMLPGESARLHCKLK 3762

Query: 648  GSPIL--GYFIERKKKQSSRWMRLNFDLCKETTFE--PKKMIEGVAYEVRIFAVNAIGIS 703
            GSP++   +F   K+   S  +R+ F +  E   +    K+ +  +Y     AVN +G  
Sbjct: 3763 GSPVIQVTWFKNNKELSESNTVRMYF-VNSEAILDITDVKVEDSGSYSCE--AVNDVGSD 3819

Query: 704  KPSMPSRPFVPLAVTSPP----TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFE 759
              S        + +  PP    TL   D V  T   ++         +G   + +     
Sbjct: 3820 SCS------TEIVIKEPPSFIKTLEPADIVRGTNALLQCE------VSGTGPFEI----- 3862

Query: 760  GTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
                W    K +    K+ +      + + + + + N+A   E        +V   +   
Sbjct: 3863 ---SWFKDKKQIRSSKKYRL--FSQKSLVCLEIFSFNSADVGE-----YECVVANEVGKC 3912

Query: 820  KIRIPRHLKQ--TYIRRV-------GEAVNLVIPFQGKPRPELTWKKDGAEI--DKNQIN 868
                   LK+  T++++V       G+ V L    +G     +TW K G E+  +  +I 
Sbjct: 3913 GCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMK-GQEVIREDGKIK 3971

Query: 869  IRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGE 928
            +  S    ++ I   + S  GKY    + +   +T+  ++ + +   P +I++      E
Sbjct: 3972 MSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE---PAKIIE----RAE 4024

Query: 929  NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 988
             + +T       G+ A   YT+    +   +W+                ++ ++ Y   F
Sbjct: 4025 LIQVT------AGDPATLEYTVAGTPELKPKWY-----------KDGRPLVASKKYRISF 4067

Query: 989  SENMCGLSEDATMTKESA-----VIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1043
              N+  L   +    +S      +    G       +   D   AP FT+PL N  ++  
Sbjct: 4068 KNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVN 4127

Query: 1044 YNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1103
                L+C + G+   +++W K+   I    RYR+   +G  +LEI +    D G + C+A
Sbjct: 4128 GTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRA 4187

Query: 1104 VNDLGT 1109
             N +G+
Sbjct: 4188 TNSVGS 4193



 Score =  105 bits (263), Expect = 2e-22
 Identities = 101/375 (26%), Positives = 158/375 (42%), Gaps = 21/375 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +G  V+  V+++   +E  W K+GQE++PS +          +L I +    D   Y
Sbjct: 2366 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2425

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDD-ANVKWFKNGEEI 381
              T      ST   V    + V   L+D     G +  LEC+VS  D  +VKW+ N E+I
Sbjct: 2426 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2485

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
               P  R +  V+G K  L+I     +D   Y ++    +++  LSV+   +KI+  L D
Sbjct: 2486 --KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRD 2541

Query: 442  QTVNLGKEICLKCEISEN-IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T    + +  + E+S + I   W      ++ S + K+   G+I+KL + N + +DEG 
Sbjct: 2542 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2601

Query: 501  YVF--APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAM 558
            Y F    +  +  L      I  P         D TV          E+     P  K  
Sbjct: 2602 YTFYAGENMTSGKLTVAGGAISKPL-------TDQTVAESQEAVFECEV---ANPDSKGE 2651

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            W R  K  +  +  IR+ES      L+I   + DD G Y    K    +  A +KV+ V 
Sbjct: 2652 WLRDGKH-LPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVK 2708

Query: 619  FPDPPVAPTVTEVGD 633
                    TVTE  D
Sbjct: 2709 IKKTLKNLTVTETQD 2723



 Score =  102 bits (255), Expect = 2e-21
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 15/389 (3%)

Query: 248   EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK-GCQ 306
             E+    F K L+    V KG  +    EL + + +V W K+G+ +      I     G  
Sbjct: 11208 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 11266

Query: 307   RILFINNCQMTDDSEYYVT---AGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELE 362
             R L IN+   TD   Y VT   A + +CS+ + V E     + K + D            
Sbjct: 11267 RALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFA 11326

Query: 363   CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQS 422
             C++++D  N+KWFK  +EI   P  +  I  +G    L I+ A   D AEY+V   G + 
Sbjct: 11327 CDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRY 11386

Query: 423   SAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVH 481
              AKL++  + +++L P+ D T+   +      EISE +IPG+W   G  ++ S   ++  
Sbjct: 11387 PAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKA 11446

Query: 482   KGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGN 541
             +G    L +     +  G+ ++   A N    A   ++   +I LD       VTV    
Sbjct: 11447 EGGKRFLTLHKVKLDQAGEVLY--QALNAITTA---ILTVKEIELDFAVPLKDVTVPERR 11501

Query: 542   KLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINL 601
             + R E  ++ E     +WS+G   I++ S +    +      LVI+ ++ DD GVY   +
Sbjct: 11502 QARFECVLTRE--ANVIWSKGPD-IIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEV 11558

Query: 602   KNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             + +   A   +    + F  P    TV E
Sbjct: 11559 EGKKTSARLFVTGIRLKFMSPLEDQTVKE 11587



 Score =  102 bits (254), Expect = 2e-21
 Identities = 85/281 (30%), Positives = 121/281 (43%), Gaps = 16/281 (5%)

Query: 283   VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
             V W K    I+ S K+     G + IL IN+ Q  D+  Y      +K S  LFV    +
Sbjct: 11515 VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRL 11574

Query: 343   MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                  LED T   GE     CE+S +  +V WFKN  ++         I  EGK H L +
Sbjct: 11575 KFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL--HTSRTVLISSEGKTHKLEM 11632

Query: 403   EGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG 462
             +  T  D ++         S+A+L V          L D+T     EI LKCE+S+++P 
Sbjct: 11633 KEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPV 11692

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV----FAPDAYNVTLPAKVHV 518
             KW K+G  +  S +  +   G    L I  A  +D+G+YV          NVT+ A++  
Sbjct: 11693 KWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIK 11752

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
             ++ P   L G      V V  G     EI +S EP     W
Sbjct: 11753 VEKP---LYG------VEVFVGETAHFEIELS-EPDVHGQW 11783



 Score =  102 bits (254), Expect = 2e-21
 Identities = 174/746 (23%), Positives = 285/746 (38%), Gaps = 121/746 (16%)

Query: 340   PPIMVTKQLEDTTAYCGERVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             P I++ +Q+   T   G+++ +E  V  +     KW K  +E++    S   +       
Sbjct: 18900 PKILMPEQI---TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTS--SHLAVHKADSSS 18954

Query: 399   ILIIEGATKADAAEYSVMT--TGGQSSAKLSV--------------------DLKPLKIL 436
             ILII+  T+ D+  YS+    + G  + K+ V                    D   L   
Sbjct: 18955 ILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWH 19014

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKW-TKNGLPVQESDRLKVVHKGRIH--------K 487
              PL D   N+   I  KC++S    G W T      + S R+  +  G+ +        +
Sbjct: 19015 IPLEDGGSNITNYIVEKCDVSR---GDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENR 19071

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL--DGLDADNTVTVIAGNKLRL 545
               I+  LT  +    F     +    A+V  ++   I +  D  D+D    +I       
Sbjct: 19072 FGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG------ 19125

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
                I  +     +W + +  +      +R+  YP +   +++  E      + I   N+A
Sbjct: 19126 -YLIERKERNSLLWVKANDTL------VRSTEYPCAG--LVEGLEYS----FRIYALNKA 19172

Query: 606   GEAHASIKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
             G +  S   + V      DPP  P V +V      + W  P +DGGS I+GYF+E  K  
Sbjct: 19173 GSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLP 19232

Query: 663   SSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
               +W+R N       +  +    + E   Y+ R  A  A+ IS PS PS P   LA   P
Sbjct: 19233 GDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVP 19292

Query: 721   P---------TLLTVDSVT----DTTV------TMRWRPPDHI--GAAGLDGYVLEYCFE 759
             P         +LLTV + T    D TV      T+ W+    +   A G+    ++    
Sbjct: 19293 PRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIK-MAMQRNLC 19351

Query: 760   GTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP----KYYSQPILVKEI 815
               E + V  KD  D T  T           +++K ++  G        K YS   ++   
Sbjct: 19352 TLELFSVNRKDSGDYT-ITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSW- 19409

Query: 816   IEPPKIRIPRHLKQTYIRRVG-EAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSET 874
              EPP            +   G E  N ++  +   RP   W +  A +     ++     
Sbjct: 19410 -EPP------------LEDGGSEITNYIVDKRETSRPN--WAQVSATVPITSCSVEKLIE 19454

Query: 875   DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTW 934
                   R    +  G  D       F E A I     D PG      I ++  +++ ++W
Sbjct: 19455 GHEYQFRICAENKYGVGD-----PVFTEPA-IAKNPYDPPGRCDPPVISNITKDHMTVSW 19508

Query: 935   TPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI--TELVIGNEYYFRVFSENM 992
              PP DDG + ITGY ++K + +++ W T +        T+  T L  G EY FRV + N 
Sbjct: 19509 KPPADDGGSPITGYLLEKRETQAVNW-TKVNRKPIIERTLKATGLQEGTEYEFRVTAINK 19567

Query: 993   CGLSEDATMTKESAVIARDGKIYKNP 1018
              G  + +  +K  A  ARD +    P
Sbjct: 19568 AGPGKPSDASK--AAYARDPQYPPGP 19591



 Score =  101 bits (251), Expect = 5e-21
 Identities = 123/553 (22%), Positives = 204/553 (36%), Gaps = 63/553 (11%)

Query: 597   YHINLKNEAGEAHASIKVKVV---DFPDPPVAPTVTEVGDDW---CIMNWEPPAYDGGSP 650
             + +  +NE G    S+  + V   D  +PP  PT   V D       + W  P YDGG+P
Sbjct: 18468 FRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 18527

Query: 651   ILGYFIERKKKQSSR-----WMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             I+GY +E + K +       W R N         F    + E   YE R+ A N +GI +
Sbjct: 18528 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 18587

Query: 705   PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVT-----------MRWRPPDHIG--AAGLDG 751
             P+       P  +  PP +    S+    +            +R RP   +     G+D 
Sbjct: 18588 PAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDN 18647

Query: 752   YVLEYCFEGTEDW---IVANKDLIDKTKFTITGL-PTDAK-IFVRVKAVNAAGASEPKYY 806
              V +   +  +     ++ N    D  K+++T + P   K +FV V+ ++  G       
Sbjct: 18648 VVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPG------- 18700

Query: 807   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ 866
               P+   ++ +  K     H+        G +       + +     TW     E+ K  
Sbjct: 18701 --PVSDLKVSDVTKTSC--HVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTS 18756

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
              ++ N       + R    +  G       V   V    +    +  P PP+ +++ ++ 
Sbjct: 18757 FHVTNLVPGNEYYFRVTAVNEYGP-----GVPTDVPKPVLASDPLSEPDPPRKLEVTEMT 18811

Query: 927   GENVALTWTPPKDDGNAAITGY-TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYF 985
               +  L W PP  DG A I GY T  + +++  + +T        S  +T L  G +Y F
Sbjct: 18812 KNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKF 18871

Query: 986   RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1045
             RV + N  G+S           + R+ +     VYE  +    P    P   T   AG  
Sbjct: 18872 RVAARNAVGVS-----------LPREAE----GVYEAKEQLLPPKILMPEQITIK-AGKK 18915

Query: 1046  ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVN 1105
               +   V G P P   W K +  +V      +        L I+  +  D G Y   A N
Sbjct: 18916 LRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAEN 18975

Query: 1106  DLGTVEIECKLEV 1118
               GT   + K+ V
Sbjct: 18976 SSGTDTQKIKVVV 18988



 Score =  100 bits (249), Expect = 8e-21
 Identities = 93/398 (23%), Positives = 157/398 (39%), Gaps = 40/398 (10%)

Query: 728   SVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAK 787
             +VT   +T+ WRPP   G A +  Y++E        W + ++ L ++   T T +    +
Sbjct: 26977 TVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL-EECIITTTKIIKGNE 27035

Query: 788   IFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT-------YIRRVGEAVN 840
                RV+AVN  G  EP      +     + P    IP   K T       + R + +  +
Sbjct: 27036 YIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGS 27095

Query: 841   LVIPF--QGKPRPELTW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 895
              +  +  + + +  L W    K+     + ++      +D    +     +  G +    
Sbjct: 27096 DISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFS--- 27152

Query: 896   KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
             +  +F + A      ID PGPP  ++I D    ++ L W+ P  DG +A+TGY ++    
Sbjct: 27153 EPSEFYKAADP----IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQG 27208

Query: 956   KSMEWFTVIE--HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1013
             +  EW TV        T   ++ L  G  YYFRV + N  G  E   M            
Sbjct: 27209 EEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEM------------ 27256

Query: 1014  IYKNPVYEDFDFSEAPMFTQPLV---NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
                N   +  D  EAP     +    +  A AG +  +    +G P P +TW K++  + 
Sbjct: 27257 ---NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLG 27313

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              D RY + +      L I + +  D G Y     N +G
Sbjct: 27314 SDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVG 27351



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 93/361 (25%), Positives = 149/361 (41%), Gaps = 12/361 (3%)

Query: 271   RFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
             +F  E++      +W K  QEI    ++     G +  + I +    D+++Y   A D+ 
Sbjct: 11858 KFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH 11917

Query: 331   CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
              S +L +    +     L+D TA   E      E+S D+  VKWFKN + +         
Sbjct: 11918 TSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL--HTTRSVS 11975

Query: 391   IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
             ++ EGK H +  +  +  D ++  V   G  S AKL+V          L D T     E+
Sbjct: 11976 MQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV 12035

Query: 451   CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN 509
              L+CEIS+ + P KW K+G  ++ S    +   G+   L++  AL  D G Y    D   
Sbjct: 12036 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC--DCGT 12093

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS-RGDKAIME 568
                  K+ + D    ++  L   ++V V+     R E  IS E    A W  +G+  +  
Sbjct: 12094 DKTSGKLDIEDREIKLVRPL---HSVEVMETETARFETEIS-EDDIHANWKLKGEALLQT 12149

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
                 I+ E    S  LV+     D +G       N    AH  +K +V+    P    TV
Sbjct: 12150 PDCEIKEEGKIHS--LVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 12207

Query: 629   T 629
             T
Sbjct: 12208 T 12208



 Score = 95.5 bits (236), Expect = 2e-19
 Identities = 111/492 (22%), Positives = 196/492 (39%), Gaps = 52/492 (10%)

Query: 648   GSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             G P+    + R        MR N ++  E  T   K+ +   A    I A N+ G +K  
Sbjct: 26502 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 26561

Query: 707   MPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
             +     V L    PPT  + +  +T+ +VT++W PP + G + +  Y+L      T  W 
Sbjct: 26562 IN---IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWT 26618

Query: 766   VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK---EIIEPPKIR 822
               +   + +T   +  L T  +   R+KA N  G S+    S  + VK       PP   
Sbjct: 26619 EVSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISD-HIDSACVTVKLPYTTPGPPSTP 26676

Query: 823   IPRHLKQTYI-----RRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETD 875
                ++ +  I       V    + V+ +  + K R  + W+K       N++ IR +   
Sbjct: 26677 WVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK------ANKLVIRTTH-- 26728

Query: 876   TIIFIRKAERSHSGKYDLQVKVDKFVETA-----SIDIQIIDRPGPPQIVKIEDVWGENV 930
                  +    S    Y+ +V  +           S  +  ID   PP+ V+I D+   +V
Sbjct: 26729 ----FKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSV 26784

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFS 989
             +L+W  P  DG + ITGY +++ D     W      +   T   I+ L   ++Y FRVF+
Sbjct: 26785 SLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFA 26844

Query: 990   ENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI---AGYNA 1046
              N  G     +++  S V+         P+    D    P+   PL  T  +   AG + 
Sbjct: 26845 RNAVG-----SISNPSEVVG--------PI-TCIDSYGGPVIDLPLEYTEVVKYRAGTSV 26890

Query: 1047  TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1106
              L   + G P P I W K+   +  +    + +   + ++ I+     + G Y  K  N 
Sbjct: 26891 KLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNA 26950

Query: 1107  LGTVEIECKLEV 1118
             +G+     ++++
Sbjct: 26951 MGSASATIRVQI 26962



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 105/462 (22%), Positives = 179/462 (38%), Gaps = 52/462 (11%)

Query: 672   DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTD 731
             D C+E        +   A E  I  +N I + KP  P+ P            + +D VT 
Sbjct: 22209 DACREDVGHYVVKLTNSAGEA-IETLNVIVLDKPGPPTGP------------VKMDEVTA 22255

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVR 791
              ++T+ W PP + G + ++ Y++E     T  W + +   + +T      L T  +   R
Sbjct: 22256 DSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSAT-VARTTIKACRLKTGCEYQFR 22314

Query: 792   VKAVNAAGAS-----EPKYYSQPILVKEIIEPPKIRIPRH--LKQTYIRRVGEAVNLVIP 844
             + A N  G S     EP     P  V      P + +     ++  +   + +  + VI 
Sbjct: 22315 IAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIG 22374

Query: 845   F--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
             +  + K R  + W K    ++K  I     +T  +    + E   S +  + +     V 
Sbjct: 22375 YHLERKERNSILWVK----LNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVS 22430

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
                +     D PG P+ + +      +V L W  P  DG + ITGY ++K +     W  
Sbjct: 22431 ECYVARDPCDPPGRPEAIIVTR---NSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMK 22487

Query: 963   V-IEHYHRTSATITELVIGNEYYFRVFSENMCGL-SEDATMTKESAVIARDG----KIYK 1016
                 +   T   +T LV  + Y FRV + N  G+ SE +  T   A+ ARD     +I  
Sbjct: 22488 ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSEST--GAITARDEVDPPRISM 22545

Query: 1017  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1076
             +P Y+D                   AG +  ++  + G P P I W+K    + +  R  
Sbjct: 22546 DPKYKD--------------TIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLE 22591

Query: 1077  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             + S     +L ++     D G Y  KA N  G   +   ++V
Sbjct: 22592 IKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 147/655 (22%), Positives = 260/655 (39%), Gaps = 108/655 (16%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E+ SK  E   +  K      T   E +A +  +S+  I  +   Q  TV       F  
Sbjct: 32816 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVI--VTGLQDTTVSSDSVAKFAV 32873

Query: 80    KVKAEDLLRKPTIKWFK--------GKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
             K   E    +PT  W K        GK+     K G  L++ +T    S +YT  ++   
Sbjct: 32874 KATGEP---RPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVK--- 32927

Query: 132   AKDNFAGNYR--CEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELD 189
                N AG+    C++T K   D+ +  +   +++  TP        K++   +E + +  
Sbjct: 32928 ---NSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQ-------KKAVVQEEISQKAL 32977

Query: 190   FSGLLKRREVKQQE------EEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKR 243
              S  +K  E K QE      E  +V + E +K +  +  EK      IT           
Sbjct: 32978 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTS-------- 33029

Query: 244   MRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
                EE ++ A  K       +++G R+     +A    +VKW  NG E+  S +Y +   
Sbjct: 33030 QASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVS 33088

Query: 304   GCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYC---- 355
             G  + L I      D+      +    G  KC  +L        ++K+L D  A+     
Sbjct: 33089 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDL-------TLSKELSDAPAFISQPR 33141

Query: 356   ------GERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
                   G+ V   CE+S E    ++WFKN   I     S   I      + L I  A+ +
Sbjct: 33142 SQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI--SISSNVSISRSRNVYSLEIRNASVS 33199

Query: 409   DAAEYSVMTTG--GQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTK 466
             D+ +Y++      GQ SA  S+      ++ PL ++     +E+ L+     ++ G ++ 
Sbjct: 33200 DSGKYTIKAKNFRGQCSATASL------MVLPLVEEP---SREVVLRTSGDTSLQGSFSS 33250

Query: 467   NGLPVQESDR-----------LKVVHKGRIHKLVIANALTEDEGDYVFAPDAY----NVT 511
               + +  S +              + + +   +   +  +  E     +  ++    N+T
Sbjct: 33251 QSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT 33310

Query: 512   ---------LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
                      L A +  I PPKI  + L +D  +++  G  L +    +GEP P+  WS G
Sbjct: 33311 QLESSTSKMLKAGIRGI-PPKI--EALPSD--ISIDEGKVLTVACAFTGEPTPEVTWSCG 33365

Query: 563   DKAI-MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              + I  +  GR   E+  D +TL+I   ++ D G+Y ++L NE G   A++ + +
Sbjct: 33366 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 133/594 (22%), Positives = 227/594 (38%), Gaps = 52/594 (8%)

Query: 60   FIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERH 119
            F++KP    V  G ++TF + VK        ++ WFKG   +L      ++ L+++    
Sbjct: 7777 FVQKPDPMDVLTGTNVTFTSIVKGTPPF---SVSWFKGS-SELVPGDRCNVSLEDSVA-- 7830

Query: 120  SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSG 179
                  E+++     + +G Y C V+ +    SC+  L +         ++  S  K   
Sbjct: 7831 ------ELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKP 7884

Query: 180  EGQEDA--GELDFSGLLKRREVKQQEEEPQVDVWELLKNAK---PSEYEKIAFQYGITDL 234
               E    G    S   K+  +     + + ++    K+A    PS   + A QY     
Sbjct: 7885 LILEGTFTGTPPISVTWKKNGINVTPSQ-RCNITTTEKSAILEIPSSTVEDAGQYNCYIE 7943

Query: 235  RGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIR 293
                K     +    +   F K L+P  +V  G       +LA  P++ V WYK   ++R
Sbjct: 7944 NASGKDSCSAQILILEPPYFVKQLEPV-KVSVGDSASLQCQLAGTPEIGVSWYKGDTKLR 8002

Query: 294  PSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREP--PIMVTKQ 347
            P+T Y    +     L  N   + D  EY   A    G+   ST L V+E   P   ++Q
Sbjct: 8003 PTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQ 8062

Query: 348  LEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT 406
            L D     G  V  +C +S  +  +V W+K+G+ +   P    +         L I    
Sbjct: 8063 LRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSP--NVQTSFLDNTATLNIFKTD 8120

Query: 407  KADAAEYSVMTTGGQSSAKLSVDLKPLKILTP------LTDQTVNLGKEICLKCEISENI 460
            ++ A +YS   T    SA  S  L   +   P      L      +G+    +C ++   
Sbjct: 8121 RSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQ 8180

Query: 461  PGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV------FAPDAYNVTL 512
            P K  W K+   ++   + ++ +      L +      D G Y          D+    L
Sbjct: 8181 PIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQL 8240

Query: 513  PAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGR 572
              K  +I PP           TV    GN  +LE  ++G  P    W + +  I   S  
Sbjct: 8241 NIKERLI-PPSFT---KRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTS-- 8294

Query: 573  IRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               E    ++TLV+ +  A  +D+G+Y   + N+AG A  +  + + +   PPV
Sbjct: 8295 -NCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPV 8347



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 201/953 (21%), Positives = 329/953 (34%), Gaps = 190/953 (19%)

Query: 259   DPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMT 317
             D  Y   +    R  + +   P   V W K    +   T+   E       L + +CQ +
Sbjct: 19989 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 20048

Query: 318   DDSEYYVT----AGDEKCSTELFVREPPIMVTKQL--EDTTAYC------------GERV 359
             D  +Y +T    AG ++ +  + V   P + T  +  ++ TA              G  +
Sbjct: 20049 DAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEI 20108

Query: 360   ELECEVSEDDANVKWFKNGEEIIPGPKSRYRI-----------RVEGKKHILIIEGATKA 408
                     D  N KW      +    K+ +R+           RV  +    + EG    
Sbjct: 20109 TNYILEKRDSVNNKWVTCASAV---QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSE 20165

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC-LKCEISENIPGKWTK- 466
                                VD++   +    TD     G  I     E  E     W + 
Sbjct: 20166 PIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA 20225

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL 526
             N  P++  D  KV              LTE   +Y F   A N+    K  +   P + L
Sbjct: 20226 NKTPIRMRD-FKVT------------GLTEGL-EYEFRVMAINLAGVGKPSLPSEPVVAL 20271

Query: 527   DGLDAD----------NTVTVI-------AGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             D +D            N+VT+I        G+KL   I    + P K+ W + +      
Sbjct: 20272 DPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS-WMKANHV---- 20326

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYH--INLKNEAGEAHA-SIKVKVVDFPDPPVAP 626
                    + P+ +  V D+ E    G Y   I  KN AG   A S   + +   D   AP
Sbjct: 20327 -------NVPECAFTVTDLVE---GGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 20376

Query: 627   TVTEVGDDWCIMNWEPPAYDG-----GSPIL--GYFIERKKKQSSRWMRLNFDL----CK 675
             T+            +P   DG     G  I+     I  K    S W +   D+      
Sbjct: 20377 TIV----------LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDIT 20426

Query: 676   ETTFEPKKMIEGVAYEVR-------IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             + T  P   +  + Y  R       I A N  G     +       L V  PP  + + +
Sbjct: 20427 QITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPVEISN 20483

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKI 788
             V+    T+ W PP   G + +  Y+LE        W V ++D I   +   T L    + 
Sbjct: 20484 VSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSED-IQSCRHVATKLIQGNEY 20542

Query: 789   FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 848
               RV AVN  G  EP   S+P+ + +   PP                G      +    K
Sbjct: 20543 IFRVSAVNHYGKGEP-VQSEPVKMVDRFGPP----------------GPPEKPEVSNVTK 20585

Query: 849   PRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETA 904
                 ++WK+     G+EI    +  R  E  ++ ++R  +   S   DL+ KV    E +
Sbjct: 20586 NTATVSWKRPVDDGGSEITGYHVERR--EKKSLRWVRAIKTPVS---DLRCKVTGLQEGS 20640

Query: 905   SIDIQIIDR-----------------------PGPPQIVKIEDVWGENVALTWTPPKDDG 941
             + + ++                          PGPP    + D   ++ +L W  P  DG
Sbjct: 20641 TYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDG 20700

Query: 942   NAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN-----EYYFRVFSENMCGLS 996
                ITGY ++        W   I+    T+  IT+ V+ +     +Y FR+ + N  G+ 
Sbjct: 20701 GLEITGYVVEHQKVGDEAW---IKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVG 20757

Query: 997   EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGN 1055
             E A +         D +I +  +  DF+          L  T  + AG +  +   ++G 
Sbjct: 20758 EPAVIP--------DVEIVEREMAPDFELDAE------LRRTLVVRAGLSIRIFVPIKGR 20803

Query: 1056  PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
             P P++TW K+ + + +  R  + + +    L I + + YD G +     N  G
Sbjct: 20804 PAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTGKFVMTIENPAG 20854



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 127/584 (21%), Positives = 221/584 (37%), Gaps = 94/584 (16%)

Query: 581   SSTLVIDIAERDDSGV--YHINLKNEAGEAH----ASIKVKV------VDFPDPPVAPTV 628
             S T  I++++  +  V  + +  KNE G +       I VK       VD  D P A   
Sbjct: 27515 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVT 27574

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEG 687
               +G +   ++ E P      P + +  +    + S ++R +    K T + +  K   G
Sbjct: 27575 VRIGHN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHG 27631

Query: 688   VAYEVRI--------FAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
               Y V +          +  I +  PS P  P            +  D +   +V + W 
Sbjct: 27632 GKYTVILDNAVCRIAVPITVITLGPPSKPKGP------------IRFDEIKADSVILSWD 27679

Query: 740   PPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 799
              P+  G   +  Y +E       +W +     + +T F +  L  DA+   RV+A N  G
Sbjct: 27680 VPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VARTTFKVPNLVKDAEYQFRVRAENRYG 27738

Query: 800   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD- 858
              S      QP++   I+   + RIP           G+ V   +   G     LTW    
Sbjct: 27739 VS------QPLVSSIIVAKHQFRIPGP--------PGKPVIYNVTSDGM---SLTWDAPV 27781

Query: 859   ---GAEIDKNQINIRNSETDTIIFIRKAERSHSGK------------YDLQVKVDKFVET 903
                G+E+     ++   E ++I++ +      SG+            Y  +V  +     
Sbjct: 27782 YDGGSEV--TGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGL 27839

Query: 904   AS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
             +S        + +  +D PG P  +   DV  E + L W PP  DG + I GY+I+K   
Sbjct: 27840 SSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEKRQG 27896

Query: 956   KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1015
                              T+T L  G+ Y FR+ + N  G     + +    ++ RD  + 
Sbjct: 27897 NERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSS-GIIMTRDENV- 27954

Query: 1016  KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1075
               P   +F     P +   L+     +G +  +   V+G P P++TW K+ V I      
Sbjct: 27955 --PPIVEF----GPEYFDGLIIK---SGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNM 28005

Query: 1076  RMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              +    G  +L +R  +    G Y  +A N  G+ + E K++V+
Sbjct: 28006 EITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 113/454 (24%), Positives = 172/454 (37%), Gaps = 74/454 (16%)

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R  AVN   + KP  P+ P            L ++ +T    ++ W  P   G A +D Y
Sbjct: 25871 RSVAVNCKVLDKPGPPAGP------------LEINGLTAEKCSLSWGRPQEDGGADIDYY 25918

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
             ++E        W +   +L   T   +T L    +   RV  VN  G  EP    + + +
Sbjct: 25919 IVEKRETSHLAWTICEGEL-QMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPL---ESVAI 25974

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
             K +        P  L+ T + +  E++ L        RPE      G+EI    I  R  
Sbjct: 25975 KALDPFTVPSPPTSLEITSVTK--ESMTLCWS-----RPE---SDGGSEISGYIIERR-- 26022

Query: 873   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI---------------------- 910
             E +++ ++R  ++     YDL+VK     E    + ++                      
Sbjct: 26023 EKNSLRWVRVNKKP---VYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAED 26079

Query: 911   -IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 969
              +  P PP   KI D     + + W  P  DG A ITGYT++       +W T I+    
Sbjct: 26080 PVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRG 26139

Query: 970   TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1029
             T  TI+ L  G EY FRV S N  G S+ +  +        D +I K    E     ++ 
Sbjct: 26140 TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSS--------DPQIAKEREEEPLFDIDSE 26191

Query: 1030  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMF--SNQGVCTLE 1087
             M    +V     AG + T+    RG P P + W K       D R R +  +     +L 
Sbjct: 26192 MRKTLIVK----AGASFTMTVPFRGRPVPNVLWSKPDT----DLRTRAYVDTTDSRTSLT 26243

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
             I   +  D G Y     N L    +   L VKV+
Sbjct: 26244 IENANRNDSGKYTLTIQNVLSAASL--TLVVKVL 26275



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 133/609 (21%), Positives = 230/609 (37%), Gaps = 111/609 (18%)

Query: 559   WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
             WSR +K+++    +   +   +  T V  +   + +G    +  ++   AH  I      
Sbjct: 14948 WSRVNKSLLNAL-KANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISP---- 15002

Query: 619   FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT 678
              P PP+ P VT+       + WEPPA++GG  I+GYF++++   ++ W R    + K   
Sbjct: 15003 -PGPPI-PRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQ 15060

Query: 679   FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRW 738
             +  K++ EG  Y++R+ AVNA G   P        P+ V  P                  
Sbjct: 15061 YTVKEIREGADYKLRVSAVNAAGEGPPGETQ----PVTVAEPQ----------------- 15099

Query: 739   RPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 798
              PP    A  LD  V      G +  I+A K L  +    +TG P   K++ +       
Sbjct: 15100 EPP----AVELDVSVKG----GIQ--IMAGKTL--RIPAVVTGRPVPTKVWTK------- 15140

Query: 799   GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV--------IPFQGKPR 850
                E +     +++  +    ++ I   L++ + R V  A N          +     P 
Sbjct: 15141 --EEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPG 15198

Query: 851   PELTWKKDGAEIDKNQINIRNSETDT------IIFIRKAERSHSGKYDLQVKVDKFVETA 904
             P L  K          +N  + E D        I  RK  + H+ +  ++ +  K   T 
Sbjct: 15199 PVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITG 15258

Query: 905   SID------------------------IQIIDRPGPP---QIVKIEDVWGENVALTWTPP 937
              ++                        I  +D  GPP   + +   +     + L W  P
Sbjct: 15259 LLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEP 15318

Query: 938   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY-FRVFSENMCGLS 996
             + +G + I GY I+K      ++  V +    T++ + E +  ++ Y FRV + N  G S
Sbjct: 15319 RSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGES 15378

Query: 997   EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGN 1055
             E +       V+ +D ++               +      +T  + AG    +   V G 
Sbjct: 15379 EPSLPLN---VVIQDDEVPPT----------IKLRLSVRGDTIKVKAGEPVHIPADVTGL 15425

Query: 1056  PKPKITWMKNKVAI------VDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGT 1109
             P PKI W KN+  I      +   +  +  ++    L I K    D GTY   A N LG+
Sbjct: 15426 PMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGS 15485

Query: 1110  VEIECKLEV 1118
             V     +EV
Sbjct: 15486 VFRNVHVEV 15494



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 98/417 (23%), Positives = 169/417 (40%), Gaps = 47/417 (11%)

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTI 779
             PP  + +D V+  ++T+ W PP++ G   +  Y++E     +  W + ++  + +T   I
Sbjct: 25490 PPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ-AVARTSIKI 25548

Query: 780   TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP----KIRIPRHLKQTYIRR- 834
               L T ++   RV A N  G S     S  ++ +    PP      ++    K T +   
Sbjct: 25549 VRLTTGSEYQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTW 25607

Query: 835   ---VGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG 889
                V +  + VI +  + K R  + W K       N+I I     DT + +   +     
Sbjct: 25608 QVPVNDGGSRVIGYHLEYKERSSILWSK------ANKILI----ADTQMKVSGLDEGLMY 25657

Query: 890   KYDLQVKVDKFVETASIDIQII------DRPGPPQIVKIEDVWGENVALTWTPPKDDGNA 943
             +Y +  +    +   S   + +      D PG P++  I     ++V+L W+ P  DG A
Sbjct: 25658 EYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITR---KSVSLKWSKPHYDGGA 25714

Query: 944   AITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMC-GLSEDATM 1001
              ITGY +++ +     W      +   T   +TEL     Y FRVF+ N    +SE +  
Sbjct: 25715 KITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSES 25774

Query: 1002  TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKIT 1061
             T    +I +D  +    V  D  F +  +           AG    +N  + G P P I+
Sbjct: 25775 T--GPIIVKDD-VEPPRVMMDVKFRDVIVVK---------AGEVLKINADIAGRPLPVIS 25822

Query: 1062  WMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGT--VEIECKL 1116
             W K+ + I +  R  + S      L ++     D G Y     N  GT  V + CK+
Sbjct: 25823 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 25879



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 18/216 (8%)

Query: 912   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRT 970
             ++PG P    I  V  ++  + W PP  DG A I  Y ++K +KK  +W +V  E    T
Sbjct: 30823 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 30882

Query: 971   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFS-EAP 1029
               ++  L+ G EY FRV  EN+ G SE + +++              P+    D   +AP
Sbjct: 30883 VFSVKNLIEGLEYEFRVKCENLGGESEWSEISE--------------PITPKSDVPIQAP 30928

Query: 1030  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFS-NQGVCTLE 1087
              F + L N       NATL C V G+PKP + W +  K  I D  +YR+     G   L 
Sbjct: 30929 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 30988

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
             I   +  D   Y  +A N  G+V     LEV+V A+
Sbjct: 30989 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAK 31024



 Score = 90.9 bits (224), Expect = 6e-18
 Identities = 99/442 (22%), Positives = 167/442 (37%), Gaps = 60/442 (13%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  + +  P  P  PF             +  +     ++ W  P   G + +  Y++E 
Sbjct: 18984 IKVVVMDAPGPPQPPF------------DISDIDADACSLSWHIPLEDGGSNITNYIVEK 19031

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI- 815
             C     DW+ A    + KT   +  L    +   RV+A N  G SEP   + P +V +  
Sbjct: 19032 CDVSRGDWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFP 19088

Query: 816   ----IEPPKIRIPRHLKQ----TYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKN 865
                  EP   R+ +  K      + R   +  + +I +  + K R  L W K       N
Sbjct: 19089 FGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVK------AN 19142

Query: 866   QINIRNSETDTIIFIRKAERS------HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI 919
                +R++E      +   E S      +        K  ++V TA + +   D PG P++
Sbjct: 19143 DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV-TARMPV---DPPGKPEV 19198

Query: 920   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF---TVIEHYHRTSATITE 976
             +   DV    V+L W  PK DG + I GY ++       +W    T      +   T T 
Sbjct: 19199 I---DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATG 19255

Query: 977   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV 1036
             L    +Y FR  +     +S  +  +    ++A +      P   D   +   + T    
Sbjct: 19256 LEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV-----PPRIDLSVAMKSLLTVK-- 19308

Query: 1037  NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG 1096
                  AG N  L+ +V G P P ++W K+   +      +M   + +CTLE+   +  D 
Sbjct: 19309 -----AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDS 19363

Query: 1097  GTYCCKAVNDLGTVEIECKLEV 1118
             G Y   A N  G+     KL+V
Sbjct: 19364 GDYTITAENSSGSKSATIKLKV 19385



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 117/543 (21%), Positives = 204/543 (37%), Gaps = 60/543 (11%)

Query: 603   NEAGEAHASIKVKVVDFPDP-----PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N AG   AS+        DP     P  P VT+       + W PP  DGGS + GY +E
Sbjct: 16399 NAAGVGPASLPSDPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVE 16458

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
              K++    W +      + T      + EG  Y+   F V A+ I+    P    V   +
Sbjct: 16459 YKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYK---FRVRAVNIAGIGEPGE--VTDVI 16513

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKF 777
                  L++ D   D +V  R R   H G        +      T  W +  + L  +   
Sbjct: 16514 EMKDRLVSPDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATI 16571

Query: 778   TITGLPTDAKI---------FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIP---- 824
               T + +   I            + A N AG  +     + I+V  +  P  +  P    
Sbjct: 16572 ETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERK-----KTIIVDVLDVPGPVGTPFLAH 16626

Query: 825   ----RHLKQTYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTII 878
                    K T+     +  + +  +  + +      W      + +    ++        
Sbjct: 16627 NLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAY 16686

Query: 879   FIRKAERSHSGKYDLQVKVDKFVETASIDI--QIIDRPGPPQIVKIEDVWGENVALTWTP 936
             F R A  +  G       +  FVET+   +  + I  P  P+ +++++V    V LTW P
Sbjct: 16687 FFRIAAENSIG-------MGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNP 16739

Query: 937   PKDDGNAAITGYTIQKADKKSMEWFTVI-EHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             PK DG + I  Y ++     + ++  V  ++      T+  L  G+ Y +RV + N+ G 
Sbjct: 16740 PKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ 16799

Query: 996   SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
              + +  TK    I    ++    ++ DF        T  +   +A+ G  +       G 
Sbjct: 16800 GKPSFCTKP---ITCKDELAPPTLHLDF----RDKLTIRVGEAFALTGRYS-------GK 16845

Query: 1056  PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
             PKPK++W K++  +++D R  + +      LE  K    D G YC    N  G+ +  C+
Sbjct: 16846 PKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQ 16905

Query: 1116  LEV 1118
             + V
Sbjct: 16906 VNV 16908



 Score = 87.0 bits (214), Expect = 9e-17
 Identities = 96/437 (21%), Positives = 162/437 (37%), Gaps = 75/437 (17%)

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
             N+  ++  +  S  +  +D  DPP  P    +      + W  P Y GG  I  Y +E++
Sbjct: 21337 NMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKR 21396

Query: 660   KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVPLAVT 718
                + RW++ NF    E  F    + E  AYE R+ A NA G IS PS PS         
Sbjct: 21397 DLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDV 21456

Query: 719   SPPTLLTVDSVTDTTV-------------------TMRWRP--PDHIGAAGLDGYVLEYC 757
               P +       DT +                   TM W     +  G A L+  + ++ 
Sbjct: 21457 EAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFS 21516

Query: 758   FEGTEDWIVANKDLI--DKTKFTITGLPTD--AKIFVRVKAVNAAGASEPKYYSQPILVK 813
                     + NKD    D   +T+T       AK    VK ++  G  E      P+ V 
Sbjct: 21517 TN------LVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-----GPLAVT 21565

Query: 814   EIIE--------PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
             E+          PP            +   G  ++  I  Q +    L W    +E+   
Sbjct: 21566 EVTSEKCVLSWFPP------------LDDGGAKIDHYI-VQKRETSRLAWTNVASEVQVT 21612

Query: 866   QINI-RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIED 924
             ++ + +  + +  IF   A   +     L+           + +     P PP+  ++  
Sbjct: 21613 KLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-------SEPVLAVNPYGPPDPPKNPEVTT 21665

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-----TVIEHYHRTSATITELVI 979
             +  +++ + W  P  DG + I  Y +++ DK    W      T+ +  ++ S     L  
Sbjct: 21666 ITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSG----LTE 21721

Query: 980   GNEYYFRVFSENMCGLS 996
             G+EY FR+ +EN  G+S
Sbjct: 21722 GHEYEFRIMAENAAGIS 21738



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 94/359 (26%), Positives = 158/359 (44%), Gaps = 23/359 (6%)

Query: 285   WYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT---AGDEKCST-ELFVREP 340
             W K+G  IR S K+ F   G  R L I + Q++D  EY         EK ST +L V E 
Sbjct: 11151 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 11210

Query: 341   PIMVTKQL-EDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHI 399
             P+   K L E+ T   G+ + L CE+++ + +V W K+G+ ++  P  R    V G    
Sbjct: 11211 PVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKP-GRIVPGVIGLMRA 11268

Query: 400   LIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL-----TPLTDQTVNLGKEICLKC 454
             L I  A   DA  Y+V T    ++ + S  +K ++++      P+ DQ V         C
Sbjct: 11269 LTINDADDTDAGTYTV-TVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 11327

Query: 455   EISENIPG-KWTK--NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 511
             +I+++ P  KW K  + +P + +D+ +++  G    L I NA+ ED  +Y  A +     
Sbjct: 11328 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEY--AVEIEGKR 11385

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              PAK+ + +    +L  ++    VT+        +  IS    P     +G+  ++  S 
Sbjct: 11386 YPAKLTLGEREVELLKPIE---DVTIYEKESASFDAEISEADIPGQWKLKGE--LLRPSP 11440

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                 ++      L +   + D +G       N    A  ++K   +DF  P    TV E
Sbjct: 11441 TCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPE 11499



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 104/434 (23%), Positives = 164/434 (37%), Gaps = 44/434 (10%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             ++ I + KP  P  P            +  D V+   V + W PP + G   +  Y++E 
Sbjct: 24397 LSVIVLEKPGPPVGP------------VRFDEVSADFVVISWEPPAYTGGCQISNYIVEK 24444

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV---- 812
                 T  W + +   + +T   IT L T  +   R+ A N  G S P   S+ ++V    
Sbjct: 24445 RDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAP-LDSKAVIVQYPF 24502

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVN------LVIPFQGKPRPELTWKKDGAEIDKNQ 866
             KE   P    +    K   + +  E VN      +    + K +  + W K    ++K  
Sbjct: 24503 KEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVK----LNKTP 24558

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
             I     +T  +    + E   S +  + +     V    +     D PG P+ + I    
Sbjct: 24559 IQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITR-- 24616

Query: 927   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYF 985
               NV L W  P  DG + ITGY ++K D     W      +   T  T++ LV    Y F
Sbjct: 24617 -NNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEF 24675

Query: 986   RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1045
             RV + N  G   + +     A+ ARD     N   +       P +   +V     AG  
Sbjct: 24676 RVIARNAAGNFSEPS-DSSGAITARDEIDAPNASLD-------PKYKDVIV---VHAGET 24724

Query: 1046  ATLNCSVRGNPKPKITWMKNKVAIVDD-PRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAV 1104
               L   +RG P P + W K+   + +   R  + S     TL ++     DGG Y  K  
Sbjct: 24725 FVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLS 24784

Query: 1105  NDLGTVEIECKLEV 1118
             N  GT  I   ++V
Sbjct: 24785 NVGGTKSIPITVKV 24798



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 78/292 (26%), Positives = 125/292 (42%), Gaps = 60/292 (20%)

Query: 265   DKGGRVRFV--VELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             ++GG V++V  +E  D   +V WY   +++  S KY   ++    IL++ +    DD  Y
Sbjct: 31580 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 31639

Query: 323   YVTA----GDEKCSTELFVR---------------------------EPPIMVTKQLEDT 351
                     G++    ELFV+                           E P   T  L + 
Sbjct: 31640 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 31699

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK-SRYRIRVEGKKHILIIEGATKAD 409
             TAY GE V     ++   + +V W+K+G++I PG    +Y    +   + L I   T  D
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 31759

Query: 410   AAEYSVMTTG--GQSS--AKLSVDLKPLKILTPLTDQTV-------------NLGKEICL 452
              AEY+V+     G+ S  AKL+V L P     P TD T+               G+ +C 
Sbjct: 31760 DAEYTVVARNKYGEDSCKAKLTVTLHP-----PPTDSTLRPMFKRLLANAECQEGQSVCF 31814

Query: 453   KCEISENIPG--KWTKNGLPVQESDRLKVVHKG-RIHKLVIANALTEDEGDY 501
             +  +S   P   KW K+G P+     ++++H+G   + L I + L ED G Y
Sbjct: 31815 EIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 31866



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 91/401 (22%), Positives = 161/401 (40%), Gaps = 47/401 (11%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEI----RPSTKYIFEHKGCQRILFINNCQMTD 318
            QV +  R     E+ +  ++  WYK+G EI    +   KY+ E +     +FI+  + +D
Sbjct: 3157 QVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR--IHRMFISETRQSD 3214

Query: 319  DSEYYVTAGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFK 376
              EY   AG  + S  L+V  P P  V ++L+  T   G+       +S      + W+K
Sbjct: 3215 AGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYK 3274

Query: 377  NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA--------EYSVMTTGGQSSAKL-- 426
              + +  G K ++    +G+++ L++  A   DAA        +Y V TT    S ++  
Sbjct: 3275 EEQLLSTGFKCKF--LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3332

Query: 427  ------SVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKV 479
                   + + P  I+TPL D   + G+    +C +S  ++   W      ++ S   ++
Sbjct: 3333 VVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3392

Query: 480  VHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDAD----- 532
                  ++L IA A  EDEG Y F        V+  A + +  P  I+ + ++ +     
Sbjct: 3393 TQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEM 3452

Query: 533  ----------NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTESYPDS 581
                        + V  G+  +    I   P  +  W +  + I E     IR+  Y   
Sbjct: 3453 KAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKY--I 3510

Query: 582  STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
            S+L I   +  D G Y     NE G    +  + V +   P
Sbjct: 3511 SSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPP 3551



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 102/444 (22%), Positives = 169/444 (38%), Gaps = 63/444 (14%)

Query: 696   AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             ++  + + KP  P  P            +  D V+  ++T+ W PP + G   +  Y+++
Sbjct: 23314 SIEIVTLDKPDPPKGP------------VKFDDVSAESITLSWNPPLYTGGCQITNYIVQ 23361

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
                  T  W V +   + +T   +T L T  +   R+ A N  G S     S PI+ +  
Sbjct: 23362 KRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFAENRYGQSFA-LESDPIVAQYP 23419

Query: 816   IE---PPKIRIPRHL-KQTYIRRVGEAVN------LVIPFQGKPRPELTWKKDGAEIDKN 865
              +   PP       + K + + +  E VN      +    + K R  + W K    ++K 
Sbjct: 23420 YKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTK----VNKT 23475

Query: 866   QINIRNSETDTIIFIRKAERSHSG-KYDLQVKVDKFVETAS--------IDIQIIDRPGP 916
              I+      DT     KA+    G +Y+ +V  +  V            +     D PG 
Sbjct: 23476 IIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGT 23526

Query: 917   PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATIT 975
             P+ + ++      + L WT P  DG + ITGY ++K D     W      +   T  T++
Sbjct: 23527 PEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVS 23583

Query: 976   ELVIGNEYYFRVFSENMCG-LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQP 1034
              L     Y FRV ++N  G +S+ +  T         G I      E    S  P F   
Sbjct: 23584 GLTEDQRYEFRVIAKNAAGAISKPSDST---------GPITAKDEVELPRISMDPKFRDT 23634

Query: 1035  LVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPY 1094
             +V     AG    L   V G P P I W++    I +  R  + +      L ++     
Sbjct: 23635 IVVN---AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRI 23691

Query: 1095  DGGTYCCKAVNDLGTVEIECKLEV 1118
             DGG Y  +A N  G+      ++V
Sbjct: 23692 DGGQYILRASNVAGSKSFPVNVKV 23715



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 128/595 (21%), Positives = 233/595 (39%), Gaps = 66/595 (11%)

Query: 59   LFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFER 118
            +F +KP       G D+    ++          + W K +         K ++  + F+ 
Sbjct: 6459 VFTQKPSPVGALKGSDVILQCEISGTPPFE---VVWVKDR---------KQVRNSKKFKI 6506

Query: 119  HSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLE-------VHESTGTTPNIDI 171
             S+ +   + I+  + +  G Y C+ T +   D+CS  ++       V + + T+  I  
Sbjct: 6507 TSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGD 6566

Query: 172  RSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIA-FQYG 230
                +   EG +    +    L  R EV ++ E           N + S  + IA  Q G
Sbjct: 6567 AVELRAIVEGFQ---PISVVWLKDRGEVIRESE-----------NTRISFIDNIATLQLG 6612

Query: 231  ITDLRGMLKRLKRMRREE--KKSAAFAKILDPAYQVDKGGRVRFV---------VELADP 279
              +     K + +++ +   ++ +A   +L+PA  ++K   +            V    P
Sbjct: 6613 SPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTP 6672

Query: 280  KLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTEL 335
            +L  KW+K+G+E+   +K+          L I   +M+D   Y      + G   C+  +
Sbjct: 6673 ELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSV 6732

Query: 336  FVRE---PPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK--SRY 389
             V +   PP  + K L+D  A  G  V LEC VS     +V WF++G EI+ GPK  S +
Sbjct: 6733 HVSDRIVPPSFIRK-LKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSF 6791

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
               V      L+    T       + +    + SA L+V   P    TP + + +  G  
Sbjct: 6792 SENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLP-GMS 6850

Query: 450  ICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAP 505
            +     I    P   KW K    +   +   +  +  + +L +      + GDY  +   
Sbjct: 6851 LTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTN 6910

Query: 506  DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKA 565
            DA + +    + V +P   +    D     +V  G+ + LE   +G PP    W + D+ 
Sbjct: 6911 DAGSASCTTHLFVKEPATFVKRLAD----FSVETGSPIVLEATYTGTPPISVSWIK-DEY 6965

Query: 566  IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFP 620
            ++  S R        S+ L I  +  +D   Y   ++NEAG+      V V++ P
Sbjct: 6966 LISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPP 7020



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 105/451 (23%), Positives = 168/451 (37%), Gaps = 79/451 (17%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  I + KP  P+ P            + +D +  T++T+ W PP+  G A L GYV+E 
Sbjct: 29824 IKVIILDKPGPPTGP------------IKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 29871

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
                    W+  ++  + ++ F  T L    +   RV A N  G           L  E+I
Sbjct: 29872 RDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGS-------YLQSEVI 29923

Query: 817   E-PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW---KKDGAE------IDKNQ 866
             E    IRIP           G    L I    +    LTW   + DG        +++ +
Sbjct: 29924 ECRSSIRIP-----------GPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKE 29972

Query: 867   INIR-----NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------IDIQIIDR 913
             +        N    T+   R    +   +Y+ +V       +          + +  I  
Sbjct: 29973 VRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAP 30032

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF------TVIEHY 967
             PG PQ  ++ D    +V+L W+ P+D+G + +TGY I+       EW       T I  Y
Sbjct: 30033 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 30092

Query: 968   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1027
                  T+T L  G EY FRV + N  G  E A        +    K+ +   Y D++  E
Sbjct: 30093 -----TLTHLPQGAEYRFRVLACNAGGPGEPAE-------VPGTVKVTEMLEYPDYELDE 30140

Query: 1028  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
                  +     +   G    L   ++G P P   W K    I    R  + +++    L 
Sbjct: 30141 -----RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSETHTELV 30193

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             I++    D GTY     N  G   +  K+ V
Sbjct: 30194 IKEADRGDSGTYDLVLENKCGKKAVYIKVRV 30224



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 21/194 (10%)

Query: 547   IPISGEPPPKAMWSRGDKAIMEGSGRIRTE-------SYPDSSTLVIDIAERDDSGVYHI 599
             + +  EPP         + ++E   R+ T        + PD +  V D+ E  +   + +
Sbjct: 14200 VDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQ-FQV 14258

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPT------VTEVGDDWCIMNWEPPAYDGGSPILG 653
               +NEAG  H S   +++   DP   P+      VT+ G     + W+PP  +GGSPI+G
Sbjct: 14259 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 14318

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVA----YEVRIFAVNAIGISKPSMPS 709
             Y +E     + +WMR+N    K+  F   K+ EGV     Y +R+ AVNAIG+S+PS  S
Sbjct: 14319 YHVEMCPVGTEKWMRVNSRPIKDLKF---KVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 14375

Query: 710   RPFVPLAVTSPPTL 723
                V       PT+
Sbjct: 14376 ENVVAKDPDCKPTI 14389



 Score = 80.9 bits (198), Expect = 6e-15
 Identities = 77/261 (29%), Positives = 107/261 (40%), Gaps = 22/261 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+G  V+ SDRL + +      L +  ++  D G Y    +    + T    V VI  
Sbjct: 14420 WHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGL 14479

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIP--ISGEPPPKAMWSRGDKA------IMEGSGRI 573
             P    D   +D T    +  KL  E P    G P    +  R +        +M G  ++
Sbjct: 14480 PGPCKDIKASDITK---SSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKL 14536

Query: 574   R---TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                  +  P+        A     G  +I LKN        I       PDPPV   V  
Sbjct: 14537 SWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPV------IAQDPKQPPDPPVDVEVHN 14590

Query: 631   VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAY 690
                +   + W+PP YDGGS I+GY IE+  K   RW R N  L    T+  K + EG  Y
Sbjct: 14591 PTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEY 14650

Query: 691   EVRIFAVNAIGISKPSMPSRP 711
             + R+ A NA GIS+PS  + P
Sbjct: 14651 QFRVRAENAAGISEPSRATPP 14671



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 118/571 (20%), Positives = 224/571 (39%), Gaps = 53/571 (9%)

Query: 92   IKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFD 151
            + W+K K         + L+  + ++  S+ +   + I+    +  G Y C+   +   D
Sbjct: 5548 VVWYKDK---------RQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSD 5598

Query: 152  SCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVW 211
            +C   +++ E       ++  S    +GE  E    ++ +  +  + +K++EE     V 
Sbjct: 5599 TCVCTVKLKEPPRFVSKLN--SLTVVAGEPAELQASIEGAQPIFVQWLKEKEE-----VI 5651

Query: 212  ELLKNAKPSEYEKIA-FQYGITDLRGMLKRLKRMRRE--EKKSAAFAKILDPAYQVDKGG 268
               +N + +  E +A  Q+   +     K + +++ +   +++ A   +L+PA  V+K G
Sbjct: 5652 RESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAG 5711

Query: 269  RVRFVV---------ELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDD 319
             +   V             P+L V+WYK+G+ +  S K+ F        L I + +  D 
Sbjct: 5712 PMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDA 5771

Query: 320  SEYYV----TAGDEKCSTELFV--REPPIMVTKQLEDTTAYCGERVELECEVS-EDDANV 372
              Y        G   C+  + V  R  P   T++L++T    G    LEC+V+     +V
Sbjct: 5772 GTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISV 5831

Query: 373  KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS----AKLSV 428
             WF    +I+ G K  Y+         L +     +D   Y+ +      S    A L+V
Sbjct: 5832 AWFHEKTKIVSGAK--YQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 5889

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
               P  +  P     V  GK +     I    P K  W +    + + DR  +  +  + 
Sbjct: 5890 QEPPSFVKEP-EPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVA 5948

Query: 487  KLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLR 544
            +L + N      G+Y  V + +A   +   ++ V +P   +    D     +V  G  + 
Sbjct: 5949 ELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDH----SVEPGKSII 6004

Query: 545  LEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNE 604
            LE   +G  P    W + D   +  S +    +   +  L I  + + D+G Y   ++NE
Sbjct: 6005 LESTYTGTLPISVTWKK-DGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENE 6063

Query: 605  AGEAHASIKVKVVDFP--DPPVAPTVTEVGD 633
            AG       V  ++ P     + P    VGD
Sbjct: 6064 AGRDVCGALVSTLEPPYFVTELEPLEAAVGD 6094



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 50/197 (25%), Positives = 94/197 (47%), Gaps = 14/197 (7%)

Query: 251  SAAFAKILDPAYQ-------VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
            ++A   +++PA++       + +G       + + P ++ +W++NG+ ++P  ++  E +
Sbjct: 8736 ASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVE 8795

Query: 304  GCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
                 L I + +  D  +Y     D + S EL +   PI  TK++++      +    EC
Sbjct: 8796 HKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFEC 8855

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT----- 418
            EVS DDA V W+K   E+    K  Y  R +G+ H + I   T  D   YSV+       
Sbjct: 8856 EVSFDDAIVTWYKGPTELTESQK--YNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRG 8913

Query: 419  GGQSSAKLSVDLKPLKI 435
              +S+A+L +  K +K+
Sbjct: 8914 EARSTAELYLTTKEIKL 8930



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 105/447 (23%), Positives = 173/447 (38%), Gaps = 58/447 (12%)

Query: 696   AVNAIGISKPSMPSR-PFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVL 754
             A NA G +K  +  +    P  V  P   +   ++T   +T+ W  P + G A +  Y++
Sbjct: 28033 AKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWWDAPLNDGCAPITHYII 28089

Query: 755   EYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK- 813
             E        W +  +D  +   +T   L    +   RV AVN  G   P   S P++ + 
Sbjct: 28090 EKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRP-LDSDPVVAQI 28147

Query: 814   --EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRN 871
                + + P I  P ++        G ++ L        RPE      G+EI +  +  R 
Sbjct: 28148 QYTVPDAPGIPEPSNI-------TGNSITLTWA-----RPE---SDGGSEIQQYILERRE 28192

Query: 872   SE-TDTIIFIRKAERSHS----------GKYDLQVKVDKF--VETASIDIQII------D 912
              + T  +  I K   S +           +Y+  V  +    V  AS   ++I      +
Sbjct: 28193 KKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVN 28252

Query: 913   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTS 971
              PGPP +VK+ D     V+L W+ P  DG   I GY I+       +W  V  E   +T 
Sbjct: 28253 PPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTR 28312

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1031
              T+T+L  G EY FRV + N  G  +   +T     I    ++    +  D +F +  + 
Sbjct: 28313 YTVTDLQAGEEYKFRVSAINGAGKGDSCEVT---GTIKAVDRLTAPELDIDANFKQTHVV 28369

Query: 1032  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1091
                       AG +  L  + +G P P   W K    +    R  + +     TL +   
Sbjct: 28370 R---------AGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENC 28418

Query: 1092  SPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             +  D G Y     N+ G+  I   ++V
Sbjct: 28419 NRNDAGKYTLTVENNSGSKSITFTVKV 28445



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 64/235 (27%), Positives = 91/235 (38%), Gaps = 46/235 (19%)

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT-SA 972
             P PP  V++ +   E + +TW PP  DG + I GY I+K  K    W    EH     + 
Sbjct: 14580 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 14639

Query: 973   TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1032
             T   L  G EY FRV +EN  G+SE +  T  +  +            +  D  +  + T
Sbjct: 14640 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAV------------DPIDAPKVILRT 14687

Query: 1033  QPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-------PRYRM-------- 1077
                V      G    L+ S+ G+P P ITW+K++  IV +       P  R         
Sbjct: 14688 SLEVKR----GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEE 14743

Query: 1078  --------------FSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                            S +G   L +R     D G Y  K  ND G  +  C + V
Sbjct: 14744 EPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 59/203 (29%), Positives = 83/203 (40%), Gaps = 14/203 (6%)

Query: 908   IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY 967
             ++  + P PP  + I D+    V+L W  PK DG + ITGY I+   K S +W T I   
Sbjct: 20959 VKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTV 21017

Query: 968   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1027
                   +  L  G EY F+V + N  G S      +ES  +     + +  +  + D   
Sbjct: 21018 KGLECVVRNLTEGEEYTFQVMAVNSAGRSAP----RESRPVI----VKEQTMLPELDLRG 21069

Query: 1028  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
                  Q LV   A AG N  +   V G PKP +TW K    +    R    +      L 
Sbjct: 21070 ---IYQKLV--IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILN 21124

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTV 1110
             I +    D G Y   A N +G V
Sbjct: 21125 INECVRSDSGPYPLTARNIVGEV 21147



 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 13/197 (6%)

Query: 912   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 971
             ++P PP+ + + D    +  L W  P  DG + ITGY ++   K S  W     H  + +
Sbjct: 28544 EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLT 28602

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1031
              T+  LV   EY FRV ++N  G SE       S+VI ++ +I           ++    
Sbjct: 28603 FTVERLVEKTEYEFRVKAKNDAGYSEPREAF--SSVIIKEPQIEPT--------ADLTGI 28652

Query: 1032  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1091
             T  L+   A  G   T++  + G P PK+TW   ++ + +  R  + + +   TL ++  
Sbjct: 28653 TNQLITCKA--GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 28710

Query: 1092  SPYDGGTYCCKAVNDLG 1108
                D G Y     N  G
Sbjct: 28711 MRGDSGRYFLTLENTAG 28727



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 134/663 (20%), Positives = 230/663 (34%), Gaps = 120/663 (18%)

Query: 2     PEPTKKEENEVPAP----APPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLS 57
             PEP  K    V +P    +P P  P       T P        TP  + Q    +     
Sbjct: 32669 PEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP--------TPTEKVQHLPVSAPPKI 32720

Query: 58    ILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFE 117
               F++       +  ++I  +  V    +LR   + W+K          GK L+    F+
Sbjct: 32721 TQFLK------AEASKEIAKLTCVVESSVLRAKEVTWYKD---------GKKLKENGHFQ 32765

Query: 118   RH-SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFK 176
              H S   T+E++I    ++  G Y CE+                                
Sbjct: 32766 FHYSADGTYELKINNLTESDQGEYVCEI-------------------------------- 32793

Query: 177   RSGEGQEDAGELDFSG---------LLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF 227
              SGEG      L F G         + K  E K+ +++       + +  +P   E I+ 
Sbjct: 32794 -SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTEST--VTRKTEPKAPEPIS- 32849

Query: 228   QYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYK 287
                                   K      + D     D   +   V    +P+    W K
Sbjct: 32850 ---------------------SKPVIVTGLQDTTVSSDSVAKFA-VKATGEPRPTAIWTK 32887

Query: 288   NGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT----AGDEKCSTELFVREPPIM 343
             +G+ I    KY          L I+    +D   Y  T    AG    S +L ++   I 
Sbjct: 32888 DGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--IK 32945

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
              T+  + +T    E    +  V +++ + K  ++ E  +   KS+ ++ ++ +   ++I 
Sbjct: 32946 DTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLIS 33005

Query: 404   GATKADAA---EYSVMTTGGQSSAKLSVDLKP-LKILTPLTDQTVNLGKEICLKCEISEN 459
                K  AA   E S++      +++ S +++   +I    T  ++N G+ + LK  I+  
Sbjct: 33006 EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA 33065

Query: 460   IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--------FAPDAYNVT 511
                KW  NG+ +  S+  +    G    L I  A   DEG                Y++T
Sbjct: 33066 TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLT 33125

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             L  ++   D P  I        +  +  G  +     ISGEP P+  W + +  I   S 
Sbjct: 33126 LSKELS--DAPAFI----SQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISS 33178

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
              +      +  +L I  A   DSG Y I  KN  G+  A+  + V+   + P    V   
Sbjct: 33179 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRT 33238

Query: 632   GDD 634
               D
Sbjct: 33239 SGD 33241



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 94/408 (23%), Positives = 146/408 (35%), Gaps = 40/408 (9%)

Query: 717   VTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKT 775
             +  PPT  +  D V+   VT  W PP++ G   +  YV+E     +  W+     +I +T
Sbjct: 21158 IPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVI-RT 21216

Query: 776   KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ-TYIRR 834
              +  T L T  +   RVKA N  G   P   S  I+      P K+  P    Q T + +
Sbjct: 21217 TYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANY---PFKVPGPPGTPQVTAVTK 21272

Query: 835   VGEAVNLVIPF------------QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIF-IR 881
                 ++   P             + K R  + W+     +    I   +  TD I +  R
Sbjct: 21273 DSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFR 21332

Query: 882   KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
                 + +GK     K  K  E   + +  ID PG P  + I       V L W  P+  G
Sbjct: 21333 VIAENMAGKS----KPSKPSEPM-LALDPIDPPGKPVPLNITR---HTVTLKWAKPEYTG 21384

Query: 942   NAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1000
                IT Y ++K D  +  W      +      T++ L     Y FRV ++N  G     +
Sbjct: 21385 GFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPS 21444

Query: 1001  MTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKI 1060
                ++     D +  K  V  D  F +  +           AG    L   V G P P +
Sbjct: 21445 EPSDAITCRDDVEAPKIKV--DVKFKDTVILK---------AGEAFRLEADVSGRPPPTM 21493

Query: 1061  TWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              W K+   +    +  +        L  +  +  D G Y   A N  G
Sbjct: 21494 EWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGG 21541



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 19/303 (6%)

Query: 341   PIMVTKQLEDT----TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
             P+   K+++D     + + G     EC VS   A   W K+G  I   PK  +R   +GK
Sbjct: 11114 PLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPK--HRFIADGK 11171

Query: 397   KHILIIEGATKADAAEYSVMTTGGQ----SSAKLSVDLKPLKILTPLTDQ-TVNLGKEIC 451
                L I     +DA EY+ +   G     S+AKL V+  P++ +  L ++ TV  G+ + 
Sbjct: 11172 DRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 11231

Query: 452   LKCEISENIPGKWTKNG-LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYN 509
             L CE+++     W K+G + V++  R+     G +  L I +A   D G Y V   +A N
Sbjct: 11232 LSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANN 11291

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             +   + V V++   +I D L        +      +      +  P   W +G   I   
Sbjct: 11292 LECSSCVKVVE---VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI-PA 11347

Query: 570   SGRIRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
                 +TE   D + L + I  A  +D   Y + ++ +   A  ++  + V+   P    T
Sbjct: 11348 EPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVT 11407

Query: 628   VTE 630
             + E
Sbjct: 11408 IYE 11410



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 31/92 (33%), Positives = 43/92 (46%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
            P     L N   I G + TL C + G P P +TW +    I     +++    G+  L I
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 1002

Query: 1089 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
            R+    D G + C AVN+ GTV   C L V+V
Sbjct: 1003 REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 1034



 Score = 61.2 bits (147), Expect = 5e-09
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 913   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH-YHRTS 971
             RP PP++ K+     E + + W PP+ DG  +ITGY ++K +K S  W  V +       
Sbjct: 18398 RPDPPEVTKVSK---EEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERR 18454

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1011
               +  L+  +EY FRV +EN  G+ E +  ++   V+A+D
Sbjct: 18455 MKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR--PVVAKD 18492



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/324 (22%), Positives = 129/324 (39%), Gaps = 19/324 (5%)

Query: 811  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID----- 863
            L +E   P +   P  + +  ++++ E  ++V   Q  G P+P + WKK G  +      
Sbjct: 1069 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1128

Query: 864  KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 923
            K   N +  E   +I +  A+   +G+Y + V+ +K  ET S    +++      ++K +
Sbjct: 1129 KVSYNKQTGECKLVISMTFAD--DAGEYTIVVR-NKHGET-SASASLLEEADYELLMKSQ 1184

Query: 924  DVWGENVALTWTPPKDDGNAAITGYTIQKADKK-SMEWFTVIEHYHRTSATITELVIGNE 982
                    +T    +        G+   + +K+   E   + +   + +  +   V   E
Sbjct: 1185 QEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQE 1244

Query: 983  YYFRVFSENMCGLSEDATM-TKESAVIARDGKIYKNPVYEDFDFSEAPM--FTQPLVNTY 1039
            ++   F E +    E   + T    ++  DG+     +  D   SEA    F   + N  
Sbjct: 1245 FHISSFEERLIKEIEYRIIKTTLEELLEEDGE---EKMAVDISESEAVESGFDSRIKNYR 1301

Query: 1040 AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRM-FSNQGVCTLEIRKPSPYDGGT 1098
             + G   T +C + G P PKI W K+   I    RY+M F   G  +L I    P D G 
Sbjct: 1302 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1361

Query: 1099 YCCKAVNDLGTVEIECKLEVKVIA 1122
            Y   A N  G      KL V+  A
Sbjct: 1362 YTAFASNIKGNAICSGKLYVEPAA 1385



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 345 TKQLEDTTAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
           T+ L+      G     E  +S      V WF++G+ I        +I     +  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 404 GATKADAAEYSVMTTGGQSSAKLSVDL------KPLKILTPLTDQTVNLGKEICLKCEIS 457
             TKA++  YS+  T G   A  + +L       P   +  L   TV  G ++ L+  ++
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 458 ENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             IP    K+ ++G  +Q S   ++  +G ++ L+IA A  ED G Y
Sbjct: 129 -GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 39/140 (27%), Positives = 56/140 (40%), Gaps = 9/140 (6%)

Query: 985   FRVFSENMCGLSEDATM---TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1041
             F+   E +  +SE       T ES V  +       P+      S  P+    L +T   
Sbjct: 32811 FKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI------SSKPVIVTGLQDTTVS 32864

Query: 1042  AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1101
             +   A       G P+P   W K+  AI    +Y++  ++G   LEI K    D G Y C
Sbjct: 32865 SDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTC 32924

Query: 1102  KAVNDLGTVEIECKLEVKVI 1121
                N  G+V   CKL +K I
Sbjct: 32925 TVKNSAGSVSSSCKLTIKAI 32944



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 74/348 (21%), Positives = 121/348 (34%), Gaps = 77/348 (22%)

Query: 847   GKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYD------------- 892
             G+PRP   W KDG  I +  +  +   +    + I K + S SG Y              
Sbjct: 32877 GEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSS 32936

Query: 893   --LQVKVDKFVETASIDIQIIDRPGPPQIVKIED------VWGENVALTWTPP------K 938
               L +K  K  E   +  Q      P +   +++      +  E + ++          K
Sbjct: 32937 CKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALK 32996

Query: 939   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS-------------ATITELVIGNEYYF 985
             ++ +  +    ++K+   S+E   V E   +TS             A  T++ I NE   
Sbjct: 32997 EEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSI-NEGQR 33055

Query: 986   RVFSENMCGLSE-----------------------DATMT------KESAVIARDGKIYK 1016
              V   N+ G ++                       D T+T      ++  ++    K  +
Sbjct: 33056 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 33115

Query: 1017  NPVYEDFDF------SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
               V   +D       S+AP F     +     G N    C + G P P+I W KN + I 
Sbjct: 33116 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 33175

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                   +  ++ V +LEIR  S  D G Y  KA N  G       L V
Sbjct: 33176 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 33223



 Score = 54.7 bits (130), Expect = 5e-07
 Identities = 52/221 (23%), Positives = 77/221 (34%), Gaps = 45/221 (20%)

Query: 902  ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 961
            +TA  D++++ RP P      E  W             DG   +  YT +          
Sbjct: 1472 QTARFDLKVVGRPMP------ETFWFH-----------DGQQIVNDYTHK---------- 1504

Query: 962  TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1021
             VI+     S  I      +   + V ++N  G S  + +    AV              
Sbjct: 1505 VVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV-------------- 1550

Query: 1022 DFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFS 1079
              +    PMF + L N     G    +     GNP P I W+KN   IV    P+ R+  
Sbjct: 1551 --EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEG 1608

Query: 1080 NQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
             +G   L+I      D   Y   A+N  G     CK+ V+V
Sbjct: 1609 TKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 56/305 (18%), Positives = 122/305 (40%), Gaps = 22/305 (7%)

Query: 824   PRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID-KNQINIRNSETDTIIFI 880
             P  + Q   + + E  N++   +  G+P PE+ W K+   I   + ++I  S     + I
Sbjct: 33134 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 33193

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDR-PGPPQIVKIEDVWGENVALTWTPPKD 939
             R A  S SGKY ++ K  +   +A+  + ++     P + V +      ++  +++    
Sbjct: 33194 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 33253

Query: 940   DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 999
               +A+    +       S    T ++    ++ +++ +    E +  + S +  G+S   
Sbjct: 33254 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM---QESFVEMSSSSFMGISNMT 33310

Query: 1000  TMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKP 1058
              +   ++ + + G                P   + L +  +I  G   T+ C+  G P P
Sbjct: 33311 QLESSTSKMLKAG------------IRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTP 33358

Query: 1059  KITWM--KNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
             ++TW     K+   +  R+ + +   + TL I      DGG Y     N+ G+      +
Sbjct: 33359 EVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 33418

Query: 1117  EVKVI 1121
              ++ I
Sbjct: 33419 HIRSI 33423



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 59/283 (20%), Positives = 97/283 (34%), Gaps = 70/283 (24%)

Query: 836  GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 895
            GE+V L     G P P +TW ++  +I+                                
Sbjct: 957  GESVTLECHISGYPSPTVTWYREDYQIE-------------------------------- 984

Query: 896  KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
                    +SID QI  + G  +++  E    ++   T +   + G  + + Y   +   
Sbjct: 985  --------SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ--- 1033

Query: 956  KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1015
                   V E + + +  +TE     E   + F E+   +  D ++T+E A        Y
Sbjct: 1034 -------VSEEFEKETTAVTEKFTTEE---KRFVESRDVVMTDTSLTEEQAGPGEPAAPY 1083

Query: 1016 KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1075
                            T+P+V    + G +    C V GNPKP + W K+ V +    RY
Sbjct: 1084 --------------FITKPVVQKL-VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1128

Query: 1076 RMFSNQ--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
            ++  N+  G C L I      D G Y     N  G       L
Sbjct: 1129 KVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 1026 SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFSNQGV 1083
            ++AP FTQPL +   + G  AT    + G P P+++W ++   I     P  ++  + G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1084 CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              L I   +  + G Y  KA N  G      +L VK
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 36/105 (34%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 512  LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
            +PA V +   P  ++ GL     VTVI G  + LE  ISG P P   W R D  I E S 
Sbjct: 932  VPAPVEIPVTPPTLVSGL---KNVTVIEGESVTLECHISGYPSPTVTWYREDYQI-ESSI 987

Query: 572  RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              +       + L+I  A  +DSG +  +  NEAG    S  + V
Sbjct: 988  DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 1029  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV---DDPRYRMFSNQGVCT 1085
             P FT PL N  A  G N     ++  +P+P +TW K+   I    +D +Y   S++G+  
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 31749

Query: 1086  LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             L I   +  D   Y   A N  G    + KL V
Sbjct: 31750 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH--YHRTS 971
             P  P    + +V  ++  +TW  P D G   IT Y ++K +  S  W  V +   +  T 
Sbjct: 17012 PDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETMSKRWARVTKDPIHPYTK 17070

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1011
               + +L+ G +Y FRV +EN  G+ + +  +K   V A+D
Sbjct: 17071 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK--PVFAKD 17108



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 120/582 (20%), Positives = 208/582 (35%), Gaps = 92/582 (15%)

Query: 316  MTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDA-NVKW 374
            MTD S     AG  + +   F+ +P  +V K +E      G  V   C+V  +   +V W
Sbjct: 1064 MTDTSLTEEQAGPGEPAAPYFITKP--VVQKLVE------GGSVVFGCQVGGNPKPHVYW 1115

Query: 375  FKNGEEIIPGPKSRYRIRVEGKKHI----LIIEGATKADAAEYSVMTTG--GQSSAKLSV 428
             K+G  +  G    YR +V   K      L+I      DA EY+++     G++SA  S+
Sbjct: 1116 KKSGVPLTTG----YRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171

Query: 429  DLKPLKILTPLTDQTVNLGKEICL---KCEISENIPGKWTKNGLPVQESDRLKVVHKGRI 485
              +    L   + Q +    ++     + ++ E  PG +  +    +      ++ K   
Sbjct: 1172 LEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPG-FVYSEYEKEYEKEQALIRKKMA 1230

Query: 486  HKLVIANALTEDEGDYVFAPDA----------YNVTLPAKVHVIDPPKIILD-------- 527
               V+     ED+  ++ + +              TL   +      K+ +D        
Sbjct: 1231 KDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVE 1290

Query: 528  -GLDAD-NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STL 584
             G D+      ++ G  +     +SG P PK  W +  K I  G  R + +   D  ++L
Sbjct: 1291 SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE-RYQMDFLQDGRASL 1349

Query: 585  VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPA 644
             I +   +D G+Y     N  G A  S K+ V      P AP    +G    I   EP  
Sbjct: 1350 RIPVVLPEDEGIYTAFASNIKGNAICSGKLYV-----EPAAP----LGAPTYIPTLEP-- 1398

Query: 645  YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
                       + R +  S R +  +          P +M        R+     +  + 
Sbjct: 1399 -----------VSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETD 1447

Query: 705  PSMPSRPFVPLAVTSPPTLLTVDSVT---DTTVTMRWRPPD---HIGAAGLDGYVLEYCF 758
             S   R + P+ V  P +   ++  T   D  V  R  P     H G   ++ Y  +   
Sbjct: 1448 ESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVI 1507

Query: 759  --EGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
              +GT+  I+      D  ++T+              A N AG S     S  + V+ + 
Sbjct: 1508 KEDGTQSLIIVPATPSDSGEWTVV-------------AQNRAGRSS---ISVILTVEAVE 1551

Query: 817  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 858
               K      LK   I+  G  + + +   G P P++ W K+
Sbjct: 1552 HQVKPMFVEKLKNVNIKE-GSRLEMKVRATGNPNPDIVWLKN 1592



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 53/231 (22%), Positives = 95/231 (41%), Gaps = 17/231 (7%)

Query: 394  EGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLK 453
            E + H L IE   +++  E            +LS   +P+ ++  + +QTV    +   +
Sbjct: 8618 EEETHRLEIEEIERSERDEKEFEELVSFIQQRLS-QTEPVTLIKDIENQTVLKDNDAVFE 8676

Query: 454  CEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
             +I  N P     W K    ++ SD+ ++   G  H L + N   +D+G+Y      +  
Sbjct: 8677 IDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIA 8736

Query: 511  TLPAKVHVIDPP--KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME 568
            +  AK+ VI+P   + + D       VT+  G    +    S  P  K+ W R  + I++
Sbjct: 8737 S--AKLTVIEPAWERHLQD-------VTLKEGQTCTMTCQFS-VPNVKSEWFRNGR-ILK 8785

Query: 569  GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
              GR +TE       L I     +D G Y    ++    A   I+ + + F
Sbjct: 8786 PQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQF 8836



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 62/284 (21%), Positives = 105/284 (36%), Gaps = 51/284 (17%)

Query: 851  PELT--WKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDL----QVKVDK-FVE 902
            P++T  W KD  E+   ++I I+  +    + I     S +GKY +     V   K FVE
Sbjct: 3084 PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3143

Query: 903  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA------AITGYTIQKADKK 956
               + I+ I +       +++ +  +   + +   +DD +A          + +Q+  K 
Sbjct: 3144 GRDVRIRSIKK-------EVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK- 3195

Query: 957  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1016
                + V    HR   + T      EY F V   N   ++                 +Y 
Sbjct: 3196 ----YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVT-----------------LYV 3233

Query: 1017 NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1076
            N         E P   Q L      +G  A     + G P+PKI+W K +  +    + +
Sbjct: 3234 NA-------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3286

Query: 1077 MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
               +    TL + +  P D   Y C+A ND G       L V+V
Sbjct: 3287 FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV 3330



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
           ++TV  G+++RL++ ++G P P   + R D A ++ S   +     D  +L+I  A  +D
Sbjct: 112 SMTVRQGSQVRLQVRVTGIPTPVVKFYR-DGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170

Query: 594 SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
           SG Y +N  N  G A ++ ++ V    + P   T T V
Sbjct: 171 SGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIV 208



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 64/320 (20%), Positives = 110/320 (34%), Gaps = 40/320 (12%)

Query: 315   QMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SEDDANVK 373
             Q T + +Y      E  S + F  +    +T ++      CG+       V S+  A VK
Sbjct: 32353 QKTSERKY------EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVK 32406

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT-------------KADAAEYSVM-TTG 419
             W+ NG E+    K  Y     G   + I++  T             K +A++Y+ +  TG
Sbjct: 32407 WYHNGVELQESSKIHYT-NTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG 32465

Query: 420   GQSSAKLSV---DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDR 476
             G  +   S    +  P  +   LT              E+  +   +  K+ +       
Sbjct: 32466 GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESL 32525

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                 H       + + AL E   +          TL A++            L    ++T
Sbjct: 32526 SSYEHSASAE--MKSAALEEKSLEEKSTTRKIKTTLAARI------------LTKPRSMT 32571

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
             V  G   R      GEP P   W R  + ++  S R +  +    ST  I   +  D G 
Sbjct: 32572 VYEGESARFSCDTDGEPVPTVTWLRKGQ-VLSTSARHQVTTTKYKSTFEISSVQASDEGN 32630

Query: 597   YHINLKNEAGEAHASIKVKV 616
             Y + ++N  G+  A   + +
Sbjct: 32631 YSVVVENSEGKQEAEFTLTI 32650



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 94/440 (21%), Positives = 160/440 (36%), Gaps = 71/440 (16%)

Query: 246  REEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKG 304
            ++EK+        +P  +V +G   RF   +   P+ +V WY NGQ IR S ++   + G
Sbjct: 1835 QKEKQKPDIVLYPEPV-RVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG 1893

Query: 305  CQRILFINNCQMTDDSEYYVTAG------DEKCSTELFVREP------------------ 340
                L I +C+  D  E  VTA       + K   E+  RE                   
Sbjct: 1894 I-HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH 1952

Query: 341  --------------PIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGE-----EI 381
                          P+  T+  E       ER+  E    E +     FK        E 
Sbjct: 1953 EPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEA 2012

Query: 382  IPGPKSRYRIRVEGKKHIL-------------IIEGATKADAAEYSV-MTTGGQSSAKLS 427
            I   + + R + E  + +L             + E   KA A E  + + T      +LS
Sbjct: 2013 ITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELS 2072

Query: 428  VDLKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLK-VVHKGR 484
              ++  KI   +  QTV  G +   +  +    +   +W KNG+ ++ SDR+     +  
Sbjct: 2073 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2132

Query: 485  IHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH---VIDPPKIILDGLDADNTVTVIAGN 541
            + +LVI +   ED    +    A N+      H   ++   ++I    +  + V      
Sbjct: 2133 VCELVIRDVTAEDSASIMV--KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2190

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE-SYPDSSTLVIDIAERDDSGVYHI 599
                E   S EP  K  W +    + EG   R+ ++      S L ID ++ +D     +
Sbjct: 2191 MATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2249

Query: 600  NLKNEAGEAHASIKVKVVDF 619
              +N    A   ++  VV+F
Sbjct: 2250 EDENVKTTAKLIVEGAVVEF 2269



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1041 IAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
            + G  A   C V G P+PK+ W  N   I    R+R+    G+  L+I     YD G   
Sbjct: 1853 LEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVK 1911

Query: 1101 CKAVNDLGTVEIECKLEVK 1119
              A N  G +E + KLE++
Sbjct: 1912 VTAENPEGVIEHKVKLEIQ 1930



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 59/286 (20%), Positives = 102/286 (35%), Gaps = 24/286 (8%)

Query: 836   GEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894
             G+    ++  Q KP  E+ W  +G E+ + ++I+  N+     + I       SG Y  +
Sbjct: 32388 GQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY--R 32445

Query: 895   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954
                  +   AS D   +D  G            E V  +  P      A    Y +    
Sbjct: 32446 AVCTNYKGEAS-DYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA----YAVSSFK 32500

Query: 955   KKS-MEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1013
             K S ME  + +       + +TE             E++      A+   +SA +     
Sbjct: 32501 KTSEMEASSSVRE---VKSQMTET-----------RESLSSYEHSASAEMKSAALEEKSL 32546

Query: 1014  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1073
               K+   +      A + T+P   T    G +A  +C   G P P +TW++    +    
Sbjct: 32547 EEKSTTRKIKTTLAARILTKPRSMT-VYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 32605

Query: 1074  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
             R+++ + +   T EI      D G Y     N  G  E E  L ++
Sbjct: 32606 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 32651



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 61/263 (23%), Positives = 104/263 (39%), Gaps = 35/263 (13%)

Query: 261   AYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDD 319
             +++V  G   RF++ + + P  EVKWY NG E++ S+K  + +      L I +C  TDD
Sbjct: 32382 SHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCH-TDD 32440

Query: 320   SEYY------------------VTAGD-EKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
             S  Y                  VT GD    +++    E P  V  +L  T AY     +
Sbjct: 32441 SGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFK 32500

Query: 361   LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
                E+ E  ++V+  K+         +  R  +   +H      + +  +A     +   
Sbjct: 32501 KTSEM-EASSSVREVKS-------QMTETRESLSSYEH----SASAEMKSAALEEKSLEE 32548

Query: 421   QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLK 478
             +S+ +        +ILT     TV  G+     C+   E +P   W + G  +  S R +
Sbjct: 32549 KSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQ 32608

Query: 479   VVHKGRIHKLVIANALTEDEGDY 501
             V          I++    DEG+Y
Sbjct: 32609 VTTTKYKSTFEISSVQASDEGNY 32631



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 41/170 (24%), Positives = 67/170 (39%), Gaps = 16/170 (9%)

Query: 464  WTKNGLPVQESDRLKVVHK-GRIHKLVIANALTEDEGDYVFAPD--------AYNVTLPA 514
            W  +G  +      KVV K      L+I  A   D G++             +  +T+ A
Sbjct: 1490 WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1549

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS-GRI 573
              H + P  +     +    V +  G++L +++  +G P P  +W +    I+     +I
Sbjct: 1550 VEHQVKPMFV-----EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKI 1604

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV-VDFPDP 622
            R E     + L ID     DS  Y     N+AG      KV V V+F +P
Sbjct: 1605 RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEP 1654



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 67/327 (20%), Positives = 116/327 (35%), Gaps = 65/327 (19%)

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDAN--VKWFKNGEEIIPGPKSRYRIRVEGKKHILI 401
             V+ Q+       G  V+  C++   D +  V W+    ++    K  Y I  E    IL 
Sbjct: 31570 VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEK--YEITYEDGVAILY 31627

Query: 402   IEGATKADAAEY--SVMTTGGQSSAKLSVDLK---------------------------- 431
             ++  TK D   Y   V+   G+ S+   + +K                            
Sbjct: 31628 VKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLE 31687

Query: 432   -PLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVV----HKGR 484
              P +   PL ++T  +G+ +     I+ +      W K+G  ++  D  K       KG 
Sbjct: 31688 RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG- 31746

Query: 485   IHKLVIANALTEDEGDYV------FAPDAYNVTLPAKVHVIDPP---------KIILDGL 529
             +++L I +  T+D+ +Y       +  D+    L   +H   PP         K +L   
Sbjct: 31747 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH--PPPTDSTLRPMFKRLLANA 31804

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             +         G  +  EI +SG PPP   W +  + +  G          D   L I   
Sbjct: 31805 ECQE------GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT 31858

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKV 616
               +D+G Y +   N AG       ++V
Sbjct: 31859 LPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 5/111 (4%)

Query: 1003 KESAVIARDGKI----YKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1058
            +E   +A +GKI    +K    E     EAP   + + +     G +A     V G P P
Sbjct: 2048 EEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDP 2107

Query: 1059 KITWMKNKVAIVDDPR-YRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
            +  W KN V I    R Y  +    VC L IR  +  D  +   KA+N  G
Sbjct: 2108 ECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2158



 Score = 42.0 bits (97), Expect = 0.003
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
            P F     +     G  A   C+V G P  +  W K+  A+   P +R+   +    LE+
Sbjct: 3551 PTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILEL 3610

Query: 1089 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
               +  D G Y CKA N  G  +I C+ E+ +I
Sbjct: 3611 SNLTIQDRGVYSCKASNKFG-ADI-CQAELIII 3641



 Score = 40.0 bits (92), Expect = 0.012
 Identities = 44/211 (20%), Positives = 95/211 (45%), Gaps = 28/211 (13%)

Query: 245  RREEKKSAAFAKILDPAYQVD-------KGGRVRFVVELAD-PKLEVKWYKNGQEIRP-- 294
            R EE   +   ++  P + +        +G   RF +++   P  E  W+ +GQ+I    
Sbjct: 1442 RLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY 1501

Query: 295  STKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFV--------REPPIMVTK 346
            + K + +  G Q ++ +     +D  E+ V A +    + + V         +   M  +
Sbjct: 1502 THKVVIKEDGTQSLIIVP-ATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1560

Query: 347  QLEDTTAYCGERVELECEVSED-DANVKWFKNGEEIIPGPKSRY-RIRVEGKK--HILII 402
            +L++     G R+E++   + + + ++ W KN + I+P    +Y +IR+EG K    L I
Sbjct: 1561 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVP---HKYPKIRIEGTKGEAALKI 1617

Query: 403  EGATKADAAEY--SVMTTGGQSSAKLSVDLK 431
            +     D+A Y  + +   G+ + +  V+++
Sbjct: 1618 DSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1648



 Score = 40.0 bits (92), Expect = 0.012
 Identities = 96/465 (20%), Positives = 165/465 (35%), Gaps = 92/465 (19%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E  S  + + +   K   L E    E+   +   + L+   + KP+  TV  GE   F  
Sbjct: 32523 ESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSC 32582

Query: 80    KVKAEDLLRKPTIKWF-KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAG 138
                 E +   PT+ W  KG+   + S + +H      ++      TFE+  ++A D   G
Sbjct: 32583 DTDGEPV---PTVTWLRKGQ---VLSTSARHQVTTTKYKS-----TFEISSVQASDE--G 32629

Query: 139   NYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRRE 198
             NY   V   +      F L + ++  T   +      K S E +  + E     +   + 
Sbjct: 32630 NYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVK-SPEPRVKSPE----AVKSPKR 32684

Query: 199   VKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKIL 258
             VK  E      V       KP+  EK+        +    K  + ++ E  K  A     
Sbjct: 32685 VKSPEPSHPKAVSP--TETKPTPTEKVQH----LPVSAPPKITQFLKAEASKEIA----- 32733

Query: 259   DPAYQVDKGGRVRFVVELADPKL-EVKWYKNGQEIRPSTKYIFEHKGCQRI-LFINNCQM 316
                       ++  VVE +  +  EV WYK+G++++ +  + F +       L INN   
Sbjct: 32734 ----------KLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 32783

Query: 317   TDDSEYY---------------------------------VTAGDEKCSTELFVR--EP- 340
             +D  EY                                      D+K +     R  EP 
Sbjct: 32784 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 32843

Query: 341   --------PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRI 391
                     P++VT  L+DTT       +   + + E      W K+G+ I  G K  Y++
Sbjct: 32844 APEPISSKPVIVT-GLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK--YKL 32900

Query: 392   RVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSVDLKPLK 434
               +     L I     +D+  Y  +V  + G  S+   + +K +K
Sbjct: 32901 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIK 32945



 Score = 39.7 bits (91), Expect = 0.016
 Identities = 25/98 (25%), Positives = 37/98 (37%)

Query: 1021  EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1080
             + F    AP  T  + +     G N     +V+  P  ++ W  N V + +  +    + 
Sbjct: 32366 QPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNT 32425

Query: 1081  QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
              GV TLEI      D GTY     N  G       L+V
Sbjct: 32426 SGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 39.3 bits (90), Expect = 0.021
 Identities = 58/327 (17%), Positives = 107/327 (32%), Gaps = 45/327 (13%)

Query: 836  GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYD 892
            G+     +   G+P PE  W  DG +I  +   ++ I+   T ++I +  A  S SG++ 
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIV-PATPSDSGEWT 1529

Query: 893  L--QVKVDKFVETASIDIQIIDRPGPPQIV----------------KIEDVWGENVALTW 934
            +  Q +  +   +  + ++ ++    P  V                K+      N  + W
Sbjct: 1530 VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1589

Query: 935  TPPKD------------DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 982
                D            +G        I     +   W+T     ++     T   +  E
Sbjct: 1590 LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATA-INKAGRDTTRCKVNVE 1648

Query: 983  YYFR--------VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQP 1034
              F         +         E A    E   +    + ++     D +  + P F + 
Sbjct: 1649 VEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKK 1708

Query: 1035 LVNTYAIAGYNATLNCSVR--GNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPS 1092
            L +        A   C +   G+P   + W+ +   +    R RM +  G C+L+     
Sbjct: 1709 LTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAY 1768

Query: 1093 PYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              D G   C+A N  GT      L VK
Sbjct: 1769 SRDSGIITCRATNKYGTDHTSATLIVK 1795



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 44/162 (27%), Positives = 69/162 (42%), Gaps = 13/162 (8%)

Query: 279 PKLEVKWYKNGQEIRPST--KYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
           P  EV W+++GQ I  ST           +  L I      +   Y + A    G    +
Sbjct: 33  PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATST 92

Query: 333 TELFVR---EPPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGPKSR 388
            EL V+    PP  V ++L+  T   G +V L+  V+      VK++++G EI       
Sbjct: 93  AELLVKAETAPPNFV-QRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI--QSSLD 149

Query: 389 YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL 430
           ++I  EG  + L+I  A   D+  YSV  T     A  + +L
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAEL 191



 Score = 38.1 bits (87), Expect = 0.047
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 3/98 (3%)

Query: 1024  DFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGV 1083
             D +  PMF + L N     G +      V G P P + W K+   +   P   +  ++G+
Sbjct: 31790 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII-HEGL 31848

Query: 1084  --CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
                 L IR   P D G Y   A N  G+   +  L+V+
Sbjct: 31849 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31886



 Score = 37.7 bits (86), Expect = 0.062
 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 5/83 (6%)

Query: 264   VDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             V  G  VRF   +   P    KW  +G EI+    Y  E      +L I NC   D  EY
Sbjct: 17522 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 17581

Query: 323   YVT----AGDEKCSTELFVREPP 341
              +T    AG +  +  L V + P
Sbjct: 17582 QITVSNAAGSKTVAVHLTVLDVP 17604



 Score = 37.7 bits (86), Expect = 0.062
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 1059  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             ++TW      + +  +Y +    GV  L ++  +  D GTY CK VND G      +L V
Sbjct: 31599 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 31658

Query: 1119  KVIAQ 1123
             K + +
Sbjct: 31659 KGVRE 31663



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR-MFSNQGVCTLE 1087
            P+F    V+   + G  A  +  V G P P+  W  +   IV+D  ++ +    G  +L 
Sbjct: 1457 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1516

Query: 1088 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
            I   +P D G +   A N  G   I   L V+ +
Sbjct: 1517 IVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV 1550



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 45/250 (18%), Positives = 92/250 (36%), Gaps = 31/250 (12%)

Query: 855   WKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 913
             W KDG EI  + + +I+      I+ I+KA+    G+Y      DK     +++ ++I  
Sbjct: 11694 WFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKV 11753

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
               P   V++      +  +  + P   G   + G  +                   T++ 
Sbjct: 11754 EKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPL-------------------TASP 11794

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQ 1033
               E++   + +  +      G++ + +    +A  A + K+ + P+          +F  
Sbjct: 11795 DCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPL----------IFIT 11844

Query: 1034  PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1093
             PL +        A   C V   PK    W+K    I  D R+ +  +    ++ I+  + 
Sbjct: 11845 PLSDVKVFEKDEAKFECEVSREPK-TFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAF 11903

Query: 1094  YDGGTYCCKA 1103
              D   Y  +A
Sbjct: 11904 EDEAKYMFEA 11913



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 39/146 (26%), Positives = 56/146 (38%), Gaps = 11/146 (7%)

Query: 276   LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
             L  PK  V W K  Q ++ + +  FE      IL IN C  +D   Y +TA +       
Sbjct: 21090 LGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN------- 21142

Query: 336   FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
              V E   ++T Q+ D        ++ + EVS D     W    E     P S Y + +  
Sbjct: 21143 IVGEVGDVITIQVHDIPGPPTGPIKFD-EVSSDFVTFSW-DPPENDGGVPISNYVVEMRQ 21200

Query: 396   KKHILIIEGATKADAAEYSV--MTTG 419
                   +E AT      Y    +TTG
Sbjct: 21201 TDSTTWVELATTVIRTTYKATRLTTG 21226



 Score = 35.8 bits (81), Expect = 0.23
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STLVIDIAERD 592
           +V V+ G+    E  ISG P P+  W R  + I   +      S+ D  + L I    + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 593 DSGVYHINLKNEAGEAHASIKVKVVDFPDPP 623
           +SG Y +   N +G+A ++ ++ V     PP
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 35.8 bits (81), Expect = 0.23
 Identities = 23/89 (25%), Positives = 34/89 (38%), Gaps = 2/89 (2%)

Query: 536   TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG--RIRTESYPDSSTLVIDIAERDD 593
             T   G  +R  + I+  P P   W +  + I  G    +   ES      L I+    DD
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 31759

Query: 594   SGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                Y +  +N+ GE     K+ V   P P
Sbjct: 31760 DAEYTVVARNKYGEDSCKAKLTVTLHPPP 31788



 Score = 35.0 bits (79), Expect = 0.40
 Identities = 23/91 (25%), Positives = 37/91 (40%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
            P F Q L +     G    L   V G P P + + ++   I     +++     + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1089 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
             +  P D GTY   A N +G      +L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.0 bits (79), Expect = 0.40
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 1029  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
             P FT  L +  A+     TL C V  +   K  W K+   IV  P+Y + ++     L+I
Sbjct: 11663 PYFTVKLHDKTAVEKDEITLKCEVSKDVPVK--WFKDGEEIVPSPKYSIKADGLRRILKI 11720

Query: 1089  RKPSPYDGGTYCCKAVND--LGTVEIECKL 1116
             +K    D G Y C    D     V +E +L
Sbjct: 11721 KKADLKDKGEYVCDCGTDKTKANVTVEARL 11750



 Score = 33.9 bits (76), Expect = 0.89
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 11/119 (9%)

Query: 393  VEGKKHILIIEGATKADAAEYSVM-------TTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
            VE KK + +    T      + V+       T   +  A + + + P  +++ L + TV 
Sbjct: 896  VEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVI 955

Query: 446  LGKEICLKCEISENIPGK---WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             G+ + L+C IS   P     W +    ++ S   ++  +  I +L+I  A  ED G +
Sbjct: 956  EGESVTLECHIS-GYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRF 1013



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 774 KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 833
           + K TI  +         +KA N +G +     +  +LVK    PP     + L+   +R
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATS---TAELLVKAETAPPNF--VQRLQSMTVR 116

Query: 834 RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI--IFIRKAERSHSGKY 891
           + G  V L +   G P P + + +DGAEI ++ ++ + S+   +  + I +A    SG Y
Sbjct: 117 Q-GSQVRLQVRVTGIPTPVVKFYRDGAEI-QSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174

Query: 892 DLQV--KVDKFVETASIDIQ 909
            +     V +   TA + +Q
Sbjct: 175 SVNATNSVGRATSTAELLVQ 194



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 105/543 (19%), Positives = 203/543 (37%), Gaps = 71/543 (13%)

Query: 3     EPTKKEENEVP-APAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFI 61
             +P K EE   P  P  PPE PS   E         +L  + P     K +  S+++  +I
Sbjct: 30312 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRP-----KDDGGSRVTGYYI 30366

Query: 62    EKPQGGTVK-VGEDITFIAKVKAEDLLRKPTIKWF------KGKWMDLASKAGKHLQLKE 114
             E+ +  T K V  + T I           P  ++           +   S A + +  K+
Sbjct: 30367 ERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD 30426

Query: 115   TFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSA 174
              F++ S+    E+  I                    DS +   E  E  G    +     
Sbjct: 30427 PFDKPSQPGELEILSISK------------------DSVTLQWEKPECDGGKEILGYWVE 30468

Query: 175   FKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF---QYGI 231
             +++SG+               ++  K++ ++ Q  +  LL+    +EYE   F   + G+
Sbjct: 30469 YRQSGDSAW------------KKSNKERIKDKQFTIGGLLE---ATEYEFRVFAENETGL 30513

Query: 232   TDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQE 291
             +  R     +K      +      ++ D   ++ +  ++   + +  P  ++KWY+ G+E
Sbjct: 30514 SRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQI-VGRPLPDIKWYRFGKE 30572

Query: 292   IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVT-- 345
             +  S KY     G    L +   +  D+  Y   A    G+ + S++L ++  P      
Sbjct: 30573 LIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGY 30632

Query: 346   KQLEDTTAYCGERVELE-CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEG 404
                E      G  + L    +      + WF +G++++   ++      E   H+++   
Sbjct: 30633 PLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNV 30691

Query: 405   ATKADAAEYSVMTTG--GQSSAKLSVDL--KPLKILTPLTDQTVNLGKEICLKCEISENI 460
               K  A +Y V  +   G   A L V++  KP K   P+  + + L     +  +   + 
Sbjct: 30692 QRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEAL-LKNSAVISWKPPADD 30750

Query: 461   PGKWTKNGL----PVQESDRLKVVHKG-RIHKLVIANALTEDEGDY--VFAPDAYNVTLP 513
              G W  N +      +E    ++V     +    I N LTE+ G Y  V A + + ++ P
Sbjct: 30751 GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVN-LTENAGYYFRVSAQNTFGISDP 30809

Query: 514   AKV 516
              +V
Sbjct: 30810 LEV 30812



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 43/147 (29%), Positives = 59/147 (40%), Gaps = 10/147 (6%)

Query: 279   PKLEVKWYKNGQE-IRPSTKY-IFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
             PK  VKWY+ G+E I    KY I E KG    L I +    D + Y V A    G    +
Sbjct: 30955 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGT 31014

Query: 333   TELFVREP-PIMVTKQLED---TTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               L V  P  I + K LE      A  GE V ++   S     V  ++ G+++I      
Sbjct: 31015 ASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHY 31074

Query: 389   YRIRVEGKKHILIIEGATKADAAEYSV 415
               I       ++   G  + DA  Y V
Sbjct: 31075 QVIVTRSFTSLVFPNGVERKDAGFYVV 31101



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 3/96 (3%)

Query: 829 QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ---INIRNSETDTIIFIRKAER 885
           Q+ +   G          G P PE++W +DG  I  +    + I  S+    + I    +
Sbjct: 13  QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72

Query: 886 SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 921
           ++SG+Y L+        T++ ++ +     PP  V+
Sbjct: 73  ANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQ 108



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 1046 ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVN 1105
            AT  C     P  K+ W K+ + + +  +YRM S++ V  L I      D   Y C  V 
Sbjct: 2192 ATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2250

Query: 1106 D 1106
            D
Sbjct: 2251 D 2251



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 31/118 (26%), Positives = 46/118 (38%), Gaps = 20/118 (16%)

Query: 1020 YEDFDFS-------EAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD 1072
            YED + S       E   FT+ + N       +AT  C V  +    +TW K    + + 
Sbjct: 8818 YEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAI-VTWYKGPTELTES 8876

Query: 1073 PRYRMFSNQGVC-TLEIRKPSPYDGGTYC----------CKAVNDLGTVEIECKLEVK 1119
             +Y  F N G C  + I   +P D G Y            ++  +L     E KLE+K
Sbjct: 8877 QKYN-FRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLELK 8933



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 862
             PP+  +P + K  Y   VGE V   +     P P +TW K G +I
Sbjct: 31689 PPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQKI 31730



 Score = 31.6 bits (70), Expect = 4.4
 Identities = 26/88 (29%), Positives = 33/88 (37%), Gaps = 4/88 (4%)

Query: 1034 PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1093
            PL +   I G  A L C V       + W  N   I  D R +         L I +   
Sbjct: 2450 PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHA 2509

Query: 1094 YDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
             D G Y  K +  +G VE  C L V+ I
Sbjct: 2510 SDEGPY--KLI--VGRVETNCNLSVEKI 2533



 Score = 31.2 bits (69), Expect = 5.8
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 262   YQVDKGGRVRFVVE-LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDS 320
             Y +  G  ++  +  +  P+  + W K+G+ ++ +T+   E      +L I      D  
Sbjct: 24321 YSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFG 24380

Query: 321   EYYVTA 326
             +Y VTA
Sbjct: 24381 KYTVTA 24386


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  299 bits (766), Expect = 9e-81
 Identities = 218/756 (28%), Positives = 346/756 (45%), Gaps = 52/756 (6%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F  +L+  K  VKWY+NG+EI+   KY FE  G    L I +C++ D+ EY     D K 
Sbjct: 6537 FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS 6596

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
               LFV E P+ + +  +D     G  V    E+++D   V+W +N   ++ G K  +++
Sbjct: 6597 RARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDK--HQM 6654

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
              EGK H L I      D  EY  +    ++ AKL +   P KI T   D  V++GK + 
Sbjct: 6655 MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVGKPLT 6713

Query: 452  LKC--EISENIPGKWTKNGLPV----------QESDRL---KVVHKGRIHKLVIANALTE 496
            +    +       +W K   P+          Q S R+   K   KGR +K+V+ N   +
Sbjct: 6714 MVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGR-YKIVLQNKHGK 6772

Query: 497  DEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             EG                + VID P  + +    + T T      L  E P++      
Sbjct: 6773 AEGFI-------------NLKVIDVPGPVRN---LEVTETFDGEVSLAWEEPLTDGGSKI 6816

Query: 557  AMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHAS 611
              +    + I   +  + T+        V  + +     ++ ++ +N  G     E    
Sbjct: 6817 IGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNP 6876

Query: 612  IKVKV-VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLN 670
            ++ +   D P PP+  T+T+V      + WEPP YDGG+ I  Y IE + K S RW    
Sbjct: 6877 VEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 6936

Query: 671  FDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTSPPTLLTV 726
                ++ +     ++EG  Y  R+ A N IG+ KPS  + PFV    P+   SPP  LT 
Sbjct: 6937 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLTS 6995

Query: 727  DSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDA 786
               T ++V ++W PP   G + + GY++E C EG ++WI  N  L+ +  + +TGL    
Sbjct: 6996 SDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGN 7055

Query: 787  KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 846
            K   RV A N AG S+P     P+   +    P + +    K      V   + +++P  
Sbjct: 7056 KYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSA-FKDGLEVIVPNPITILVPST 7114

Query: 847  GKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 905
            G PRP  TW      ++  +++ ++       + I  +ERS  G Y L  K++  V+T S
Sbjct: 7115 GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTL--KLENRVKTIS 7172

Query: 906  --IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 963
              ID+ +I RP  P+ +K  D+  ++V LTW PP DDG + +TGY ++K +     W  V
Sbjct: 7173 GEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV 7232

Query: 964  IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 999
            ++       T+ +LV G EY F+V + N CG  E A
Sbjct: 7233 MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 7268



 Score =  288 bits (737), Expect = 2e-77
 Identities = 165/503 (32%), Positives = 269/503 (53%), Gaps = 17/503 (3%)

Query: 511   TLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             TLP  V     I+PP+I LD  D    V + A   LRL + I G P P+  W + +  + 
Sbjct: 18786 TLPGSVVAQERIEPPEIELDA-DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 18844

Query: 568   EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
             +   R + E     + LVID   R DSG Y++ L+N +G   A + V+V+D P  PV  T
Sbjct: 18845 D---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLT 18901

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             + EV  D   ++WEPP  DGG+ I  Y +E+++     +  +  + C +TTF  + + EG
Sbjct: 18902 IREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEG 18960

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
              +Y  R+ A N  GI  P+  + P        PP  +T+  VT  T T++W  P+  G +
Sbjct: 18961 CSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGS 19020

Query: 748   GLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 807
              + GYV+E   +G+E W    +  +   + TI+GL    +   RV AVN  G S+P+   
Sbjct: 19021 KITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG 19078

Query: 808   QPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQ 866
              P++ ++I   P + +P H   T+  +  E + + +PF+G+P+  + W+KDG  + +  +
Sbjct: 19079 VPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTR 19135

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
             +N+ +S+T T + I++A +   G Y+L V       T  I I ++DRPGPP  ++I++V 
Sbjct: 19136 VNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVS 19195

Query: 927   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFR 986
              +++ ++W PP+ DG   I+ Y ++K +  S  W  V +   RTS  I  L  G+EY FR
Sbjct: 19196 CDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFR 19255

Query: 987   VFSENMCGLSEDATMTKESAVIA 1009
             V +EN  G S   + ++ SAV+A
Sbjct: 19256 VCAENRYGKS---SYSESSAVVA 19275



 Score =  276 bits (707), Expect = 6e-74
 Identities = 176/570 (30%), Positives = 286/570 (50%), Gaps = 35/570 (6%)

Query: 438   PLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQ------ESDRLKVVHKGRIHKLVIA 491
             P+ D    +   I  KC++S    G+WT    P        E ++L   H+       I 
Sbjct: 16556 PIYDGGCEIQGYIVEKCDVSV---GEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAIN 16612

Query: 492   NALTEDEGDYVFAPDAYNVTLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIP 548
              A   +  D           +P  + V   ++ P I LD L+    + + AG  LRL +P
Sbjct: 16613 KAGVGEHAD-----------VPGPIIVEEKLEAPDIDLD-LELRKIINIRAGGSLRLFVP 16660

Query: 549   ISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEA 608
             I G P P+  W + D  I + +    T S+   ++LV+D   R DSG Y + L+N +G  
Sbjct: 16661 IKGRPTPEVKWGKVDGEIRDAAIIDVTSSF---TSLVLDNVNRYDSGKYTLTLENSSGTK 16717

Query: 609   HASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
              A + V+V+D P PPV   VTE+  D   + WEPP  DGGS I  Y +E+++     +  
Sbjct: 16718 SAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAA 16777

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             +  + C + +++  ++ EG +Y  R+ A N  GI  P+  + P     V  PP  +TVD 
Sbjct: 16778 VVTN-CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDD 16836

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKI 788
             VT  +V++ W  P+H G + +  Y++E   + +E W    +  +   +  IT L    + 
Sbjct: 16837 VTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEY 16894

Query: 789   FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 848
               RV AVN  G S+P+  + PI+ K+++  P +   +    +Y  +VG+ + + +P  G+
Sbjct: 16895 LFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV---KPAFSSYSVQVGQDLKIEVPISGR 16951

Query: 849   PRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASID 907
             P+P +TW KDG  + +  +IN+ +S   T + I++  +   G+Y + V      +TASI+
Sbjct: 16952 PKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIE 17011

Query: 908   IQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 966
             I  +D+P PP+  VK +DV  E++ L+W PP   G   IT Y +QK D  +  W  V   
Sbjct: 17012 IVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT 17071

Query: 967   YHRTSATITELVIGNEYYFRVFSENMCGLS 996
               RT+  +T+L  G EY FR+F+EN  G S
Sbjct: 17072 VARTTLKVTKLKTGTEYQFRIFAENRYGQS 17101



 Score =  272 bits (695), Expect = 1e-72
 Identities = 159/562 (28%), Positives = 280/562 (49%), Gaps = 19/562 (3%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++ P++ LD  +    + V AG   R+ IP  G P P+  WSR +    E + +++ E  
Sbjct: 17714 LEAPELDLDS-ELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEG---EFTDKVQIEKG 17769

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
              + + L ID  +R+D+G Y + L+N +G   A + VKV+D P PP    V EV  D   +
Sbjct: 17770 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFL 17829

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              WEPP  DGG+ +  Y I++++     +  ++   C +T+F+ + + EG  Y  R+ A N
Sbjct: 17830 VWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKTSFKVENLTEGAIYYFRVMAEN 17888

Query: 699   AIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
               G+  P             SPP  +T+  V+ T+ ++ W  P+H G + + GYV+E   
Sbjct: 17889 EFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 17948

Query: 759   EGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEP 818
             +GTE W +  +  +      +TGL +  +   RVKA N  G S+P+    P++ K++   
Sbjct: 17949 KGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQ 18006

Query: 819   PKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTI 877
             P +++P +   TY  + GE + + IP  G+PRP ++W KDG  + +  ++N+  + T T+
Sbjct: 18007 PSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTV 18063

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENVALTWTP 936
             + I++  +   GKY +         T ++ + ++++PGPP   V+ ++V  + V ++W P
Sbjct: 18064 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEP 18123

Query: 937   PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 996
             P   G   I+ Y ++K D  +  W  V     RT+  IT+L  G EY FR+F+EN  G S
Sbjct: 18124 PAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKS 18183

Query: 997   EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT--LNCSVRG 1054
               A +  ++ ++      +K P      F  +    Q LV  +       T  +   +  
Sbjct: 18184 --APLDSKAVIVQYP---FKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQ 18238

Query: 1055  NPKPKITWMKNKVAIVDDPRYR 1076
               K  I W+K     + D +++
Sbjct: 18239 KEKNSILWVKLNKTPIQDTKFK 18260



 Score =  258 bits (658), Expect = 3e-68
 Identities = 148/478 (30%), Positives = 252/478 (52%), Gaps = 12/478 (2%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PP+I LD  D    VT+ A   LRL +PI G P P+  W+R     ++ +    T SY  
Sbjct: 15552 PPEIELDA-DLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSY-- 15608

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              + L++    R DSG Y + ++N +G   A + V+V+D P PP    V EV      + W
Sbjct: 15609 -TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTW 15667

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGGS I  Y +E+++     +  +  + C +T+++  ++ EG +Y  R+ A N  
Sbjct: 15668 DPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENEY 15726

Query: 701   GISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
             GI  P+  +          PP  +T+  VT  +V++ W  P+H G + + GY++E   +G
Sbjct: 15727 GIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKG 15786

Query: 761   TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             ++ W  A    +  T+ TITGL    +   RV A N  G S+P+  S P++ K+++ PP 
Sbjct: 15787 SDKW--ATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPA 15844

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIF 879
              ++   L  T+    GE + + +PF G+P P +TW KD   + +  ++N  ++E ++++ 
Sbjct: 15845 FKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLT 15901

Query: 880   IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPK 938
             I+ A R   G Y +++         ++++ ++D+PGPP   VK+++V  +++ L+W PPK
Sbjct: 15902 IKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPK 15961

Query: 939   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 996
              DG ++I  Y ++K D  +  W  V     RT+     L  G EY FR+ +EN  G S
Sbjct: 15962 YDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKS 16019



 Score =  255 bits (651), Expect = 2e-67
 Identities = 157/482 (32%), Positives = 251/482 (52%), Gaps = 13/482 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P + LD    D  V V AG  +R+   +SG+PPP   W+  ++ + + +     E+   S
Sbjct: 10217 PDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAIS 10272

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-VGDDWCIMNW 640
             S++VI   +R   GVY +  KNEAGE   +I V V+D P P   P +   + ++ C + W
Sbjct: 10273 SSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTW 10332

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGGSPI  Y IE+++     W  + + + ++     + +I+G AY  RI A N+I
Sbjct: 10333 FSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSI 10391

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+      S   V   P+ V   P  L V  VT  TVT+ W PP + G + +  YVLE  
Sbjct: 10392 GMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESR 10451

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
               GTE +     D +   K+T+ GL        RV AVN  G  +P + ++PI  K+ + 
Sbjct: 10452 LIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA 10511

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDT 876
             PP + +    K T   RVGEA  L   + GKP+P+++W KD A++ + ++ +I+ +    
Sbjct: 10512 PPTLHLDFRDKLTI--RVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10569

Query: 877   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENVALTWT 935
              +   KA+RS SGKY + V+           + ++DRPGPP   V  ++V  + + ++W 
Sbjct: 10570 ALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWK 10629

Query: 936   PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             PP DDG + IT Y I+K +     W  V     +T+  +++L+ G +Y FR+ +EN+ G+
Sbjct: 10630 PPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGI 10689

Query: 996   SE 997
             S+
Sbjct: 10690 SD 10691



 Score =  255 bits (651), Expect = 2e-67
 Identities = 143/470 (30%), Positives = 242/470 (51%), Gaps = 16/470 (3%)

Query: 534   TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSS----TLVIDIA 589
             T+ V AG    + +P  G P P  +WS+ D  +       RT +Y D++    +L I+ A
Sbjct: 19890 TLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-------RTRAYVDTTDSRTSLTIENA 19942

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R+DSG Y + ++N    A  ++ VKV+D P PP   TV +V  +  +++W+ P  DGG+
Sbjct: 19943 NRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGA 20002

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y IE+++     W+ +  + C   +++   + EG  Y  R+   N  G+  P+   
Sbjct: 20003 PVKNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETK 20061

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANK 769
                      SPP  L V S++  +V++ W  P+H G + +  YV+E   +G ++W+    
Sbjct: 20062 EGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC-- 20119

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 829
              +   T   ++GL  +++ F RV A N AG S+P+    P+L+KE +EPP+I +      
Sbjct: 20120 AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSH 20179

Query: 830   TYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHS 888
             T   R G  + + IP  GKP P++T  +DG  +    + N   +  +  I ++++  + +
Sbjct: 20180 TVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADA 20239

Query: 889   GKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITG 947
             G+Y++          A I+I ++DRPGPP   V I D+  E+V L W PPK DG + +T 
Sbjct: 20240 GRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTN 20299

Query: 948   YTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             Y + K +  +  W  V     RT   + +L  G EY FR+ +EN  G+S+
Sbjct: 20300 YILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISD 20349



 Score =  252 bits (644), Expect = 1e-66
 Identities = 152/470 (32%), Positives = 240/470 (51%), Gaps = 10/470 (2%)

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             D   TVT+ AG  LRL + +SG PPP   WS+    +   +    TESY   S L++D  
Sbjct: 23146 DLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY---SLLIVDKV 23202

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R D+G Y I  +N++G+  A++ VKV D P P  +  V EV  D   + WE P  DGG+
Sbjct: 23203 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23262

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y +E K++ + R  +     C +T +    ++EG  Y  R+   N  GI +P   S
Sbjct: 23263 PVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETS 23321

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDW--IVA 767
                +   V   P  L V  VT +TVT+ W  P + G + L GYVLE C  GTE W  +V 
Sbjct: 23322 DAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVT 23381

Query: 768   NKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHL 827
              K  +   + T+T L    +   R++A N  G SEP+     + V+++   P I +    
Sbjct: 23382 LKPTV--LEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMP 23439

Query: 828   KQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERS 886
             ++T     G  V LVIP  G+P P  +W   G+++ +  ++ +        + IR+    
Sbjct: 23440 QKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIR 23499

Query: 887   HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAI 945
              +G+Y L++K      + +I + I+D+PGPP   +KI+++   ++ ++W PP+ DG A +
Sbjct: 23500 DTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPL 23559

Query: 946   TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             +GY +++ D     W  V E   R++   T L  GNEY FRV + N  G+
Sbjct: 23560 SGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGI 23609



 Score =  249 bits (636), Expect = 1e-65
 Identities = 151/508 (29%), Positives = 245/508 (48%), Gaps = 22/508 (4%)

Query: 508  YNVTLPAKVHVIDPPKIILDGLDADNT--------------VTVIAGNKLRLEIPISGEP 553
            Y V+   K  V DP +I L  L AD+               + VI  N + + +P +G P
Sbjct: 7059 YRVSAENKAGVSDPSEI-LGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYP 7117

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
             P A W  GDK ++E   R++ ++    + LVI  +ER D G+Y + L+N        I 
Sbjct: 7118 RPTATWCFGDK-VLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEID 7176

Query: 614  VKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL 673
            V V+  P  P      ++  D   + WEPP  DGGSP+ GY +E+++     W ++  D 
Sbjct: 7177 VNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDF 7235

Query: 674  CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPF---VPLAVTSPPTLLTVDSVT 730
              +  F    +++G  Y  ++ A N  G  +P+    P     P  V  PP  +     T
Sbjct: 7236 VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRT 7295

Query: 731  DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFV 790
              ++ + W PP + G + + GY++E C  G++ W+   +  + +TK  +TGL        
Sbjct: 7296 ANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEP-VAETKMEVTGLEEGKWYAY 7354

Query: 791  RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPR 850
            RVKA+N  GAS+P   ++ I   +  E P+I +   L      + G  + L     GKP 
Sbjct: 7355 RVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPE 7414

Query: 851  PELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQ 909
            P++TW K    + ++ +I I N    + + I  ++RS +G Y ++        TA +++ 
Sbjct: 7415 PKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVN 7474

Query: 910  IIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 969
            ++D+PGPP    I DV  E+  LTW PP+DDG + IT Y +++    S  W  +      
Sbjct: 7475 VLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKD 7534

Query: 970  TSATITELVIGNEYYFRVFSENMCGLSE 997
            T+   T+L+   EY FRV +ENM G+ E
Sbjct: 7535 TNFKATKLIPNKEYIFRVAAENMYGVGE 7562



 Score =  247 bits (631), Expect = 4e-65
 Identities = 170/584 (29%), Positives = 278/584 (47%), Gaps = 33/584 (5%)

Query: 436   LTPLTDQTVNL--GKEICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIA 491
             L+ +  +T+++  G+ + L   I+   P    W   G  ++ES+R+ V    ++ KL I 
Sbjct: 23435 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIR 23494

Query: 492   NALTEDEGDYVFAPDAYNVTLPA----KVHVIDPP-----KIILDGLDADNTVTVIAGNK 542
                  D G+Y    +  NVT       KV ++D P      I +D +DA +        +
Sbjct: 23495 ETTIRDTGEYTL--ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPE 23552

Query: 543   LRLEIPISG-----EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
             L    P+SG         +  W    +++   + +    +  +     +    R   G Y
Sbjct: 23553 LDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 23612

Query: 598   HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
                L++E  E  +SI++     P PP    + +V  D   + W PP  DGGS + GY +E
Sbjct: 23613 ---LQSEVIECRSSIRI-----PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVE 23664

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK+ ++ RW+R+N      T +    + EG+ YE R+ A+NA G  KPS PS+P V +  
Sbjct: 23665 RKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDP 23724

Query: 718   TSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774
              +PP       VTDTT   V++ W  P+  G + + GY++E       +W   N      
Sbjct: 23725 IAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKI 23784

Query: 775   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834
              ++T+T LP  A+   RV A NA G  EP      + V E++E P   +    ++    R
Sbjct: 23785 REYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVR 23844

Query: 835   VGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894
              G  + L IP +GKP P   W K+G +I K  + I  SET T + I++A+R  SG YDL 
Sbjct: 23845 QGGVIRLTIPIKGKPFPICKWTKEGQDISKRAM-IATSETHTELVIKEADRGDSGTYDLV 23903

Query: 895   VKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 953
             ++     +   I +++I  P  P+  ++ +D+   +V ++W PP DDG A I GY +++ 
Sbjct: 23904 LENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERR 23963

Query: 954   DKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             +     W+T+      TS  +  L    EY+FRV +EN  G+S+
Sbjct: 23964 EVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISK 24007



 Score =  245 bits (626), Expect = 1e-64
 Identities = 153/493 (31%), Positives = 238/493 (48%), Gaps = 17/493 (3%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG--DKAIMEGSGRIRT 575
             +++PP+I LD       V V AG  +RL   + G P PK  W +   D  + +G    + 
Sbjct: 12295 ILEPPEIDLDA-SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG----QV 12349

Query: 576   ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
             +     + LVI  + RDDSG Y + L N AGE    + V+V+D P P     V++V    
Sbjct: 12350 DLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTS 12409

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++W PP  DGGS +  Y +E+++     W  +  ++ K+T+F    ++ G  Y  R+ 
Sbjct: 12410 CHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNLVPGNEYYFRVT 12468

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             AVN  G   P+   +P +   PL+   PP  L V  +T  + T+ W PP   G A +DGY
Sbjct: 12469 AVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 12528

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
             +  Y  E           ++      +TGL    K   RV A NA G S P+        
Sbjct: 12529 ITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEA 12588

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE-IDKNQINIRN 871
             KE + PPKI +P  +      + G+ + +     GKP P   WKK   E +  + + +  
Sbjct: 12589 KEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHK 12644

Query: 872   SETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENV 930
             +++ +I+ I+   R  SG Y L  +     +T  I + ++D PGPPQ    I D+  +  
Sbjct: 12645 ADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC 12704

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 990
             +L+W  P +DG + IT Y ++K D    +W T +    +TS  + +L+ G EY FRV +E
Sbjct: 12705 SLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAE 12764

Query: 991   NMCGLSEDATMTK 1003
             N  G+SE  T  K
Sbjct: 12765 NRFGISEPLTSPK 12777



 Score =  243 bits (621), Expect = 6e-64
 Identities = 152/515 (29%), Positives = 259/515 (50%), Gaps = 25/515 (4%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP+  LD  D   T+ + AG  +RL +P+ G PPPK  WS+ +  + +  G +  +S
Sbjct: 13382 ILIPPEGELDA-DLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIG-LDIKS 13439

Query: 578   YPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCI 637
                 + L  +   + D+G Y + L+N  G+   +I VKV+D P PPV  TV E+  D   
Sbjct: 13440 TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAY 13499

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + WEPP  DGGSPI+ Y ++++  +   W  +  + C +T+F    + EG +Y  R+FA 
Sbjct: 13500 VTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAE 13558

Query: 698   NAIGISKPSMPSRPFVPLAVTSPPTL-LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             N  GI  P   +R  V  + T  P + L V SV+ ++ ++ W+ P   G + + GYV+++
Sbjct: 13559 NEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 13617

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
               E  + W    K L    +++   L    +   RV A N  G   P   +  ++ ++ +
Sbjct: 13618 LTEENK-WQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDV 13672

Query: 817   EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-DGAEIDKNQINIRNSETD 875
               P + +       Y+ +      L IP +GKP P ++WKK +       ++++ +S  +
Sbjct: 13673 VAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVN 13732

Query: 876   TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-PPQIVKIEDVWGENVALTW 934
             T + +   ++S +GKY + +K     +  +I I+++ +PG P   +K ++V  E + L W
Sbjct: 13733 TTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKW 13792

Query: 935   TPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
              PPKDDG + IT Y ++K D  + +W T      +T+  +T L  G EY FRV +EN  G
Sbjct: 13793 APPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYG 13852

Query: 995   LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1029
             + E     K   ++AR            FD  +AP
Sbjct: 13853 VGEG---LKSEPIVAR----------HPFDVPDAP 13874



 Score =  243 bits (620), Expect = 7e-64
 Identities = 202/709 (28%), Positives = 322/709 (45%), Gaps = 69/709 (9%)

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKW----FKNGEEIIP---- 383
             S  L +REP I V ++ ED        +E++ EV+++   + W    +  G EII     
Sbjct: 10400 SEALVIREP-ITVPERPED--------LEVK-EVTKNTVTLTWNPPKYDGGSEIINYVLE 10449

Query: 384   ----GPKSRYRIRVEGK-KHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTP 438
                 G +  +++  +        ++G  + D  EY V         K S   KP+     
Sbjct: 10450 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 10509

Query: 439   LTDQTVNLGKEICLKCEISE------NIPGK------WTKNGLPVQESDRLKVVHKGRIH 486
             L   T++L     L   + E         GK      W K+   V E DR  +       
Sbjct: 10510 LAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10569

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVIDPPKIILDGLDADNTVTVIAGNK 542
              L    A   D G Y    +  N T   K    V+V+D P   +  +  D          
Sbjct: 10570 ALEKIKAKRSDSGKYCVVVE--NSTGSRKGFCQVNVVDRPGPPVGPVSFDEVT------- 10620

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR------TESYPDSSTLVIDIAERDDSGV 596
              +  + IS +PP     S+    I+E     +      T +   ++  V  + E  D  +
Sbjct: 10621 -KDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY-I 10678

Query: 597   YHINLKNEAG--EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 651
             + I+ +N  G  +   S  +K  D    PD P  P VTEV  D  ++ W  P +DGG PI
Sbjct: 10679 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPI 10737

Query: 652   LGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
               Y +E+++  S RW R+  D +   T F    ++EG  YE R+ A N IGI  PS PS+
Sbjct: 10738 TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK 10797

Query: 711   PFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVA 767
             P     P+A  SPP        T  +V + W+PP H G + + GY++EY   G E+W  A
Sbjct: 10798 PVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRA 10857

Query: 768   NK--DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
             N   +   +TK+ +TGL        RV AVNAAG S+P +  +P+LVK+ +EPP++ +  
Sbjct: 10858 NHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDA 10917

Query: 826   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAER 885
             ++ +    +VG+ + L    +G P P++TWKK+  +    +  I  +   + + IR A  
Sbjct: 10918 NMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAP-TKARIDVTPVGSKLEIRNAAH 10976

Query: 886   SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945
                G Y L V+     +T S+ + ++D+PGPP+ +++ ++  ++  LTW  P DDG + I
Sbjct: 10977 EDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVI 11036

Query: 946   TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
             T Y +++ D  S +W  +     + S     L  GN+Y FRV +EN  G
Sbjct: 11037 TNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYG 11085



 Score =  243 bits (620), Expect = 7e-64
 Identities = 166/560 (29%), Positives = 272/560 (48%), Gaps = 26/560 (4%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH--VIDP 521
             W K+G+ ++E  R +++       L + + +  D G YV        T    V+  V+D 
Sbjct: 19518 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 19577

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + ++GL A+         +      I      K   S     I EG  ++   
Sbjct: 19578 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQM--- 19634

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEV 631
                 +S  V  + + ++  ++ +   N+   GE   S+ +K +D    P PP +  +T V
Sbjct: 19635 ----TSCKVTKLLKGNEY-IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSV 19689

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               +   + W  P  DGGS I GY IER++K S RW+R+N     +   +   + EG  YE
Sbjct: 19690 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 19749

Query: 692   VRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAG 748
              R++A NA G+S PS  S   R   P+ + SPP+   +     TT+T+ W  P   G A 
Sbjct: 19750 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19809

Query: 749   LDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 808
             + GY +EY      DW  + + L   T++TI+GL T A+   RVK+VN  GAS+P   S 
Sbjct: 19810 ITGYTVEYKKSDDTDWKTSIQSLRG-TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 19868

Query: 809   PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN 868
             P + KE  E P   I   +++T I + G +  + +PF+G+P P + W K   ++ + +  
Sbjct: 19869 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-RTRAY 19927

Query: 869   IRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGE 928
             +  +++ T + I  A R+ SGKY L ++      + ++ ++++D PGPP  + ++DV  E
Sbjct: 19928 VDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKE 19987

Query: 929   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 988
             +  L+W  P++DG A +  Y I+K +     W +V  + +R S  +T L  G  YYFRV 
Sbjct: 19988 SAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVS 20047

Query: 989   SENMCGLSEDATMTKESAVI 1008
              EN  G+   A  TKE   I
Sbjct: 20048 GENEFGVGIPAE-TKEGVKI 20066



 Score =  241 bits (614), Expect = 4e-63
 Identities = 135/381 (35%), Positives = 198/381 (51%), Gaps = 3/381 (0%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT V  D   ++W  P  DGGSPILGY +ERK++    W  ++  L     F
Sbjct: 14954 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIF 15013

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   + +G+AYE R+ A N  G SKPS PS P + L    PP      ++T  TVT++W 
Sbjct: 15014 KSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWA 15073

Query: 740   PPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 799
              P++ G   +  Y++E        W+ AN   I + +FT++GL  DA    RV A NAAG
Sbjct: 15074 KPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAG 15133

Query: 800   A-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 858
             A S P   S  I  ++ +E PKI++    K T I + GEA  L     G+P P + W KD
Sbjct: 15134 AISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKD 15193

Query: 859   GAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
             G E++   ++ I+ ++  T +  + + R  SG Y L             +++++DRPGPP
Sbjct: 15194 GKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPP 15253

Query: 918   Q-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE 976
             +  + + +V  E   L+W PP DDG A I  Y +QK +   + W  V      T   +T+
Sbjct: 15254 EGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTK 15313

Query: 977   LVIGNEYYFRVFSENMCGLSE 997
             L+ GNEY FRV + N  G+ E
Sbjct: 15314 LLKGNEYIFRVMAVNKYGVGE 15334



 Score =  240 bits (613), Expect = 5e-63
 Identities = 159/591 (26%), Positives = 282/591 (47%), Gaps = 40/591 (6%)

Query: 429   DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
             D+KP       +  +V +G+++ ++  IS        WTK+GLP++++ R+ V     + 
Sbjct: 16926 DVKPA-----FSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT 16980

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPK--IILDGLDADNTVTVIA 539
              L I     +D G Y            A + ++     DPPK  +  D + A++      
Sbjct: 16981 TLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES------ 17034

Query: 540   GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT-----ESYPDSSTLVIDIAERDDS 594
                    I +S  PP      +    I++      T      +    +TL +   +    
Sbjct: 17035 -------ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTE 17087

Query: 595   GVYHINLKNEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
               + I  +N  G++ A     +V       P PP  P  T +  D  ++ W  P  +GGS
Sbjct: 17088 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 17147

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P++GY +ERK++ S  W ++N  +  +T F+ + + EG+ YE R++A N +G+ K S  S
Sbjct: 17148 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 17207

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANK 769
               +V      PP       V    +T++W  P + G + + GY++E        W+ A+ 
Sbjct: 17208 ECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASF 17267

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLK 828
               + +T+FT++GL  D +   RV A NAAGA S+P   + PI  K+ +E P+I +    +
Sbjct: 17268 TNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFR 17327

Query: 829   QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSH 887
              T +   GE   L     GKP P + W +   EI+++ +  I+N++   ++ ++ A R  
Sbjct: 17328 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRID 17387

Query: 888   SGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAIT 946
              G+Y L+       ++  ++++++DRPGPP+  V++  V  E  +LTW+PP  DG + I+
Sbjct: 17388 GGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDIS 17447

Query: 947   GYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
              Y ++K +   + W  V       S  +T+L+ GNEY FR+ + N  G+ E
Sbjct: 17448 HYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGE 17498



 Score =  239 bits (611), Expect = 8e-63
 Identities = 148/495 (29%), Positives = 245/495 (49%), Gaps = 10/495 (2%)

Query: 506   DAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D+  VT   K V  +  P++ +D  +   T  V AG  +RL I   G P P A+WS+ D 
Sbjct: 22033 DSCEVTGTIKAVDRLTAPELDIDA-NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDS 22091

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
              +   +    T+S+   STL ++   R+D+G Y + ++N +G    +  VKV+D P PP 
Sbjct: 22092 NLSLRADIHTTDSF---STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPG 22148

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
               T  +V      + W+ P  DGG+ I  Y +E+++     W  ++ + C    F+   +
Sbjct: 22149 PITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDL 22207

Query: 685   IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
              EGV Y  R+ AVN  G+ +P     P V     +PP  L V   + ++  + W  PDH 
Sbjct: 22208 AEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHD 22267

Query: 745   GAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
             G + + GY+LE   +G++ W+ A      +  FT+  L    +   RVKA N AG SEP+
Sbjct: 22268 GGSRITGYLLEMRQKGSDFWVEAGH--TKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPR 22325

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-D 863
                  +++KE    P   +     Q    + G    + +P  G+P P++TWK +   + +
Sbjct: 22326 EAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE 22385

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP-PQIVKI 922
              ++++I  ++  T + ++ + R  SG+Y L ++    V+T S+ + +I RPGP    +++
Sbjct: 22386 TDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEV 22445

Query: 923   EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 982
               V  E+  L+W  PKD G   IT Y ++K +  +  W  V     RT   +T L    E
Sbjct: 22446 SSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYME 22505

Query: 983   YYFRVFSENMCGLSE 997
             Y FRV SEN  G+S+
Sbjct: 22506 YSFRVSSENRFGVSK 22520



 Score =  238 bits (608), Expect = 2e-62
 Identities = 155/491 (31%), Positives = 238/491 (48%), Gaps = 15/491 (3%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++PP++ILD   A     +  G+ LRL   I G P PK  W + D+   +   + R +  
Sbjct: 10908 LEPPELILDANMAREQ-HIKVGDTLRLSAIIKGVPFPKVTWKKEDR---DAPTKARIDVT 10963

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
             P  S L I  A  +D G+Y + ++N AG    S+KV V+D P PP    V+E+  D C +
Sbjct: 10964 PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYL 11023

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              W+ P  DGGS I  Y +ER+   S++W  L+    K++ F  K + EG  Y  R+ A N
Sbjct: 11024 TWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAEN 11082

Query: 699   AIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
               G     +   P +   PL    PP  L    V  T V++ W  PD  G + + GY++E
Sbjct: 11083 QYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVE 11142

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
             Y  EGT+DWI      +   +  +TGL        RVKA N  G   P   + PI  +E 
Sbjct: 11143 YQEEGTQDWI--KFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPD-TTIPIECQEK 11199

Query: 816   IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSET 874
             + PP + +   L +  + + G  V      +G P P   W  DG+EI  ++   +     
Sbjct: 11200 LVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNF 11259

Query: 875   DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALT 933
              +++ I+   R  +G+Y + V      +T ++ + ++D PGPP   + I DV  E++ ++
Sbjct: 11260 SSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTIS 11319

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMC 993
             W PPKDDG + +  Y ++K D +   W  V     +T   I  L  G EY FRV +EN  
Sbjct: 11320 WQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKI 11379

Query: 994   GLSE--DATMT 1002
             G+    D+T T
Sbjct: 11380 GVGPPLDSTPT 11390



 Score =  238 bits (607), Expect = 2e-62
 Identities = 169/593 (28%), Positives = 282/593 (47%), Gaps = 27/593 (4%)

Query: 241  LKRMRREEKKSAAFA-------KILDPAYQVDKGGR--VRFVVELADPKLEVKWYKNGQE 291
            L   R E  KSAA         +I++P   ++   +  V F  ++    + +KW KNG+E
Sbjct: 6408 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 6467

Query: 292  IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT 351
            +    +  +     + +L I +C   D+ EY VTAG +K   EL + E P    + LED 
Sbjct: 6468 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 6527

Query: 352  TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA 411
            T    +     C++S + ANVKW++NG EI  G K  Y+   +G  H LII+     D  
Sbjct: 6528 TVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK--YKFEKDGSIHRLIIKDCRLDDEC 6585

Query: 412  EYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLP 470
            EY+      +S A+L V+  P++I+ P  D     G ++    E++ + +  +W +N + 
Sbjct: 6586 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 6645

Query: 471  VQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD 530
            V + D+ +++ +G+IH+L I +    D+G+Y F   A +    AK+ +   PKI      
Sbjct: 6646 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI--AKDKEARAKLELAAAPKI----KT 6699

Query: 531  ADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAE 590
            AD  + V  G  L + +P    P  +A W + ++ +   +     ++  + ++  I  A+
Sbjct: 6700 ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEAK 6755

Query: 591  RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
            + D G Y I L+N+ G+A   I +KV+D P P     VTE  D    + WE P  DGGS 
Sbjct: 6756 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSK 6815

Query: 651  ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE-GVAYEVRIFAVNAIGISKPSMPS 709
            I+GY +ER+  +   W+ L  D  +   F    + + GV Y  R+ A N +G  +P    
Sbjct: 6816 IIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETD 6874

Query: 710  RPFVPLA---VTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV 766
             P    +   V  PP  +T+  V    V++ W PP++ G A +  YV+E   + +  W  
Sbjct: 6875 NPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDT 6934

Query: 767  ANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
            A     +    T+T +    +   RV+A N  G  +P   +  + V + IE P
Sbjct: 6935 AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERP 6987



 Score =  238 bits (607), Expect = 2e-62
 Identities = 172/634 (27%), Positives = 302/634 (47%), Gaps = 44/634 (6%)

Query: 386   KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
             K++Y+ R   +  + I   +  +D    +++         LSV +K L         TV 
Sbjct: 12954 KAQYQFRAIARTAVNISPPSEPSDPV--TILAENVPPRIDLSVAMKSLL--------TVK 13003

Query: 446   LGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              G  +CL   +  + +P   W K+G  ++ ++ +K+  +  +  L + +   +D GDY  
Sbjct: 13004 AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTI 13063

Query: 504   APDAYNVTLPA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR 561
               +  + +  A  K+ V+D P     G  A   +  +  ++  L    S EPP +   S 
Sbjct: 13064 TAENSSGSKSATIKLKVLDKP-----GPPASVKINKMYSDRAML----SWEPPLEDGGSE 13114

Query: 562   GDKAIMEGSGRIRTESYPDSSTLVI---DIAERDDSGVYHINL--KNEAGEA-----HAS 611
                 I++     R      S+T+ I    + +  +   Y   +  +N+ G         +
Sbjct: 13115 ITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPA 13174

Query: 612   IKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
             I     D P   DPPV   +T+   D   ++W+PPA DGGSPI GY +E+++ Q+  W +
Sbjct: 13175 IAKNPYDPPGRCDPPVISNITK---DHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK 13231

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLT 725
             +N     E T +   + EG  YE R+ A+N  G  KPS  S+      P     PP    
Sbjct: 13232 VNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPK 13291

Query: 726   VDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVAN-KDLIDKTKFTITGLPT 784
             V   T ++V++ W  P + G + + GY++E     +++W+  N    + KT+F +TGL  
Sbjct: 13292 VYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLME 13351

Query: 785   DAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP 844
             D +   RV AVN  G S+P         K+I+ PP+  +   L++T I R G  + L +P
Sbjct: 13352 DTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVP 13411

Query: 845   FQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 903
              +G+P P++TW K    + D+  ++I++++ DT +      +  +GKY L ++     + 
Sbjct: 13412 VKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKE 13471

Query: 904   ASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 963
              +I ++++D PGPP  V ++++  ++  +TW PP  DG + I  Y +QK D +   W TV
Sbjct: 13472 YTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTV 13531

Query: 964   IEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
                  +TS  +  L  G  Y+FRVF+EN  G+ +
Sbjct: 13532 TTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD 13565



 Score =  238 bits (606), Expect = 3e-62
 Identities = 182/680 (26%), Positives = 309/680 (45%), Gaps = 62/680 (9%)

Query: 364   EVSEDDANVKWFK----NGEEII-------PGPKSRYRIRVEGKKHILIIEGATKADAAE 412
             +VS+  A++ W K     G  ++       P    ++ I  E K    ++ G +     +
Sbjct: 17918 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 17977

Query: 413   YSVMTTG--GQSSAKL--------SVDLKPLKILTPLTDQTVNLGKEICLKCEI----SE 458
             + V      G+S  ++         + ++P  +  P    ++  G+++ ++  +      
Sbjct: 17978 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQP-SLKLPFNTYSIQAGEDLKIEIPVIGRPRP 18036

Query: 459   NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKV 516
             NI   W K+G P++++ R+ V        L I     +D G Y       A   T    V
Sbjct: 18037 NI--SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSV 18094

Query: 517   HVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              V++ P      +  D + AD  V             IS EPP      +    I+E   
Sbjct: 18095 IVLEKPGPPVGPVRFDEVSADFVV-------------ISWEPPAYTGGCQISNYIVEKRD 18141

Query: 572   RIRTESYPDSSTLV---IDIAERDDSGVYHINL--KNEAGE-AHASIKVKVVDFP----D 621
                T  +  S+T+    I I +      Y   +  +N  G+ A    K  +V +P     
Sbjct: 18142 TTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPG 18201

Query: 622   PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
             PP  P VT +  D  ++ W  P  DGG+ I+GY +E+K+K S  W++LN    ++T F+ 
Sbjct: 18202 PPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKT 18261

Query: 682   KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
               + EG+ YE ++ A N +GI KPS  S  FV      PP       +T   VT++W+ P
Sbjct: 18262 TGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKP 18321

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG-A 800
              + G + + GY++E        W+ A+   + +T+FT++GL  D +   RV A NAAG  
Sbjct: 18322 AYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNF 18381

Query: 801   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
             SEP   S  I  ++ I+ P   +    K   +   GE   L    +GKP P++ W KDG 
Sbjct: 18382 SEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGK 18441

Query: 861   EIDKN--QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 918
             E+++   ++ I+++   T + ++   R+  G+Y L++      ++  I ++++DRPGPP+
Sbjct: 18442 ELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPE 18501

Query: 919   -IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               +K+  V  E   L W PP  DG A I+ Y I+K +   + W  V       +  +T+L
Sbjct: 18502 GPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKL 18561

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + GNEY FRV + N  G+ E
Sbjct: 18562 LPGNEYIFRVMAVNKYGIGE 18581



 Score =  234 bits (598), Expect = 3e-61
 Identities = 141/476 (29%), Positives = 240/476 (50%), Gaps = 11/476 (2%)

Query: 529   LDAD--NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
             LDA+   T+ V AG  +R+ +PI G P P+  W++ +  +   +    TES+   + L+I
Sbjct: 14473 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESF---TLLII 14529

Query: 587   DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
                 R D+G + + ++N AG+    + V+V+D P P +    T++  D   ++W+ P  D
Sbjct: 14530 PECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLID 14589

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I  Y +E+++     +       C + T++   + EG  Y  R+ A N  GI +P+
Sbjct: 14590 GGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPT 14648

Query: 707   MPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV 766
               + P       SPP  L +  +T +TV++ W  P H G + + GYV+E   +G++ W  
Sbjct: 14649 ETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-- 14706

Query: 767   ANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRH 826
              +   +   +  +  L    +   +V AVN+AG S P+  S+P++VKE    P++ +   
Sbjct: 14707 THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESRPVIVKEQTMLPELDLRGI 14765

Query: 827   LKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAER 885
              ++  I + G+ + + IP  G+P+P +TWKK    + + Q +N   + T TI+ I +  R
Sbjct: 14766 YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVR 14825

Query: 886   SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAA 944
             S SG Y L  +         I IQ+ D PGPP   +K ++V  + V  +W PP++DG   
Sbjct: 14826 SDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVP 14885

Query: 945   ITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1000
             I+ Y ++     S  W  +     RT+   T L  G EY FRV ++N  G+    T
Sbjct: 14886 ISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGIT 14941



 Score =  233 bits (595), Expect = 6e-61
 Identities = 168/591 (28%), Positives = 280/591 (47%), Gaps = 38/591 (6%)

Query: 428   VDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             +DLK   +LT     T+ L  E  ++ +    +     K+   +  S R+K+  +    K
Sbjct: 11898 LDLKLSGVLTVKAGDTIRL--EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11955

Query: 488   LVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
               +  A   D G YV      A +    A V+V+D P     G   +  +  ++ ++   
Sbjct: 11956 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP-----GPVRNLKIVDVSSDRCT- 12009

Query: 546   EIPISGEPPPKAMWSRGDKAIMEG--SGRIRTESYPDS----STLVIDIAERDDSGVYHI 599
                +  +PP           I+E   + R+   +Y  +     T V  + E ++  ++ +
Sbjct: 12010 ---VCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEY-IFRV 12065

Query: 600   NLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
               +N+ G     E+   I     D P  P  P VT+V  +   + W PP YDGG  I GY
Sbjct: 12066 RAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGY 12125

Query: 655   FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV- 713
             F+E+K+K S+RW+ +N     E   + + ++    Y+ R+ A N IGI +PS+PSRP V 
Sbjct: 12126 FLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVA 12185

Query: 714   --PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC-----FEGTEDWIV 766
               P+    PPT   V   T  ++T+ W  P + G A + GYV+E           E W  
Sbjct: 12186 KDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKR 12245

Query: 767   ANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
              N    + + +FT+T L  + +   RV A N  G   P    + I  KEI+EPP+I +  
Sbjct: 12246 CNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDA 12305

Query: 826   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE--IDKNQINIRNSETDTIIFIRKA 883
              +++  I R G  + L    +G+P P++TW+K G +  + K Q+++   +T   + I  +
Sbjct: 12306 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDL--VDTMAFLVIPNS 12363

Query: 884   ERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA 943
              R  SGKY L +      +   ++++++D PGP   +K+ DV   +  ++W PP++DG +
Sbjct: 12364 TRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGS 12423

Query: 944   AITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
              +T Y ++K +     W TV     +TS  +T LV GNEYYFRV + N  G
Sbjct: 12424 QVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYG 12474



 Score =  233 bits (594), Expect = 8e-61
 Identities = 159/513 (30%), Positives = 252/513 (49%), Gaps = 34/513 (6%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS---RGDKAIMEGSGRI--- 573
             + P++ +D + A + +   AG+++R+   I G P PK+ W    +  KA+ +G   I   
Sbjct: 9501  EEPEVFID-IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 9559

Query: 574   -RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVG 632
              + E+  +SS ++I   +R  +G Y I  KN+AG+  A+ +VKV+D P PP    V+++ 
Sbjct: 9560  AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDIT 9619

Query: 633   DDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEV 692
                C ++W+ P  DGG  I GY IE++      W ++N D C  TTF    ++    Y  
Sbjct: 9620  RGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFF 9678

Query: 693   RIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGL 749
             R+ A N  GI  P    +      P+    PP  L +  +T  TV + W+PP + G + +
Sbjct: 9679  RVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPV 9738

Query: 750   DGYVLEYCF----EGT--EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 803
               Y++E C      GT  E W   NK  +++ +FT+  L    +   RVKAVNAAG S+P
Sbjct: 9739  THYIVE-CLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKP 9797

Query: 804   KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW------KK 857
                  P   +    PP I     LK+      G  VN+V   +G P P LTW      K 
Sbjct: 9798  SATVGPCDCQRPDMPPSI----DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKP 9853

Query: 858   DGAE---IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP 914
             D  E    D +   +   +T T++ I ++ RS +G Y +    +    +  + + ++ RP
Sbjct: 9854  DNKEPVLYDTHVNKLVVDDTCTLV-IPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRP 9912

Query: 915   GPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             GPP   +K E V  + + L+W PPKDDG + IT Y I+K +     W  V       + T
Sbjct: 9913  GPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYT 9972

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1006
             I +L+ G+EY FR+ ++N  G+ E      E+A
Sbjct: 9973  IPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETA 10005



 Score =  230 bits (587), Expect = 5e-60
 Identities = 156/568 (27%), Positives = 267/568 (47%), Gaps = 24/568 (4%)

Query: 465   TKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKI 524
             +++G+P++ + R           + +  ++T D G Y       + T  A ++++     
Sbjct: 20206 SRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV----- 20260

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM---EGSGRIRTESYPDS 581
             +LD      T  V+  +     + +  EPP     S+    I+   E S  + TE     
Sbjct: 20261 VLDR-PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATV 20319

Query: 582   STLVIDIAERDDSGVYHINLKNE--------AGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             +  ++ + +      Y   +K E           A  ++K+     P PP  P VT V  
Sbjct: 20320 ARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTT-PGPPSTPWVTNVTR 20378

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             +   + W  P  +GGS ++GY +E K + S  W + N  + + T F+   +  G+ YE R
Sbjct: 20379 ESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFR 20438

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYV 753
             ++A NA G+ KPS PS P + +    PP  + +  ++  +V++ W+ P   G + + GY+
Sbjct: 20439 VYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYI 20498

Query: 754   LEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPILV 812
             +E        W  A+   + +T+F I+GL  +++   RV A NA G+ S P     PI  
Sbjct: 20499 VERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITC 20558

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
              +    P I +P    +    R G +V L     GKP P + W KD  E+  N +    +
Sbjct: 20559 IDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVEN 20618

Query: 873   ETD-TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENV 930
              TD   I I+ A+R +SG Y+L+++      +A+I +QI+D+PGPP   ++ + V  E +
Sbjct: 20619 TTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKI 20678

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 990
              L W PP DDG A IT Y ++K +   + W  V EH      T T+++ GNEY FRV + 
Sbjct: 20679 TLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAV 20738

Query: 991   NMCGLSEDATMTKESAVIARDGKIYKNP 1018
             N  G+ E     +  +V+A++  +   P
Sbjct: 20739 NKYGIGEP---LESDSVVAKNAFVTPGP 20763



 Score =  230 bits (586), Expect = 6e-60
 Identities = 161/526 (30%), Positives = 248/526 (47%), Gaps = 48/526 (9%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            + P+I LD +     +TV AG K+ L   ++G+P PK  W++ D  I++   RI  E+ P
Sbjct: 7381 EAPEIFLD-VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM-ILKQDKRITIENVP 7438

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              ST+ I  ++R D+G Y I   N  G A A ++V V+D P PP A  +T+V ++ C++ 
Sbjct: 7439 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLT 7498

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W PP  DGGS I  Y +ER+   S  W +L+    K+T F+  K+I    Y  R+ A N 
Sbjct: 7499 WNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENM 7557

Query: 700  IGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+ +P  + P           PPT L    +T   VT+ W  PD  G + + GY +E  
Sbjct: 7558 YGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERL 7617

Query: 758  FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
               T+ W+  NK  +  T + + GL    K   RV A N AG  +P   ++PIL+K+ I+
Sbjct: 7618 DPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID 7677

Query: 818  PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK----DGAEIDKNQINIRNSE 873
            PP       +K                  GK    L W K     GA+I+   I +  + 
Sbjct: 7678 PPWPPGKPTVKDV----------------GKTSVRLNWTKPEHDGGAKIESYVIEMLKTG 7721

Query: 874  TDTIIFIRKAE-----------RSHSGKYDLQVK-VDKFVETASID-------IQIIDRP 914
            TD   ++R AE                +Y  +V+ V+K  E+   +        + +  P
Sbjct: 7722 TDE--WVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPP 7779

Query: 915  GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI 974
             PP+ +++ ++      L WT P+ DG + IT Y ++K D +   W TV      T  T+
Sbjct: 7780 SPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTV 7839

Query: 975  TELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1020
            T L  G+ Y FRV +EN  G S+   +  E +V+A+D      P Y
Sbjct: 7840 TPLTEGSLYVFRVAAENAIGQSDYTEI--EDSVLAKDTFTTPGPPY 7883



 Score =  230 bits (586), Expect = 6e-60
 Identities = 154/553 (27%), Positives = 257/553 (46%), Gaps = 32/553 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF--APDAYNVTLPAKVHVIDP 521
             W K+G  ++E+ R+ V     +  L I  A  ED G Y    +  A ++T+P  + V+D 
Sbjct: 19123 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19182

Query: 522   P----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             P     I +D +  D+             I IS  PP      +    I+E      T  
Sbjct: 19183 PGPPGPIRIDEVSCDS-------------ITISWNPPEYDGGCQISNYIVEKKETTSTTW 19229

Query: 578   YPDSSTLV---IDIAERDDSGVYHINL-------KNEAGEAHASIKVKVVDFPDPPVAPT 627
             +  S  +    I I        Y   +       K+   E+ A +       P PP  P 
Sbjct: 19230 HIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPK 19289

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             V        ++ W+ P  DGGS ++GY +E K++ S  W + N  L  +T  +   + EG
Sbjct: 19290 VVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEG 19349

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
             + YE R++A N  GI K S    P        PP    V ++T  +V+++W  P + G A
Sbjct: 19350 LMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGA 19409

Query: 748   GLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA-GASEPKYY 806
              + GY++E        W+  N   I +T F +T L  D +   RV A NAA   SEP   
Sbjct: 19410 KITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSES 19469

Query: 807   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN- 865
             + PI+VK+ +EPP++ +    +   + + GE + +     G+P P ++W KDG EI++  
Sbjct: 19470 TGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERA 19529

Query: 866   QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIED 924
             +  I +++  T++ ++   R  +G+Y L +K      + +++ +++D+PGPP   ++I  
Sbjct: 19530 RTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEING 19589

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY 984
             +  E  +L+W  P++DG A I  Y ++K +   + W         TS  +T+L+ GNEY 
Sbjct: 19590 LTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYI 19649

Query: 985   FRVFSENMCGLSE 997
             FRV   N  G+ E
Sbjct: 19650 FRVTGVNKYGVGE 19662



 Score =  229 bits (583), Expect = 1e-59
 Identities = 169/620 (27%), Positives = 271/620 (43%), Gaps = 26/620 (4%)

Query: 394   EGKKHILIIEGATKADAAEYSVMTTGGQSSAKL-SVDLKPLKILTPLTDQTVNLGKEICL 452
             EGK++   +    +      S +T   +       +DLK L  L  L  +  N   +I +
Sbjct: 13642 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 13701

Query: 453   KCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTL 512
             K + + ++   W K   P+    R+ V        L++ +    D G Y         T 
Sbjct: 13702 KGKPAPSV--SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 13759

Query: 513   PA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                  + V+  P I    +  D  VT  A       + +   PP     S     I+E  
Sbjct: 13760 EGTISIKVVGKPGIPTGPIKFDE-VTAEA-------MTLKWAPPKDDGGSEITNYILEKR 13811

Query: 571   GRIRTE-----SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV-----DFP 620
               +  +     S    +T  +          + ++ +N+ G         +V     D P
Sbjct: 13812 DSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 13871

Query: 621   DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE 680
             D P  P + +V  D   + W  P   GGSPI GY +E K++ S  W R N    +   F+
Sbjct: 13872 DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFK 13931

Query: 681   PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRP 740
                + EG+ YE R+ A+N  G+ KPS+PS P V L    PP    V ++T  +VT+ W  
Sbjct: 13932 VTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTE 13991

Query: 741   PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
             P + G   L GY++E     ++ W+ AN   + +  FT+T L    K   R++A N AGA
Sbjct: 13992 PKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGA 14051

Query: 801   -SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL-VIPFQGKPRPELTWKKD 858
              S P   ++ I+ K+  E P I +   +K     + G+ + L  I   GKP P+ +W K 
Sbjct: 14052 ISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKA 14111

Query: 859   GAEIDKNQI-NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
             G +I  + I  I ++ T +++ I+ A R  +G+Y +        +   + + ++D PGPP
Sbjct: 14112 GKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPP 14171

Query: 918   QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               V+I +V  E   LTWTPP +DG + I  Y ++K +   + W  V E         T+L
Sbjct: 14172 GPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKL 14231

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + GNEY FRV + N  G  E
Sbjct: 14232 IQGNEYIFRVSAVNHYGKGE 14251



 Score =  228 bits (580), Expect = 3e-59
 Identities = 170/617 (27%), Positives = 288/617 (46%), Gaps = 47/617 (7%)

Query: 428   VDLKPLKILTPLTDQTV-NLGKEICLKCEISENIPG--KWTKNGLPVQESDRLKVVHKGR 484
             V+   +K+     D  +   G+   L+ ++S   P   +W+K+G  ++ + +L++     
Sbjct: 15151 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15210

Query: 485   IHKLVIANALTEDEGDYV--------FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                LV  ++   D G Y         FA   +NV       V+D P       +    VT
Sbjct: 15211 STNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVK------VLDRP----GPPEGPLAVT 15260

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAER 591
              +   K  L    S  PP     ++ D  I++     R       S    + L +    +
Sbjct: 15261 EVTSEKCVL----SWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLK 15316

Query: 592   DDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
              +  ++ +   N+ G     E+   + V     PDPP  P VT +  D  ++ W  P  D
Sbjct: 15317 GNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSD 15376

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I+ Y +ER+ K   RW++ N     +  ++   + EG  YE RI A NA GIS PS
Sbjct: 15377 GGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 15436

Query: 707   MPSRPFVPLAVT----SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTE 762
              P+ PF     T     PP    V   + +++++ W  P + G + + GY++E      +
Sbjct: 15437 -PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEED 15495

Query: 763   DW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 821
             +W IV     +  T +TITGL  + +  +R+ A+N+ G  EP         ++ + PP+I
Sbjct: 15496 EWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEI 15555

Query: 822   RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD-GAEIDKNQINIRNSETDTIIFI 880
              +   L++    R    + L +P +G+P PE+ W +D G  +DK   +I ++ + T++ +
Sbjct: 15556 ELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDK--ASIESTSSYTLLIV 15613

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 940
                 R  SGKY L V+     ++A ++++++D PGPPQ +K+++V   +V LTW PP  D
Sbjct: 15614 GNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLD 15673

Query: 941   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL---SE 997
             G + I  Y ++K +     + TV  + H+TS  + +L  G  YYFRV +EN  G+   +E
Sbjct: 15674 GGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAE 15733

Query: 998   DATMTKESAVIARDGKI 1014
              A   K S      GKI
Sbjct: 15734 TAESVKASERPLPPGKI 15750



 Score =  228 bits (580), Expect = 3e-59
 Identities = 151/547 (27%), Positives = 256/547 (46%), Gaps = 24/547 (4%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+GLP++ES+ ++         L I NA  E  G Y    D     + +P  V  + P
Sbjct: 21292 WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 21351

Query: 522   PK-----IILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      I  D + AD+ +       L  ++P          +S   +   + + ++   
Sbjct: 21352 PSKPKGPIRFDEIKADSVI-------LSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCS 21404

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD-----FPDPPVAPTVTEV 631
             S   ++  V ++  +D    + +  +N  G +   +   +V       P PP  P +  V
Sbjct: 21405 SVARTTFKVPNLV-KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNV 21463

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               D   + W+ P YDGGS + G+ +E+K++ S  W ++N        +    ++EG+ Y+
Sbjct: 21464 TSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQ 21523

Query: 692   VRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDG 751
              R++A N+ G+S PS PS+  + ++   PP       VT  T+T++W PP   G + + G
Sbjct: 21524 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 21583

Query: 752   YVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPI 810
             Y +E   +G E W+  N   + + ++T+TGL    +   R+ A NA G  S P   S  I
Sbjct: 21584 YSIEK-RQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGII 21642

Query: 811   LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINI 869
             + ++   PP +          I + GE++ +    QG+P P +TW KDG EI+K   + I
Sbjct: 21643 MTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEI 21702

Query: 870   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP-PQIVKIEDVWGE 928
              +    T +F+R A R H G Y ++ K       A I +++ D PG     ++  ++ GE
Sbjct: 21703 TDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGE 21762

Query: 929   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 988
              + L W  P +DG A IT Y I+K +   + W  + +     S T  +L+ GNEY FRV 
Sbjct: 21763 KMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVS 21822

Query: 989   SENMCGL 995
             + N  G+
Sbjct: 21823 AVNKFGV 21829



 Score =  227 bits (578), Expect = 5e-59
 Identities = 154/500 (30%), Positives = 249/500 (49%), Gaps = 18/500 (3%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   N  + AK  +++ P+I LD +    +V   AG  +++ IP  G PPP   W R D+
Sbjct: 20948 PIEMNEPVQAK-DILEAPEIDLD-VALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDE 21004

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS-IKVKVVDFPDPP 623
               +    R   E+   SS L I    R+D+G Y + ++N  GE  +S + VKV+D P   
Sbjct: 21005 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 21064

Query: 624   VAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
                 V  V      + W+PP  DGGSPI+ Y IE++      W  ++   C  T+F+   
Sbjct: 21065 QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHK-CSSTSFKLID 21123

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             + E   +  R+ A N IGI +P   + P     V +P   L++   T T+V + W  PD 
Sbjct: 21124 LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDF 21183

Query: 744   IGAAGLDGYVLEYCFEGTEDWIVANKDLIDKT-KFTITGLPTDAKIFVRVKAVNAAGASE 802
              G + +  YV+E   +G + W  A    I KT +  ++ L   + +  RV A N  G S+
Sbjct: 21184 DGGSVITEYVVERKGKGEQTWSHAG---ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSD 21240

Query: 803   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 862
             P     PI VKE+I  P++ +          R+G  V+L +P++GKP+P ++W KDG  +
Sbjct: 21241 PVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPL 21299

Query: 863   DKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI-- 919
              +++ +    +E    + I+ A++ H GKY   V +D  V   ++ I +I   GPP    
Sbjct: 21300 KESEFVRFSKTENKITLSIKNAKKEHGGKYT--VILDNAVCRIAVPITVITL-GPPSKPK 21356

Query: 920   --VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               ++ +++  ++V L+W  P+D+G   IT Y+I+K +     W  V     RT+  +  L
Sbjct: 21357 GPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNL 21416

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             V   EY FRV +EN  G+S+
Sbjct: 21417 VKDAEYQFRVRAENRYGVSQ 21436



 Score =  226 bits (576), Expect = 9e-59
 Identities = 163/554 (29%), Positives = 261/554 (47%), Gaps = 33/554 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDP 521
             W K+ +P++++ R+          L I +A  ED G YV      A        V V+D 
Sbjct: 15876 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDK 15935

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + +D + AD+             I +S  PP     S  +  I+E      T 
Sbjct: 15936 PGPPTGPVKMDEVTADS-------------ITLSWGPPKYDGGSSINNYIVEKRDTSTTT 15982

Query: 577   SYPDSSTLVIDI--AERDDSGV---YHINLKNEAGEA-HASIKVKVVDF----PDPPVAP 626
                 S+T+      A R  +G    + I  +N  G++ + + +  V  +    P PP  P
Sbjct: 15983 WQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTP 16042

Query: 627   TVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              VT    D   + W  P  DGGS ++GY +ERK++ S  W++LN     +T F+   + E
Sbjct: 16043 VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEE 16102

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGA 746
             GV YE R+ A N +GI KPS  S  +V      PP       VT  +VT++W+ P + G 
Sbjct: 16103 GVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGG 16162

Query: 747   AGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKY 805
             + + GY++E        W+ A+   I  T F +TGL  D +   RV A NAAG  SEP  
Sbjct: 16163 SKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSE 16222

Query: 806   YSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
              +  I  ++ ++PP+I +    K T +   GE+  +     GKP P + W K   E+   
Sbjct: 16223 STGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNT 16282

Query: 866   -QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIE 923
              ++ I++++  T + ++ A R  SG Y L+ K      + +++++++DRPGPP+  V I 
Sbjct: 16283 ARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVIS 16342

Query: 924   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
              V  E   L W PP  DG + I  Y +++ +   + W  V  +    S  +T+L+ GNEY
Sbjct: 16343 GVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEY 16402

Query: 984   YFRVFSENMCGLSE 997
              FR+ + N  G+ E
Sbjct: 16403 TFRIMAVNKYGVGE 16416



 Score =  225 bits (574), Expect = 2e-58
 Identities = 142/476 (29%), Positives = 224/476 (47%), Gaps = 18/476 (3%)

Query: 573   IRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPT 627
             +   S P   T  I         V+ I  +N+ G     ++       +   P  P  PT
Sbjct: 9960  VHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPT 10019

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT----FEPKK 683
             V+ V  +   +NWE P YDGGSP+ GY++E K   S RW R+N D  K  T    ++   
Sbjct: 10020 VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTG 10079

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRP 740
             +IEG  Y+ R++A+NA G+   S+PS P     P+A   PP     D  T ++  + W P
Sbjct: 10080 LIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVTDW-TKSSADLEWSP 10138

Query: 741   PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
             P   G + + GY++EY  EG E+W       +  TK  +TGL   A    RV+AVN AG 
Sbjct: 10139 PLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGI 10198

Query: 801   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
              EP   +  I +K+ +  P +++   ++   +   G  + ++    GKP P +TW  +  
Sbjct: 10199 GEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNER 10258

Query: 861   EIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV 920
              + + +  I  +   + + I+  +RSH G Y L  K +      +I + ++D PGP    
Sbjct: 10259 TLPQ-EATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTP 10317

Query: 921   KI-EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVI 979
              +  ++  E+  LTW  P+DDG + IT Y I+K +     W  V     R +AT+  L+ 
Sbjct: 10318 FLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQ 10377

Query: 980   GNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPL 1035
             G  Y+FR+ +EN  G+      T E+ VI     + + P  ED +  E    T  L
Sbjct: 10378 GKAYFFRIAAENSIGMG-PFVETSEALVIREPITVPERP--EDLEVKEVTKNTVTL 10430



 Score =  223 bits (569), Expect = 6e-58
 Identities = 160/574 (27%), Positives = 265/574 (46%), Gaps = 34/574 (5%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHV 518
             +W K    +  + RL++        L + +A+  D G+Y+    A NV    ++   V V
Sbjct: 16271 QWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK--AKNVAGERSVTVNVKV 16328

Query: 519   IDPP-----KIILDGLDADNTVTVIA-----GNKLRLEIPISGEPPPKAMWSRGDKAIME 568
             +D P      +++ G+ A+            G    +   +      + +W+  D  +  
Sbjct: 16329 LDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQT 16388

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              S ++      +  T  I    +   G        E  E+   +       PD P AP V
Sbjct: 16389 LSCKVTKLLEGNEYTFRIMAVNKYGVG--------EPLESEPVVAKNPFVVPDAPKAPEV 16440

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV 688
             T V  D  I+ WE PA DGGS ILGY +E++ K+  RW R +  L  E       +IE  
Sbjct: 16441 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 16500

Query: 689   AYEVRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIG 745
              YE R+ A NA G+S+PS PS   +   P+    PP    V  +T ++V + W  P + G
Sbjct: 16501 DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDG 16560

Query: 746   AAGLDGYVLEYCFEGTEDWIVANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
                + GY++E C     +W +      I+KT   +  L    +   R+ A+N AG  E  
Sbjct: 16561 GCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHA 16620

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW-KKDGAEID 863
                 PI+V+E +E P I +   L++    R G ++ L +P +G+P PE+ W K DG   D
Sbjct: 16621 DVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRD 16680

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 923
                I++ +S T  +  +    R  SGKY L ++     ++A + ++++D P PP  +K+ 
Sbjct: 16681 AAIIDVTSSFTSLV--LDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVT 16738

Query: 924   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
             ++  ++V++TW PP  DG + I  Y ++K +     +  V+ + H+ S  I +L  G  Y
Sbjct: 16739 EITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSY 16798

Query: 984   YFRVFSENMCGL---SEDATMTKESAVIARDGKI 1014
             YFRV +EN  G+   ++ A   K + V    GKI
Sbjct: 16799 YFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 16832



 Score =  222 bits (566), Expect = 1e-57
 Identities = 161/583 (27%), Positives = 256/583 (43%), Gaps = 22/583 (3%)

Query: 430   LKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             L P KIL P    T+  GK++ ++  +    +   KW K    V  S  L V        
Sbjct: 12592 LLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI 12650

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPKIILDGLDADNTVTVIAGNK 542
             L+I +   +D G Y    +  + T   K+ V+      PP+   D  D D          
Sbjct: 12651 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC-----S 12705

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
             L   IP+         +      +  G       S   +S  V  +    +  ++ +  +
Sbjct: 12706 LSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEY-IFRVRAE 12764

Query: 603   NEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N  G +      K+V       P  P    VT+V  D   + W+ P  DGGSPI+GY IE
Sbjct: 12765 NRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIE 12824

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK++ S  W++ N  L + T +    ++EG+ Y  RI+A+N  G S PS P+        
Sbjct: 12825 RKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP 12884

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVAN--KDLIDKT 775
               PP    V  VT +TV++ W  P H G + + GY +E C    + W+  N     I + 
Sbjct: 12885 VDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQE 12944

Query: 776   KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 835
             ++T TGL   A+   R  A  A   S P   S P+ +     PP+I +   +K     + 
Sbjct: 12945 EYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKA 13004

Query: 836   GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQ 894
             G  V L     GKP P ++WKKDG  +   + I +        + +    R  SG Y + 
Sbjct: 13005 GTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTIT 13064

Query: 895   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954
              +     ++A+I ++++D+PGPP  VKI  ++ +   L+W PP +DG + IT Y + K +
Sbjct: 13065 AENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRE 13124

Query: 955   KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
                  W  V      TS ++ +L+ G+EY FR+ +EN  G+ +
Sbjct: 13125 TSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGD 13167



 Score =  222 bits (565), Expect = 2e-57
 Identities = 160/535 (29%), Positives = 257/535 (48%), Gaps = 52/535 (9%)

Query: 502  VFAPDAYNVTLPAKV--HVI--DP---PKIILDGLDADNTVTVIAGNKLRLEIPISGEPP 554
            V A +A  V+ P+++  +V+  DP   P I L+  D    + VI G KL + +P    P 
Sbjct: 8055 VRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD----IIVIEGEKLSIPVPFRAVPV 8110

Query: 555  PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
            P   W +  K + + S R+  ++   S+ L +  + R D+G+Y I L+N+ G A ASI V
Sbjct: 8111 PTVSWHKDGKEV-KASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINV 8169

Query: 615  KVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC 674
            KV+  P P      +++    C + WEPP +DGG+PIL Y +ER++     ++ +     
Sbjct: 8170 KVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGEN 8229

Query: 675  KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTD 731
            K  ++  K +I    Y  R+ AVN +G  +      P +   P     PP  + V + T 
Sbjct: 8230 K-LSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTA 8288

Query: 732  TTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVR 791
              +T+ W+PP + G + + GY++E   +G E W   N+ L+    +T  GL    +   R
Sbjct: 8289 EAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFR 8348

Query: 792  VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 851
            V+A NAAG SEP   + P    + I+ PK+ +   L+   ++R G+ + L     G P P
Sbjct: 8349 VRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLE---VKR-GDEIALDASISGSPYP 8404

Query: 852  ELTWKKD-----GAEIDK------------------------NQINIRNSET-DTIIFIR 881
             +TW KD       EI K                         +++I NS+  ++ + +R
Sbjct: 8405 TITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVR 8464

Query: 882  KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
             + R   G Y ++V+ D  +  A   + ++D PGPP     ED+   +V   W PP DDG
Sbjct: 8465 DSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDG 8524

Query: 942  NAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
             + I  YT++K D  K   EW  V         ++T+L+ G EY FRV +EN  G
Sbjct: 8525 GSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFG 8579



 Score =  220 bits (561), Expect = 5e-57
 Identities = 176/654 (26%), Positives = 292/654 (44%), Gaps = 63/654 (9%)

Query: 380   EIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPL 439
             +++ G K  +RIR +         GA  A +     +    +  A       P  +L P 
Sbjct: 14032 DLVEGGKYEFRIRAKNTA------GAISAPSESTETIICKDEYEA-------PTIVLDPT 14078

Query: 440   TDQ--TVNLGKEICLKCE--ISENIP-GKWTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                  T+  G  I L     + + +P   W+K G  ++ SD  ++        L I  A 
Sbjct: 14079 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 14138

Query: 495   TEDEGDY-VFAPDAYNVTLP-AKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              +D G+Y + A + +   +   KV V+D P     G      ++ ++  K  L    +  
Sbjct: 14139 RKDAGEYTITATNPFGTKVEHVKVTVLDVP-----GPPGPVEISNVSAEKATL----TWT 14189

Query: 553   PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK----NE---- 604
             PP +   S     I+E           ++S L+  +   D     H+  K    NE    
Sbjct: 14190 PPLEDGGSPIKSYILEKR---------ETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFR 14240

Query: 605   --------AGEAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILG 653
                      GE   S  VK+VD    P PP  P V+ V  +   ++W+ P  DGGS I G
Sbjct: 14241 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 14300

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV 713
             Y +ER++K+S RW+R       +   +   + EG  YE R+ A N  GI  PS  S   +
Sbjct: 14301 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 14360

Query: 714   PLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV-ANK 769
                   PP   +   VTDTT    ++ W  P + G   + GYV+E+   G E WI     
Sbjct: 14361 MKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTG 14420

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 829
               +  T+F +  L T  K   R+ A+N AG  EP       +V+  + P    +   L++
Sbjct: 14421 TALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPD-FELDAELRR 14479

Query: 830   TYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG 889
             T + R G ++ + +P +G+P PE+TW KD   + KN+ NI N+E+ T++ I +  R  +G
Sbjct: 14480 TLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIENTESFTLLIIPECNRYDTG 14538

Query: 890   KYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYT 949
             K+ + ++     ++  ++++++D PGP   ++  D+  ++V L W  P  DG + IT Y 
Sbjct: 14539 KFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYI 14598

Query: 950   IQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             ++K +     + T     H+ +  +T L  G EY+FRV +EN  G+ E    T+
Sbjct: 14599 VEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTE 14652



 Score =  218 bits (554), Expect = 3e-56
 Identities = 159/598 (26%), Positives = 266/598 (44%), Gaps = 55/598 (9%)

Query: 434   KILTPLTDQTVNLGKEICLKCEISENIPG----------KWTKNGLPVQESDRLKVVHKG 483
             K++ P  +  V L + + +K   +   P           KWT +G  ++  +   V    
Sbjct: 11199 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11258

Query: 484   RIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVID---PPKIILDGLDADNTVTVI 538
                 L I N L  D G+Y       A + T+   + V+D   PP   ++ LD        
Sbjct: 11259 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPE---- 11314

Query: 539   AGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAERDD 593
                     + IS +PP     S     I+E     +       S    + L I   ++  
Sbjct: 11315 -------HMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 11367

Query: 594   SGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
               V+ +  +N+ G     ++  ++       P PP  P VT++ ++   ++W  P  DGG
Sbjct: 11368 EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGG 11427

Query: 649   SPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             SPI GY++ER++  + +W+R+N     +  F    + EG  YE R+FA N  G+SKPS  
Sbjct: 11428 SPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 11486

Query: 709   SRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
             S P     P+    PP    +   +  T  + W  P   G + + GYV+E    GT  W 
Sbjct: 11487 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWN 11546

Query: 766   VANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIP 824
               NKD LI +  F + GL    +   R+KA N  G  EP+  ++ ++ K+I+ PP++ + 
Sbjct: 11547 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 11606

Query: 825   RHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI------- 877
                +     RVG+ + ++   +G+P P++TW K+G      ++ +R    D I       
Sbjct: 11607 VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG------KVLVREKRVDLIQDLPRVE 11660

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 937
             + I++A R+  GKY +  K        S  + ++DRPGP Q +K+ +V  EN  ++W  P
Sbjct: 11661 LQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENP 11720

Query: 938   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
              D+G + IT + ++        W  V     +       L+  NEYYFRV +EN  G+
Sbjct: 11721 LDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIK-ANLLANNEYYFRVCAENKVGV 11777



 Score =  214 bits (544), Expect = 5e-55
 Identities = 128/407 (31%), Positives = 204/407 (50%), Gaps = 22/407 (5%)

Query: 611  SIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
            S KV + D    P PP  P V        +++W PP  +GGSPI GY++E++++ S  W 
Sbjct: 9282 SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWS 9341

Query: 668  RLNFDLC-----KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
            R++         K   F   +++EGV Y+ R  A+NA GI  PS PS P V   P+    
Sbjct: 9342 RVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPG 9401

Query: 720  PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKD--LIDKTKF 777
            PP+   V   T +++++ W+PP   G + + GY++E   EGT DW   N+   LI   + 
Sbjct: 9402 PPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCEC 9461

Query: 778  TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 837
             +  L    K   RVKAVN AG SEP   +  I   +I E P++ I    +   + + G 
Sbjct: 9462 VVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGS 9521

Query: 838  AVNLVIPFQGKPRPELTWK---------KDGAEIDKNQINIRNSETDTIIFIRKAERSHS 888
             + +    +G+P P+ +W+         KDG         +  +E  ++I I + +RSH+
Sbjct: 9522 QIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT 9581

Query: 889  GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 948
            GKY +  K     +TA+  ++++D PGPP+ +K+ D+   +  L+W  P DDG   I GY
Sbjct: 9582 GKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGY 9641

Query: 949  TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             I+K       W  V      T+  + +L+   +Y+FRV +EN  G+
Sbjct: 9642 VIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGI 9688



 Score =  214 bits (544), Expect = 5e-55
 Identities = 163/595 (27%), Positives = 269/595 (45%), Gaps = 44/595 (7%)

Query: 443   TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T+  G ++ L   +      K  WTK    +   +++ + + G+    VI      D G 
Sbjct: 22753 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGK 22812

Query: 501   YVFAPDAYNVT--LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP---- 554
             Y       + T  +   V V+D P     G     TV+ +   K  L   +  E      
Sbjct: 22813 YTLTVKNASGTKAVSVMVKVLDSP-----GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 22867

Query: 555   -----PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                   +   SR +  I+EG     T SY      V+    +++  ++ +   N+ G   
Sbjct: 22868 THYIVERRETSRLNWVIVEGE--CPTLSY------VVTRLIKNNEYIFRVRAVNKYGPGV 22919

Query: 607   --EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
               E+   +       P PP  P     G +  I+ W  P  DGG+ I  Y +++++K+S 
Sbjct: 22920 PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSL 22979

Query: 665   RWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTS 719
             RW R+N D +  +T  +   ++EG  Y+ R+ AVNA G S+PS  S  F+    P     
Sbjct: 22980 RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASN-FISCREPSYTPG 23038

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI-VANKDLIDKTKFT 778
             PP+   V   T  ++++ W  P + G   + GYVLE   + T+ W  V     I  T+FT
Sbjct: 23039 PPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFT 23098

Query: 779   ITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEA 838
             +  L    K   RV AVN  G SE       I   E IE P + +   LK+T   R G +
Sbjct: 23099 VPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGAS 23158

Query: 839   VNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVD 898
             + L++   G+P P +TW K G ++    I I  +E+ +++ + K  R  +GKY ++ +  
Sbjct: 23159 LRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSLLIVDKVNRYDAGKYTIEAENQ 23217

Query: 899   KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 958
                ++A++ +++ D PGP   VK+++V  ++V +TW  P  DG A +  Y ++K +    
Sbjct: 23218 SGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMR 23277

Query: 959   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKESAVI 1008
              + TV     +T   I+ LV G  YYFRV  EN+ G+ E     DA +  E  ++
Sbjct: 23278 AFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLV 23332



 Score =  213 bits (543), Expect = 6e-55
 Identities = 156/581 (26%), Positives = 275/581 (47%), Gaps = 32/581 (5%)

Query: 444   VNLGKEICLKCEI-SENIPGK-WTKNGLPVQESD-RLKVVHKGRIHKLVIANALTEDEGD 500
             V+ G+   L+ +I  + IP   W+K+G  ++E+  R+++    +   LV+ + +  D G 
Sbjct: 18414 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18473

Query: 501   YVFAPDAYNVT--LPAKVHVIDPP-----KIILDGLDAD------NTVTVIAGNKLRLEI 547
             Y+        T  +P  V V+D P      + + G+ A+      N      G  +   I
Sbjct: 18474 YILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYI 18533

Query: 548   PISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE 607
              I      +  W++    +   + ++ T+  P +  +   +A       Y I    E+G 
Sbjct: 18534 -IEKRETSRLSWTQVSTEVQALNYKV-TKLLPGNEYIFRVMAVNK----YGIGEPLESGP 18587

Query: 608   AHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
               A    K    P PP  P V+ +  D  ++ W  P  DGG+ I GY +E++ K+  RW 
Sbjct: 18588 VTACNPYKP---PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18644

Query: 668   RLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVD 727
             + N     +       + EG +YE R+ A NA G+ +PS PS  +       PP   +  
Sbjct: 18645 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP 18704

Query: 728   SVTDT---TVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDL-IDKTKFTITGLP 783
              VTDT   +V++ W  P + G A + GYV+E      ++W        +   +FT+T L 
Sbjct: 18705 KVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLK 18764

Query: 784   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVI 843
              + +   R+ A+N+ G  EP      ++ +E IEPP+I +   L++  + R    + L +
Sbjct: 18765 ENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFV 18824

Query: 844   PFQGKPRPELTWKK-DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
               +G+P PE+ W+K +G   D+ QI + +S   T++ I    R  SG+Y+L ++ +   +
Sbjct: 18825 TIKGRPEPEVKWEKAEGILTDRAQIEVTSS--FTMLVIDNVTRFDSGRYNLTLENNSGSK 18882

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
             TA ++++++D P  P  + I +V  ++V L+W PP  DG A IT Y ++K +     + T
Sbjct: 18883 TAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYAT 18942

Query: 963   VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             +  +  +T+  I  L  G  YYFRV + N  G+   A  T+
Sbjct: 18943 ITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTE 18983



 Score =  213 bits (542), Expect = 8e-55
 Identities = 117/390 (30%), Positives = 208/390 (53%), Gaps = 6/390 (1%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT++  +   + W  P  DGGS I GYF+E++ K+S  W ++  +  ++T  
Sbjct: 20761 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQ 20820

Query: 680   EPKKMIEGVAYEVRIFAVNAIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             +   + E   Y+ R+ AVNA G    S+PS   +   P+    PP  + +   T +++T+
Sbjct: 20821 KVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITL 20880

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGTEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAV 795
              W  P + G + + GYV+E      E+W  V+ K  +  T++ ++ L      + RV AV
Sbjct: 20881 GWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAV 20940

Query: 796   NAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW 855
             N AG  EP   ++P+  K+I+E P+I +   L+ + I + GE V ++IPF+G+P P +TW
Sbjct: 20941 NCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTW 21000

Query: 856   KKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVD-KFVETASIDIQIIDR 913
             +KD   +  + + +I N+++ +++ I +  R+ +GKY L ++      +++++ ++++D 
Sbjct: 21001 RKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDT 21060

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             P   Q ++++ V    V L W PP  DG + I  Y I+K D     W  V      TS  
Sbjct: 21061 PAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFK 21120

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             + +L     ++FRV +EN  G+ E    T+
Sbjct: 21121 LIDLSEKTPFFFRVLAENEIGIGEPCETTE 21150



 Score =  210 bits (535), Expect = 5e-54
 Identities = 144/504 (28%), Positives = 232/504 (46%), Gaps = 21/504 (4%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            +PP + LD +     + ++AG  LR+   ++G P P  +W++ +  +     R+  ++  
Sbjct: 8795 EPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL--DKDRVVIDNVG 8851

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              S L+I  A R D G Y I   N  G   A+ +V+V D P P +           C++N
Sbjct: 8852 TKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLN 8911

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W  P  DGGS I G+ IERK  +   W R   +  + +  +   ++EG  Y+ R+ A N 
Sbjct: 8912 WSDPEDDGGSEITGFIIERKDAKMHTW-RQPIE-TERSKCDITGLLEGQEYKFRVIAKNK 8969

Query: 700  IGISKPSM--PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P    P     PL   + P  LT    T +T+T+ W+ P   G + + GY++E  
Sbjct: 8970 FGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKR 9029

Query: 758  FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                 D+   NK L   T F +  L        RVKAVN  G SEP      +++++   
Sbjct: 9030 RHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPS-LPLNVVIQDDEV 9088

Query: 818  PPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-------NQINI 869
            PP I++   ++   I+ + GE V++     G P P++ W K+   I+K        +  +
Sbjct: 9089 PPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEV 9148

Query: 870  RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 929
              SE  T + I KA R   G Y +           ++ +++ DRP PP+ + + D+  E+
Sbjct: 9149 SRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAES 9208

Query: 930  VALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 987
              LTW  P D+G + IT Y I K D  +K  EW  V          I +L+   +Y FRV
Sbjct: 9209 CYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRV 9268

Query: 988  FSENMCGLSEDATMTKESAVIARD 1011
             + N  G+S++    K   V+ +D
Sbjct: 9269 RAVNKYGISDEC---KSDKVVIQD 9289



 Score =  209 bits (533), Expect = 9e-54
 Identities = 155/595 (26%), Positives = 276/595 (46%), Gaps = 28/595 (4%)

Query: 420   GQSSAKLSVDLKPLKILTPLTDQ-TVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDR 476
             G  +AK  V+L  + +     D   VN G+   L+ ++  + +P  +W +    ++ES R
Sbjct: 17307 GPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESAR 17366

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNT 534
              ++ +      L++ +A+  D G Y+      A + + P  V V+D P       +    
Sbjct: 17367 CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQ 17422

Query: 535   VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIA 589
             VT +   K  L    +  PP +   S     ++E     R       S   +++L +   
Sbjct: 17423 VTGVTSEKCSL----TWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKL 17478

Query: 590   ERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPA 644
                +  V+ I   N+   GE   S  V + +    P PP +  VT +  D   + W  P 
Sbjct: 17479 LEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPD 17538

Query: 645   YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
              DGGS I+GY +E++ +   RW++ N     +       + E   YE R+ A NA G+ +
Sbjct: 17539 SDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGE 17598

Query: 705   PSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
             PS  +   +   P+    PPT   +   T  ++T+ W  P + G + + GYV+E C    
Sbjct: 17599 PSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADE 17658

Query: 762   EDW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             E+W IV  +  +  T+F I+ L    +  +RV A+N  G  E       +  ++ +E P+
Sbjct: 17659 EEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPE 17718

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFI 880
             + +   L++  + R G +  + IPF+G+P PE+TW ++  E   +++ I      T + I
Sbjct: 17719 LDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFT-DKVQIEKGVNYTQLSI 17777

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 940
                +R+ +GKY L+++     ++A + ++++D PGPPQ + +++V  ++  L W PP  D
Sbjct: 17778 DNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIID 17837

Query: 941   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             G A +  Y I K +     +  V     +TS  +  L  G  YYFRV +EN  G+
Sbjct: 17838 GGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 17892



 Score =  207 bits (528), Expect = 3e-53
 Identities = 124/404 (30%), Positives = 206/404 (50%), Gaps = 10/404 (2%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP A  V +V      + WEPP  DGG PI  Y IE+K++  +RW++       +  F
Sbjct: 7879 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7938

Query: 680  EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTM 736
                +IEG   + ++ A N  G+  PS P+       P +  SPP  L V       + +
Sbjct: 7939 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 7998

Query: 737  RWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT-GLPTDAKIFVRVKAV 795
             W+PP+  G + + GY +E C  GTE W+  N   I   KF +  G+  D +  +RV+AV
Sbjct: 7999 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 8058

Query: 796  NAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW 855
            NA G SEP   S+ ++ K+    P I +  H     I   GE +++ +PF+  P P ++W
Sbjct: 8059 NAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSW 8115

Query: 856  KKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP 914
             KDG E+   +++ ++N      + + K+ R+ +G Y + ++      TASI++++I  P
Sbjct: 8116 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP 8175

Query: 915  GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI 974
            GP + +K  D+   +  LTW PP+ DG   I  Y +++ +     +  V+   ++ S T+
Sbjct: 8176 GPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTV 8235

Query: 975  TELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1018
             +L+   EY+FRV + N  G  E   +  ++ VIA+D K   +P
Sbjct: 8236 KDLIPNGEYFFRVKAVNKVGGGEYIEL--KNPVIAQDPKQPPDP 8277



 Score =  205 bits (522), Expect = 2e-52
 Identities = 140/501 (27%), Positives = 228/501 (45%), Gaps = 20/501 (3%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP++ LD +   + +TV  G  +R+   + G P P   W++  K ++      R + 
Sbjct: 11597 ILHPPEVELD-VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK---RVDL 11652

Query: 578   YPDSSTLVIDIAE--RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
               D   + + I E  R D G Y I+ KN +G A  S  V V+D P P     VT V  + 
Sbjct: 11653 IQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKEN 11712

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++WE P  +GGS I  + +E +K     W  +  D+ K        ++    Y  R+ 
Sbjct: 11713 CTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYFRVC 11770

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             A N +G+        P +   P+     P  L +     T V ++WR PD+ G +    Y
Sbjct: 11771 AENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSY 11830

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
              +E   +G++DW   +K  I +T + +     +     RV+  N  G S+    ++ ++V
Sbjct: 11831 HVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESD-WVKTEEVVV 11889

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ---INI 869
             KE ++ P + +   L      + G+ + L    +GKP PE+ W KD    D  +   + I
Sbjct: 11890 KEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKI 11947

Query: 870   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 929
                   +   + KA+RS  GKY +          A   + ++D+PGP + +KI DV  + 
Sbjct: 11948 DTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDR 12007

Query: 930   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 989
               + W PP+DDG   I  Y ++K + K M W T          T+T L+ GNEY FRV +
Sbjct: 12008 CTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRA 12067

Query: 990   ENMCGLSEDATMTKESAVIAR 1010
             EN  G       T+   VIA+
Sbjct: 12068 ENKIGTGPP---TESKPVIAK 12085



 Score =  204 bits (520), Expect = 3e-52
 Identities = 148/557 (26%), Positives = 258/557 (46%), Gaps = 31/557 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVI 519
             W K+G+ +++   +++        L + +A  +  G  V+  +A N +  AK    V V 
Sbjct: 21687 WFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG--VYTVEAKNASGSAKAEIKVKVQ 21744

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRL--EIPISGEPPP-------KAMWSRGDKAIMEGS 570
             D P  ++  +   N    I G K+ L  + P++    P       K   SR   A++E  
Sbjct: 21745 DTPGKVVGPIRFTN----ITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIED- 21799

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGV--YHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              +   +SY     +  +  +   S V  + +    ++    A I+  V   PD P  P  
Sbjct: 21800 -KCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTV---PDAPGIPEP 21855

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR-LNFDLCKETTFEPKKMIEG 687
             + +  +   + W  P  DGGS I  Y +ER++K+S+RW++ ++     ET F+   + EG
Sbjct: 21856 SNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEG 21915

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               YE  + A NA G+   S  SR      P+    PPT++ V   + TTV++ W  P   
Sbjct: 21916 NEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFD 21975

Query: 745   GAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
             G   + GY++E C     DW   N +   KT++T+T L    +   RV A+N AG  +  
Sbjct: 21976 GGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSC 22035

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK 864
               +  I   + +  P++ I  + KQT++ R G ++ L I +QG+P P   W K  + +  
Sbjct: 22036 EVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL 22095

Query: 865   NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIED 924
              + +I  +++ + + +    R+ +GKY L V+ +   ++ +  ++++D PGPP  +  +D
Sbjct: 22096 -RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKD 22154

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY 984
             V   +  L W  P  DG A I  Y ++K +     W  + E   R    + +L  G  YY
Sbjct: 22155 VTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYY 22214

Query: 985   FRVFSENMCGLSEDATM 1001
             FRV + N  G+ E   M
Sbjct: 22215 FRVSAVNEYGVGEPYEM 22231



 Score =  203 bits (517), Expect = 6e-52
 Identities = 137/482 (28%), Positives = 227/482 (47%), Gaps = 20/482 (4%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P  P  P V  V  +   + WE P +DGGS I+GY++E+K++ +  W++ N   C E  +
Sbjct: 22536 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 22595

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   ++EG+ Y+ R +A+NA G+SK S  SRP +       P    V  VT +TV++ W 
Sbjct: 22596 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 22655

Query: 740   PPDHIGAAGLDGYVLE---YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN 796
              P + G + + GY++E       G   W+  N  ++    FT+T L        RV A N
Sbjct: 22656 APAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKN 22715

Query: 797   AAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELT 854
             AAG  S+    + P+  ++   PPK  +   L    +  R G  + L     GKP P++ 
Sbjct: 22716 AAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKII 22775

Query: 855   WKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 913
             W K   E+D   +++++ +       I+  +RS SGKY L VK     +  S+ ++++D 
Sbjct: 22776 WTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDS 22835

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             PGP   + +  V  E   L W+ P++DG A IT Y +++ +   + W  V       S  
Sbjct: 22836 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYV 22895

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP--VYEDFDFSEAPM- 1030
             +T L+  NEY FRV + N  G        +   ++AR+     +P  + E+    +  + 
Sbjct: 22896 VTRLIKNNEYIFRVRAVNKYG---PGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHII 22952

Query: 1031  --FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFSNQGVCTLE 1087
               +T+P  +     G N   N  V    K  + W + NK  +V D R ++ S    C  +
Sbjct: 22953 IQWTKPESD-----GGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQ 23007

Query: 1088  IR 1089
              R
Sbjct: 23008 FR 23009



 Score =  200 bits (509), Expect = 5e-51
 Identities = 218/906 (24%), Positives = 364/906 (40%), Gaps = 113/906 (12%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +   V F  E+     + KW++N + I  S+KYI   K     L I +  + D + Y
Sbjct: 6345 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6404

Query: 323  YVTAGDE-----KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKN 377
             V+  +      K +  L V E  + + + L+D      + V   C+V+  +  +KW KN
Sbjct: 6405 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 6464

Query: 378  GEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILT 437
            GEE+    +  YR  V+  KH+L I+     D  EY V     +S A+L +   P + + 
Sbjct: 6465 GEEVPFDNRVSYR--VDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 6522

Query: 438  PLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTE 496
             L DQTV    +    C++S E    KW +NG  ++E  + K    G IH+L+I +   +
Sbjct: 6523 HLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLD 6582

Query: 497  DEGDYVFAPD-----AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISG 551
            DE +Y    +     A        V +I PP+ IL+   AD  V +   NK ++E+    
Sbjct: 6583 DECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD-VVFLAELNKDKVEV---- 6637

Query: 552  EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                   W R +  +++G               + DI  RD  G Y    K++  EA A 
Sbjct: 6638 ------QWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQ-GEYRFIAKDK--EARAK 6688

Query: 612  IKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF-IERKKKQSSRWMRLN 670
            +++          AP +     D  +        D G P+      +   K  + W + N
Sbjct: 6689 LELAA--------APKIKTADQDLVV--------DVGKPLTMVVPYDAYPKAEAEWFKEN 6732

Query: 671  FDL--------CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPT 722
              L         ++T+F   +  +G     +I   N  G ++  +  +    + V  P  
Sbjct: 6733 EPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV---IDVPGPVR 6789

Query: 723  LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGL 782
             L V    D  V++ W  P   G + + GYV+E      + W++A  D  +  +FT+TGL
Sbjct: 6790 NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLAT-DRAESCEFTVTGL 6848

Query: 783  PTDAKIFV-RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 841
                  ++ RV A N  G  EP     P+  +   + P                G  +N+
Sbjct: 6849 QKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP----------------GPPLNV 6892

Query: 842  VIPFQGKPRPELTWKKD----GAEIDKNQINIRNSET---DTIIFIRKAERS-------H 887
             I    +    LTW+      GAEI    I +R+  +   DT + +R  + S        
Sbjct: 6893 TITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVE 6952

Query: 888  SGKYDLQVKVDKFV-----ETASIDIQI---IDRPGPPQIVKIEDVWGENVALTWTPPKD 939
              +Y  +V+    +       A+  +++   I+RP PP  +   D    +V L W PP  
Sbjct: 6953 GQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLK 7012

Query: 940  DGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSED 998
            DG + I GY I++ ++    W    ++     +  +T L  GN+Y +RV +EN  G+S+ 
Sbjct: 7013 DGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDP 7072

Query: 999  ATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNA-TLNCSVRGNPK 1057
            + +                P+  D  F E  M      +   +   N  T+     G P+
Sbjct: 7073 SEIL--------------GPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPR 7118

Query: 1058 PKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLE 1117
            P  TW      +    R +M +      L I      D G Y  K  N + T+  E  ++
Sbjct: 7119 PTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGE--ID 7176

Query: 1118 VKVIAQ 1123
            V VIA+
Sbjct: 7177 VNVIAR 7182



 Score =  198 bits (503), Expect = 3e-50
 Identities = 173/674 (25%), Positives = 288/674 (42%), Gaps = 74/674 (10%)

Query: 373  KWFKNGEEIIP-----------GPKSRYRIRVEGKKHILIIEGATKA-------DAAEYS 414
            +W +  E ++P           G + ++R+R E    I     AT         DA +  
Sbjct: 8320 RWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI 8379

Query: 415  VMTT-----GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC---------EISENI 460
            + T+     G + +   S+   P   +T + D+ V + +EI  +          E+ E  
Sbjct: 8380 LRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEE 8439

Query: 461  PGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN--VTLPAKVHV 518
            P       LP+ +   +    KG   +L + ++L  D G Y+   +  +     P  V V
Sbjct: 8440 PFV-----LPLTQRLSIDNSKKGE-SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8493

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
            +D P   ++ +  D   T +             EPP       G   I+  +   + ++ 
Sbjct: 8494 LDTPGPPINFVFEDIRKTSVL---------CKWEPP----LDDGGSEIINYTLEKKDKTK 8540

Query: 579  PDSSTLVIDIAERD-----------DSGVYHINLKNEAGEAHASIKVKVVDF-----PDP 622
            PDS  +V+    R               ++ +  +N  G     +   +V       PD 
Sbjct: 8541 PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDA 8600

Query: 623  PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPK 682
            P  P V +V  +  ++ W  P  D GSPILGY++E+++  S+ W R+N  L         
Sbjct: 8601 PDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVD 8659

Query: 683  KMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP--PTLLTVDSVTDTTVTMRWRP 740
             ++EG+ Y  R+ A NA G  K S PS P       SP  P +  V   + TT+ + W P
Sbjct: 8660 GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEP 8719

Query: 741  PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
            P   G   + GY ++    GT +W    + +I   ++T+  +   A   +RV AVNAAG 
Sbjct: 8720 PAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGE 8779

Query: 801  SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
              P   +QP+ V E  EPP + +   +K       G+ + +     G+P P   W K+  
Sbjct: 8780 GPPG-ETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEG 8838

Query: 861  EIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV 920
            E+DK+++ I N  T + + I+ A R   G+Y +        + A+  +++ D PGP   +
Sbjct: 8839 ELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDL 8898

Query: 921  KIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIG 980
            K      +   L W+ P+DDG + ITG+ I++ D K   W   IE   R+   IT L+ G
Sbjct: 8899 KPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEG 8957

Query: 981  NEYYFRVFSENMCG 994
             EY FRV ++N  G
Sbjct: 8958 QEYKFRVIAKNKFG 8971



 Score =  192 bits (487), Expect = 2e-48
 Identities = 179/703 (25%), Positives = 312/703 (44%), Gaps = 63/703 (8%)

Query: 344   VTKQLEDTTAYCGERVELECE-VSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
             + K+++D T   GE  +L C+ V     ++KW++ G+E+I   K  Y++  +G+ H L +
Sbjct: 24230 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRK--YKMSSDGRTHTLTV 24287

Query: 403   EGATKADAAEYSVMTTGG----QSSAKLSVDLKP-LKILTPLTDQTVN-LGKEICLKCE- 455
                 + D   Y+ + T      ++S+KL +   P      PL ++    +G  + L    
Sbjct: 24288 MTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMY 24347

Query: 456   ISENIPGK-WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
             I   +P   W      +Q S+ + + +      LV+ N   +           Y V L  
Sbjct: 24348 IGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAG------KYKVQLSN 24401

Query: 515   KVHVIDPPKIILDGLDADN----TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME-- 568
                 +D    ILD    D     T  ++    L+    IS +PP     S     ++E  
Sbjct: 24402 VFGTVDA---ILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKC 24458

Query: 569   -----GSGRIRTESYPDSSTLVIDIAERDDSGVY-HINLKNEAG-----EAHASIKVKV- 616
                     ++ + +   ++  ++++ E  ++G Y  ++ +N  G     E  + + +K  
Sbjct: 24459 EAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 24516

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
              + P  P  PT+T V  D C++ W+PPA DGG+ I  Y++E+++K+ ++W+ +  +  +E
Sbjct: 24517 FEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 24576

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             T F  K +IEG+ YE R+   N  G S+ S  S P  P +          + + +  V  
Sbjct: 24577 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRY 24636

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTK-----FTITGLPTDAKIFVR 791
             +          G    ++++  +G E      K  I + K       I  +  D     +
Sbjct: 24637 QSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQ 24696

Query: 792   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV--GEAVNLVIPFQGKP 849
             V+A N  G+             E+  P KI +P+ L+         GE V++ IPF GKP
Sbjct: 24697 VRATNQGGSVSGT------ASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 24750

Query: 850   RPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 906
              P +TW+K    ID N   Q+ +  S T +++F    ER  +G Y +  K    ++  ++
Sbjct: 24751 DPVITWQKGQDLIDNNGHYQVIVTRSFT-SLVFPNGVERKDAGFYVVCAKNRFGIDQKTV 24809

Query: 907   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 966
             ++ + D P PP+ VK+ DV  ++V LTWT P  DG + IT Y ++K    +  W  V   
Sbjct: 24810 ELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRV-GQ 24868

Query: 967   YHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKE 1004
                T  T+  L     Y FRV +EN  GLS+     + T+TKE
Sbjct: 24869 ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 24911



 Score =  181 bits (460), Expect = 3e-45
 Identities = 166/686 (24%), Positives = 284/686 (41%), Gaps = 75/686 (10%)

Query: 350  DTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
            D    CGE V E + EV+  +   KW+             YR++   +      +GA+K 
Sbjct: 7327 DKWVACGEPVAETKMEVTGLEEG-KWYA------------YRVKALNR------QGASKP 7367

Query: 409  DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTK 466
                  +     Q + ++ +D+K L  LT      V  G +I L   ++     K  WTK
Sbjct: 7368 SRPTEEIQAVDTQEAPEIFLDVKLLAGLT------VKAGTKIELPATVTGKPEPKITWTK 7421

Query: 467  NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHVIDP- 521
              + +++  R+ + +  +   + I ++   D G Y+   +A NV    T   +V+V+D  
Sbjct: 7422 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII--EAVNVCGRATAVVEVNVLDKP 7479

Query: 522  -PKIILDGLDADNTVTVIAGNKLR-------LEIPISGEPPPKAMWSRGDKAIMEGSGRI 573
             P    D  D  N   ++  N  R           +        +W +    + + + + 
Sbjct: 7480 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFK- 7538

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             T+  P+   +    AE     +Y +    +A    A  +    D P PP     +++  
Sbjct: 7539 ATKLIPNKEYIFRVAAE----NMYGVGEPVQASPITAKYQ---FDPPGPPTRLEPSDITK 7591

Query: 634  DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
            D   + W  P  DGGSPI GY++ER    + +W+R N    K+TT+  K +     Y  R
Sbjct: 7592 DAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFR 7651

Query: 694  IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
            + A N  G  KPS  + P +   P+    PP   TV  V  T+V + W  P+H G A ++
Sbjct: 7652 VLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE 7711

Query: 751  GYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPI 810
             YV+E    GT++W+   +  +  T+  + GL    +   RV+AVN AG SEP   S P+
Sbjct: 7712 SYVIEMLKTGTDEWVRVAEG-VPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPV 7770

Query: 811  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP------------ELTWKKD 858
            L +E + PP    PR L+   I +    +   +P +    P               W+  
Sbjct: 7771 LCREKLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV 7828

Query: 859  GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 918
               +   +  +      ++   R A  +  G+ D        +E + +       PGPP 
Sbjct: 7829 DTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTE-----IEDSVLAKDTFTTPGPPY 7883

Query: 919  IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY-HRTSATITEL 977
             + + DV   +V L W PPK+DG   I  Y I+K ++    W    +      +  +T++
Sbjct: 7884 ALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDV 7943

Query: 978  VIGNEYYFRVFSENMCGLSEDATMTK 1003
            + G E  F+V +EN  G+   +  T+
Sbjct: 7944 IEGTEVQFQVRAENEAGVGHPSEPTE 7969



 Score =  162 bits (411), Expect = 1e-39
 Identities = 110/364 (30%), Positives = 175/364 (48%), Gaps = 16/364 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V  G    F  EL+   + V+WY  G+++ PS K +   +G    L + + ++ D  E  
Sbjct: 5902 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 5961

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
            +TA D K    LFV+EPP+  TK LED T   G    LECEVS ++A VKWFKNG EI+ 
Sbjct: 5962 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 6021

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
              K  Y I  +G+   L+I   T  D   Y+      ++S  L+V    ++ L PLTD  
Sbjct: 6022 SKK--YEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ 6079

Query: 444  VNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V   +    +CE+S EN   KW K+G  +++  +  ++ KG +  LVI   L +DE +Y 
Sbjct: 6080 VREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY- 6138

Query: 503  FAPDAYNVTLPAKVHVIDPPKII---LDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
             + +         + V++   +    L  ++   T T+    KL  E+    +P  + +W
Sbjct: 6139 -SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTI----KLVCEV---SKPGAEVIW 6190

Query: 560  SRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
             +GD+ I+E +GR    +      LVI  A  +D+G Y+  L +   +    +     +F
Sbjct: 6191 YKGDEEIIE-TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEF 6249

Query: 620  PDPP 623
               P
Sbjct: 6250 ISKP 6253



 Score =  157 bits (398), Expect = 4e-38
 Identities = 105/308 (34%), Positives = 159/308 (51%), Gaps = 19/308 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +DPP+I +D    D T+ V AG   +++  I G+P P   W +GD+ +   + R+  +S 
Sbjct: 16233 VDPPRISMDPKYKD-TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKST 16290

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV-TEVGDDWCI 637
               +++L +  A R DSG Y +  KN AGE   ++ VKV+D P PP  P V + V  + C 
Sbjct: 16291 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCT 16350

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL----CKETTFEPKKMIEGVAYEVR 693
             + W+PP  DGGS I+ Y +ER++     W  ++ ++    CK T     K++EG  Y  R
Sbjct: 16351 LAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVT-----KLLEGNEYTFR 16405

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             I AVN  G+ +P + S P V   P  V   P    V +VT  ++ + W  P   G + + 
Sbjct: 16406 IMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEIL 16464

Query: 751   GYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPI 810
             GYVLE   +    W   +K LI + +  +TGL  +     RV A NAAG SEP   S P 
Sbjct: 16465 GYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEP---SPPS 16521

Query: 811   LVKEIIEP 818
               ++  +P
Sbjct: 16522 AYQKACDP 16529



 Score =  157 bits (398), Expect = 4e-38
 Identities = 101/319 (31%), Positives = 164/319 (51%), Gaps = 7/319 (2%)

Query: 506   DAYNVTLPAKV-HVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D   + LP  +   ++PP+I +    + +TV V AG+ L+++IPISG+P PK   SR D 
Sbjct: 20152 DPRELLLPVLIKEQLEPPEIDMKNFPS-HTVYVRAGSNLKVDIPISGKPLPKVTLSR-DG 20209

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R  TE   ++ T+ +  +   D+G Y I   N +G   A I + V+D P PP 
Sbjct: 20210 VPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPT 20269

Query: 625   APTV-TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P V +++ ++   + WEPP YDGGS +  Y + +++  ++ W  ++  + + T  +  K
Sbjct: 20270 GPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVAR-TMMKVMK 20328

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  GIS    S      +P     PP+   V +VT  ++T+ W  P
Sbjct: 20329 LTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 20388

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 801
                G + + GY LE     +  W  ANK +I  T F +T +        RV A NAAG  
Sbjct: 20389 VSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVG 20448

Query: 802   EPKYYSQPILVKEIIEPPK 820
             +P + S+P+L  +  EPP+
Sbjct: 20449 KPSHPSEPVLAIDACEPPR 20467



 Score =  157 bits (397), Expect = 5e-38
 Identities = 212/890 (23%), Positives = 342/890 (38%), Gaps = 93/890 (10%)

Query: 267  GGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA 326
            G  V F+ EL   K+EV+W +N   +    K+    +G    L I + +  D  EY   A
Sbjct: 6621 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIA 6680

Query: 327  GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGP 385
             D++   +L +   P + T   +D     G+ + +         A  +WFK  E     P
Sbjct: 6681 KDKEARAKLELAAAPKIKTAD-QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENE-----P 6734

Query: 386  KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLT--DQT 443
             S   I    ++    I  A K D   Y ++       A+  ++LK + +  P+   + T
Sbjct: 6735 LSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVT 6794

Query: 444  VNLGKEICLKCEISENIPGKWTKN-GLPVQESD---RLKVVHKGRIHKLVIA-NALTEDE 498
                 E+ L  E  E +    +K  G  V+  D   +  V+   R          L +  
Sbjct: 6795 ETFDGEVSLAWE--EPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGG 6852

Query: 499  GDYVFAPDAYNVTLPAKVHVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEP 553
             +Y+F   A N     +    D P     K  + G   + T+T +     R  + ++ EP
Sbjct: 6853 VEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN----RFGVSLTWEP 6908

Query: 554  PPKAMWSRGDKAIMEGSGRIR-------TESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            P     +     ++E   +         T    D S  V D+ E  +   + +  +N  G
Sbjct: 6909 PEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYS-FRVRAQNRIG 6967

Query: 607  EAHASIK---VKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660
                S     VKV D    P PPV  T ++       + WEPP  DGGSPILGY IER +
Sbjct: 6968 VGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCE 7027

Query: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS----------------K 704
            +    W+R N  L  E T++   + +G  Y  R+ A N  G+S                +
Sbjct: 7028 EGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVE 7087

Query: 705  PSMPSRPF---VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
            P+M    F   + + V +P T+L V S      T  W   D +   G    V        
Sbjct: 7088 PTMDLSAFKDGLEVIVPNPITIL-VPSTGYPRPTATWCFGDKVLETG--DRVKMKTLSAY 7144

Query: 762  EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 821
             + +++  +  DK  +T+       K+  RVK ++  G  +    ++P   KE+      
Sbjct: 7145 AELVISPSERSDKGIYTL-------KLENRVKTIS--GEIDVNVIARPSAPKELKFGDIT 7195

Query: 822  RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR 881
            +   HL        G +       + +     TW K    +   +  + +         +
Sbjct: 7196 KDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFK 7255

Query: 882  KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
               R+  G  +    VD+ V  ++        P PP+ VK  D    ++ LTW PPK+DG
Sbjct: 7256 VCARNKCGPGE-PAYVDEPVNMSTPATV----PDPPENVKWRDRTANSIFLTWDPPKNDG 7310

Query: 942  NAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATM 1001
             + I GY +++  + S +W    E    T   +T L  G  Y +RV + N  G S+ +  
Sbjct: 7311 GSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRP 7370

Query: 1002 TKESAVIARDGKIYKNPVYEDFDFSEAP---MFTQPLVNTYAIAGYNATLNCSVRGNPKP 1058
            T+E   +               D  EAP   +  + L      AG    L  +V G P+P
Sbjct: 7371 TEEIQAV---------------DTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEP 7415

Query: 1059 KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
            KITW K  + +  D R  + +     T+ I      D GTY  +AVN  G
Sbjct: 7416 KITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG 7465



 Score =  157 bits (397), Expect = 5e-38
 Identities = 146/550 (26%), Positives = 232/550 (42%), Gaps = 42/550 (7%)

Query: 360   ELEC-EVSEDDANVKWFK----NGEEII-----------PGPKSRYRIRVEGKKHILIIE 403
             ELE   +S+D   ++W K     G+EI+              K   + R++ K+    I 
Sbjct: 24131 ELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ--FTIG 24188

Query: 404   GATKADAAEYSVMT---TGGQSSAKLSVDLKPLK-------ILTPLTDQTVNLGKEICLK 453
             G  +A   E+ V     TG     + ++ +K          I   + D T  LG+   L 
Sbjct: 24189 GLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLS 24248

Query: 454   CEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYN 509
             C+I    +P  KW + G  + +S + K+   GR H L +     EDEG Y  +   +   
Sbjct: 24249 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 24308

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             V   +K+ +   P+    G           G+ LRL +   G P P   W  G K +++ 
Sbjct: 24309 VETSSKLLLQATPQFH-PGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK-LLQN 24366

Query: 570   SGRIRTESYPDSSTLVI-DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
             S  I  E+    + LV+ ++  +  +G Y + L N  G   A + V++ D PD P  P V
Sbjct: 24367 SENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV 24426

Query: 629   TE-VGDDWCIMNWEPPAYDGGSPILGYFIER-KKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              E +  +  +++W+PPA DGGS I  Y +E+ + K+ + W  ++  +   TT     + E
Sbjct: 24427 IEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAI-SVTTCRIVNLTE 24485

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
                Y  R+ A N  GIS P   S   +   P      P   T+ +VT  +  + W+PP  
Sbjct: 24486 NAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPAS 24545

Query: 744   IGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 803
              G A +  Y LE   +    WI    + I +T F++  L    +   RVK  N  G SE 
Sbjct: 24546 DGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEW 24605

Query: 804   KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEID 863
                S+PI  K  +          L+   +R    A  LV    G P+P + W + G EI 
Sbjct: 24606 SEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNA-TLVCKVTGHPKPIVKWYRQGKEII 24664

Query: 864   KNQINIRNSE 873
              + +  R  E
Sbjct: 24665 ADGLKYRIQE 24674



 Score =  156 bits (395), Expect = 9e-38
 Identities = 103/340 (30%), Positives = 163/340 (47%), Gaps = 15/340 (4%)

Query: 491   ANALTEDEGDYVFAPDAYNVT---LPAKVHVIDPPKIILDGLDA----DNTVTVIAGNKL 543
             A  LTE + +Y F   A N      P+++ V+    ++   LD     D        +  
Sbjct: 13637 AKDLTEGK-EYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF 13695

Query: 544   RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN 603
             RL+IPI G+P P   W +G+  +   + R+  ES   ++TL++   ++ D+G Y I LKN
Sbjct: 13696 RLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKN 13754

Query: 604   EAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
              AG    +I +KVV  P  P  P    EV  +   + W PP  DGGS I  Y +E++   
Sbjct: 13755 VAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSV 13814

Query: 663   SSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             +++W+       ++TTF   ++ EG+ Y  R+ A N  G+ +  + S P V   P  V  
Sbjct: 13815 NNKWVTCA-SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPD 13872

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTI 779
              P    +  V   +V++ W  P   G + + GY LE+    +  W  ANK  I    F +
Sbjct: 13873 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKV 13932

Query: 780   TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
             TGL    +   RV A+N AG  +P   S+P++  + I+PP
Sbjct: 13933 TGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 13972



 Score =  155 bits (391), Expect = 3e-37
 Identities = 98/310 (31%), Positives = 156/310 (50%), Gaps = 8/310 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P++ L G+     V   AG+ +++EIP+ G P P   W +GD+ I++ + R+  E+   S
Sbjct: 14758 PELDLRGI-YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQ-ILKQTQRVNFETTATS 14815

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             + L I+   R DSG Y +  +N  GE    I ++V D P PP  P    EV  D+   +W
Sbjct: 14816 TILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSW 14875

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGG PI  Y +E ++  S+ W+ L   + + TT++  ++  G+ Y+ R+ A N  
Sbjct: 14876 DPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRY 14934

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+  P + S   V   P  V  PP    V +VT  ++T+ W  P   G + + GY +E  
Sbjct: 14935 GVG-PGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERK 14993

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                   W   +K L+    F  +GL        RV A N AG S+P   S+P+L  + I+
Sbjct: 14994 ERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPID 15053

Query: 818   PPKIRIPRHL 827
             PP   +P ++
Sbjct: 15054 PPGKPVPLNI 15063



 Score =  154 bits (389), Expect = 5e-37
 Identities = 103/318 (32%), Positives = 157/318 (49%), Gaps = 10/318 (3%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   +V + AK  VI P   +L      NT TV+AG  L++++P  G P P   W + D 
Sbjct: 15827 PRQLSVPVIAKDLVIPPAFKLLF-----NTFTVLAGEDLKVDVPFIGRPTPAVTWHK-DN 15880

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R+  ES  ++S L I  A R+D G Y + L N AGEA  ++ V V+D P PP 
Sbjct: 15881 VPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPT 15940

Query: 625   APT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P  + EV  D   ++W PP YDGGS I  Y +E++   ++ W  ++  + + TT +  +
Sbjct: 15941 GPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVAR-TTIKACR 15999

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  G S    S P+    P  V  PP    V   +  ++ ++W  P
Sbjct: 16000 LKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEP 16059

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 801
                G + + GY LE     +  W+  NK  I +TKF  TGL    +   RV A N  G  
Sbjct: 16060 ISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIG 16119

Query: 802   EPKYYSQPILVKEIIEPP 819
             +P   S+  + ++  +PP
Sbjct: 16120 KPSKVSECYVARDPCDPP 16137



 Score =  149 bits (375), Expect = 2e-35
 Identities = 97/304 (31%), Positives = 142/304 (46%), Gaps = 5/304 (1%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ID P   LD    D  + V AG    LE  I G+P P  +WS+  K + E + R+  +S 
Sbjct: 18397 IDAPNASLDPKYKD-VIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 18455

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCI 637
                +TLV+    R D G Y + L N  G     I VKV+D P PP  P  VT V  + C 
Sbjct: 18456 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 18515

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + W PP  DGG+ I  Y IE+++     W +++ ++ +   ++  K++ G  Y  R+ AV
Sbjct: 18516 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAV 18574

Query: 698   NAIGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             N  GI +P  S P     P     PP+   V ++T  ++ + W  P   G   ++GY+LE
Sbjct: 18575 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILE 18634

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
                +    W   NK  +   +  +TGL        RV A NAAG  EP   S      + 
Sbjct: 18635 KRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDA 18694

Query: 816   IEPP 819
             + PP
Sbjct: 18695 LYPP 18698



 Score =  146 bits (369), Expect = 9e-35
 Identities = 189/864 (21%), Positives = 334/864 (38%), Gaps = 120/864 (13%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F VEL+   + VKW+KN Q +  +     + +G    +   +  + D S+  V A     
Sbjct: 5643 FTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSS 5702

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +L V E     T +L+D T    + V L+CE+S+ DA VKWFK+G+EI P   +   I
Sbjct: 5703 EAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNA--VI 5760

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
            + +GKK +LI++ A K+D  +Y+      ++S KL ++ + +K++ PL    V   +   
Sbjct: 5761 KADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETAR 5820

Query: 452  LKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
             + EISE +I   W   G  + ++   ++  +G+IH LV+ N   +  G   F   A NV
Sbjct: 5821 FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANV 5878

Query: 511  TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
               A + V   P++I   L     VTV AG     +  +S E  P   + +G K  +E S
Sbjct: 5879 KSSAHLRV--KPRVI-GLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKK--LEPS 5933

Query: 571  GRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             ++   S     TL +   + +D+G   +  K+    A+  +K   V+F  P    TV E
Sbjct: 5934 DKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEE 5993

Query: 631  VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE------PKKM 684
                            G + +L   + R+  +  +W +   ++ K   +E       +K+
Sbjct: 5994 ----------------GATAVLECEVSRENAK-VKWFKNGTEILKSKKYEIVADGRVRKL 6036

Query: 685  I--EGVAYEVRIFAVNA--------IGISKPSMP-SRPFVPLAVTSPPTLLTVDSVTDTT 733
            +  +    +++ +  +A        + +  P +   RP   L V           ++   
Sbjct: 6037 VIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSREN 6096

Query: 734  VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 793
              ++W      GA    G   +   +G    +V NK L+D           +A+    V+
Sbjct: 6097 AKVKWFKD---GAEIKKGKKYDIISKGAVRILVINKCLLD----------DEAEYSCEVR 6143

Query: 794  AVNAAG----ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 849
                +G      E   +++ +   E+ E   I++   +                    KP
Sbjct: 6144 TARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEV-------------------SKP 6184

Query: 850  RPELTWKKDGAE-IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV---KVDKFVETAS 905
              E+ W K   E I+  +  I       I+ I+ A    +G Y+ ++   + D  V+   
Sbjct: 6185 GAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHE 6244

Query: 906  IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ-KADKKSMEWFTVI 964
            +  + I +P   +I++     GE      +  K+        + +Q K D K++E     
Sbjct: 6245 LAAEFISKPQNLEILE-----GEKAEFVCSISKE-------SFPVQWKRDDKTLE----- 6287

Query: 965  EHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFD 1024
                           G++Y      +    + +DAT+      +   G            
Sbjct: 6288 --------------SGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAA---RAAAHLT 6330

Query: 1025 FSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVC 1084
              E      PL +T          NC V      K  W +N+ AI D  +Y +     V 
Sbjct: 6331 VIEKLRIVVPLKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSKYIILQKDLVY 6389

Query: 1085 TLEIRKPSPYDGGTYCCKAVNDLG 1108
            TL IR     D   Y     N  G
Sbjct: 6390 TLRIRDAHLDDQANYNVSLTNHRG 6413



 Score =  146 bits (369), Expect = 9e-35
 Identities = 96/339 (28%), Positives = 169/339 (49%), Gaps = 21/339 (6%)

Query: 496   EDEGDYVF---APDAYNVTLPAK----VHVID---PPKIILDGLDADNTVTVIAGNKLRL 545
             E++  Y F   A  A N++ P++    V ++    PP+I L  +   + +TV AG  + L
Sbjct: 12952 EEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS-VAMKSLLTVKAGTNVCL 13010

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
             +  + G+P P   W + D  +++ +  I+     +  TL +    R DSG Y I  +N +
Sbjct: 13011 DATVFGKPMPTVSWKK-DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSS 13069

Query: 606   GEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSR 665
             G   A+IK+KV+D P PP +  + ++  D  +++WEPP  DGGS I  Y +++++     
Sbjct: 13070 GSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPN 13129

Query: 666   WMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGI-----SKPSMPSRPFVPLAVTSP 720
             W +++  +   T+   +K+IEG  Y+ RI A N  G+     ++P++   P+ P     P
Sbjct: 13130 WAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 13188

Query: 721   PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT 780
             P    + ++T   +T+ W+PP   G + + GY+LE       +W   N+  I +     T
Sbjct: 13189 P---VISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKAT 13245

Query: 781   GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
             GL    +   RV A+N AG  +P   S+    ++   PP
Sbjct: 13246 GLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP 13284



 Score =  145 bits (365), Expect = 3e-34
 Identities = 110/374 (29%), Positives = 173/374 (46%), Gaps = 19/374 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            QV +    RF  EL+    +VKW+K+G EI+   KY    KG  RIL IN C + D++EY
Sbjct: 6079 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6138

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII 382
                   + S  L V E   + TK L +      + ++L CEVS+  A V W+K  EEII
Sbjct: 6139 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 6198

Query: 383  PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 442
                 RY I  EG+K IL+I+ A   DA  Y+      ++  K+ V     + ++   + 
Sbjct: 6199 --ETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL 6256

Query: 443  TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             +  G++    C IS E+ P +W ++   ++  D+  V+  G+   LV+ +A  +D G Y
Sbjct: 6257 EILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTY 6316

Query: 502  VF----APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKA 557
            V     A  A ++T+  K+ ++ P K        D  V          E+   G    KA
Sbjct: 6317 VVMVGAARAAAHLTVIEKLRIVVPLK--------DTRVKEQQEVVFNCEVNTEG---AKA 6365

Query: 558  MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV 617
             W R ++AI + S  I  +      TL I  A  DD   Y+++L N  GE   S    +V
Sbjct: 6366 KWFRNEEAIFDSSKYIILQK-DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV 6424

Query: 618  DFPDPPVAPTVTEV 631
            +  D  +   + ++
Sbjct: 6425 EEEDLRIVEPLKDI 6438



 Score =  144 bits (362), Expect = 6e-34
 Identities = 89/302 (29%), Positives = 150/302 (49%), Gaps = 8/302 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P   L G+  +  +T  AG+   +++PISG P PK  W   +  + E + R+   +  D 
Sbjct: 22340 PTADLTGI-TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE-TDRVSITTTKDR 22397

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             +TL +  + R DSG Y + L+N AG    S+ V V+  P P   P  V+ V  + C+++W
Sbjct: 22398 TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSW 22457

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P   GG+ I  Y +E+++  ++ W  +N  + K T  +   + + + Y  R+ + N  
Sbjct: 22458 GEPKDGGGTEITNYIVEKRESGTTAWQLVNSSV-KRTQIKVTHLTKYMEYSFRVSSENRF 22516

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+SKP + S P +   P    S PT   V  V+   +++RW  P H G + + GY +E  
Sbjct: 22517 GVSKP-LESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKK 22575

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                T  W+  NK    +  + +TGL    +   R  A+NAAG S+    S+PI+ +  ++
Sbjct: 22576 ERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 22635

Query: 818   PP 819
              P
Sbjct: 22636 AP 22637



 Score =  142 bits (359), Expect = 1e-33
 Identities = 133/536 (24%), Positives = 207/536 (38%), Gaps = 70/536 (13%)

Query: 617  VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
            +D P PP  PTV +VG     +NW  P +DGG+ I  Y IE  K  +  W+R+   +   
Sbjct: 7676 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTT 7735

Query: 677  TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTT 733
                P  M EG  Y  R+ AVN  G S+PS PS P +    L   SPP  L V ++T  T
Sbjct: 7736 QHLLPGLM-EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 7794

Query: 734  VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 793
              ++W  P+  G + +  Y++E      + W   +  + D TK T+T L   +    RV 
Sbjct: 7795 ADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKD-TKCTVTPLTEGSLYVFRVA 7853

Query: 794  AVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 853
            A NA G S+       +L K+    P                G    L +    K   +L
Sbjct: 7854 AENAIGQSDYTEIEDSVLAKDTFTTP----------------GPPYALAVVDVTKRHVDL 7897

Query: 854  TW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI 910
             W   K DG    +  +  +     T    R  +   +   D   +V   +E   +  Q+
Sbjct: 7898 KWEPPKNDGGRPIQRYVIEKKERLGT----RWVKAGKTAGPDCNFRVTDVIEGTEVQFQV 7953

Query: 911  -----------------------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITG 947
                                      P PP  + + D   +++A+ W PP+ +G + I G
Sbjct: 7954 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 8013

Query: 948  YTIQKADKKSMEWFTVIEHYHRTSATITE--LVIGNEYYFRVFSENMCGLSEDATMTKES 1005
            Y ++     + +W  V     +      E  +V   EY  RV + N  G+SE + +++  
Sbjct: 8014 YHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISEN- 8072

Query: 1006 AVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKN 1065
             V+A+D         E  D                I G   ++    R  P P ++W K+
Sbjct: 8073 -VVAKDPDCKPTIDLETHDI-------------IVIEGEKLSIPVPFRAVPVPTVSWHKD 8118

Query: 1066 KVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
               +    R  M ++     LE+ K    D G Y     N LG+      + VKVI
Sbjct: 8119 GKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSA--TASINVKVI 8172



 Score =  140 bits (352), Expect = 9e-33
 Identities = 91/298 (30%), Positives = 146/298 (48%), Gaps = 7/298 (2%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PPK  LD     + VT+ AG+ L L+  + G+P PK +W++GDK  ++   ++  +    
Sbjct: 22738 PPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKE-LDLCEKVSLQYTGK 22796

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              +T VI   +R DSG Y + +KN +G    S+ VKV+D P P    TV+ V  + C + W
Sbjct: 22797 RATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAW 22856

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGG+ I  Y +ER++     W+ +  + C   ++   ++I+   Y  R+ AVN  
Sbjct: 22857 SLPQEDGGAEITHYIVERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKY 22915

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P + S P V      + SPP +          + ++W  P+  G   +  Y+++  
Sbjct: 22916 GPGVP-VESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKR 22974

Query: 758   FEGTEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKE 814
              + +  W   NKD ++  T+  +T L        RV AVNAAG SEP   S  I  +E
Sbjct: 22975 EKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCRE 23032



 Score =  139 bits (350), Expect = 2e-32
 Identities = 112/414 (27%), Positives = 188/414 (45%), Gaps = 21/414 (5%)

Query: 270  VRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDE 329
            + F V +    +  KW KNG EI+ + K     K     L I N    D ++Y   AG  
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 330  KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRY 389
              +  L+V    I   K ++D      +R   ECEVSE D  V+W K+ +E+      R 
Sbjct: 3000 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRI 3057

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
            +I+ E   H L+I     +DA +Y+V+  G  S+AKL V+ + ++I +   +  V   + 
Sbjct: 3058 KIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3117

Query: 450  ICLKCEISE-NIPGKWTKNGLPV--QESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD 506
              ++ E++E ++   W K+G+ +  Q  +R K V + RIH++ I+     D G+Y F   
Sbjct: 3118 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3177

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                ++   V+  +PP++    L     VTV +G   R    ISG P PK  W + ++ +
Sbjct: 3178 RNRSSVTLYVNAPEPPQV----LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL 3233

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG----EAHASIKVKVVDFPD- 621
              G  + +        TL++  A  +D+ VY    KN+ G     A  S++V  V  PD 
Sbjct: 3234 STGF-KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3292

Query: 622  --PPVAPTVTEVGDDWCIMNWEPPAY----DGGSPILGYFIERKKKQSSRWMRL 669
              P   P +     D      +P  +     G    + ++ + KK + SR+ R+
Sbjct: 3293 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3346



 Score =  139 bits (350), Expect = 2e-32
 Identities = 158/612 (25%), Positives = 260/612 (42%), Gaps = 77/612 (12%)

Query: 267   GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
             GG +R  V +   P  EVKW K   EIR +   I +       L ++N    D  +Y +T
Sbjct: 16652 GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFTSLVLDNVNRYDSGKYTLT 16709

Query: 326   AGDEKCSTELFVR-------EPPI--MVTKQLEDTTAYCGERVELECE-------VSEDD 369
               +   +   FV         PP+   VT+  +D+ +   E   L+         V + +
Sbjct: 16710 LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKRE 16769

Query: 370   ANVKWF--------KNG---EEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
             A  K +        KN    +++  G    +R+  E +  I        A  A+   +  
Sbjct: 16770 ATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI-----GLPAQTADPIKVAE 16824

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESD 475
               Q   K++VD         +T  +V+L     E     +I + I     K+     E  
Sbjct: 16825 VPQPPGKITVD--------DVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA 16876

Query: 476   RLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN-----------VTLPAKVHVIDPPKI 524
             R+K +      + VI N LT+ E +Y+F   A N           V + AK  VI+P   
Sbjct: 16877 RVKSL------QAVITN-LTQGE-EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP--- 16925

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTL 584
               D   A ++ +V  G  L++E+PISG P P   W++ D   ++ + RI      D +TL
Sbjct: 16926 --DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTK-DGLPLKQTTRINVTDSLDLTTL 16982

Query: 585   VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPP 643
              I    +DD G Y I + N  G+  ASI++  +D PDPP  P    +V  +   ++W PP
Sbjct: 16983 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPP 17042

Query: 644   AYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
              Y GG  I  Y ++++   ++ W  ++  + + TT +  K+  G  Y+ RIFA N  G S
Sbjct: 17043 LYTGGCQITNYIVQKRDTTTTVWDVVSATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQS 17101

Query: 704   KPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
               ++ S P V   P     PP      +++  ++ ++W  P + G + + GY LE     
Sbjct: 17102 F-ALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERN 17160

Query: 761   TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             +  W   NK +I  T+F    L    +   RV A N  G  +    S+  + ++  +PP 
Sbjct: 17161 SILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPG 17220

Query: 821   IRIPRHLKQTYI 832
                P  +K+  I
Sbjct: 17221 TPEPIMVKRNEI 17232



 Score =  138 bits (347), Expect = 3e-32
 Identities = 89/302 (29%), Positives = 146/302 (48%), Gaps = 6/302 (1%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P I+  G +  + + + +G  LR++  + G P P+  W + D   +E    +       S
Sbjct: 21650 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGS 21708

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             ++L +  A RD  GVY +  KN +G A A IKVKV D P   V P   T +  +   + W
Sbjct: 21709 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWW 21768

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             + P  DG +PI  Y IE+++     W  +  D C+  ++   K+I G  Y+ R+ AVN  
Sbjct: 21769 DAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNEYQFRVSAVNKF 21827

Query: 701   GISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
             G+ +P  S P    +   V   P +    ++T  ++T+ W  P+  G + +  Y+LE   
Sbjct: 21828 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERRE 21887

Query: 759   EGTEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
             + +  W+ V +K  I +T+F +TGL    +    V A NAAG       S+ I  +E + 
Sbjct: 21888 KKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVN 21947

Query: 818   PP 819
             PP
Sbjct: 21948 PP 21949



 Score =  136 bits (343), Expect = 1e-31
 Identities = 105/376 (27%), Positives = 169/376 (44%), Gaps = 13/376 (3%)

Query: 247  EEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQ 306
            + K+   F + L      +K     F  E ++P ++VKWYK+G E+    KY        
Sbjct: 2123 QAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKV 2182

Query: 307  RILFINNCQMTDDSEY-YVTAGDE--KCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
              L I     +D  +Y  V   DE  K + +L V    +   K+L+D         ELEC
Sbjct: 2183 HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC 2242

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS 423
             VS ++   KW+ N  E+      +Y I     +  L ++  TK D  EYS +  G +++
Sbjct: 2243 IVSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT 2300

Query: 424  AKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHK 482
             KL +  +P+ IL  L+DQ V  G  + L+ ++S E++ G W K+G  VQ SDR+ +V  
Sbjct: 2301 CKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID 2360

Query: 483  GRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNK 542
             + H L+I +   ED G+Y F   A  ++   +V V       +D +     V VI G K
Sbjct: 2361 KQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-----VDVITPLKDVNVIEGTK 2415

Query: 543  LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
              LE  +S        W   D+ I +   R++         LVI+     D G Y + + 
Sbjct: 2416 AVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2474

Query: 603  NEAGEAHASI-KVKVV 617
                  + S+ K+K++
Sbjct: 2475 RVETNCNLSVEKIKII 2490



 Score =  134 bits (338), Expect = 4e-31
 Identities = 201/832 (24%), Positives = 325/832 (39%), Gaps = 120/832 (14%)

Query: 337   VREPPIMVTKQLEDTTAY-CGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
             V  P I V  + +DT     GE   LE +VS      ++W K+G+E+     ++  I++ 
Sbjct: 15151 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL--EGTAKLEIKIA 15208

Query: 395   GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC 454
                  L+ + +T+ D+  Y++  T     AK   ++K L    P  +  + + +    KC
Sbjct: 15209 DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP-PEGPLAVTEVTSEKC 15267

Query: 455   EISENIP-----GKWTKNGLPVQESDRL---KVVHKGRIHKLVIANALTEDEGDY-VFAP 505
              +S   P      K     +  +E+ RL    V  + ++ KL +   L  +E  + V A 
Sbjct: 15268 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV 15327

Query: 506   DAYNVTLPAKVHVI---------DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             + Y V  P +   +         DPPK        +  VT I  + +   +   G P   
Sbjct: 15328 NKYGVGEPLESEPVLAVNPYGPPDPPK--------NPEVTTITKDSM---VVCWGHPDSD 15376

Query: 557   A-------MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                     +  R DKA      +   ++  D    V  + E  +   + I  +N AG   
Sbjct: 15377 GGSEIINYIVERRDKAGQRWI-KCNKKTLTDLRYKVSGLTEGHEYE-FRIMAENAAGISA 15434

Query: 607   EAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQS 663
              +  S   K  D    P PP  P V +       + W  P YDGGS I GY +E    + 
Sbjct: 15435 PSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEE 15494

Query: 664   SRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM-PSRPFVPLAVTSPP 721
               W  +      K T++    + E   Y++RI+A+N+ G+ +P++ P  P     +  P 
Sbjct: 15495 DEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPE 15554

Query: 722   TLLTVDSVTDTT----------VTMRWRPPDHIGAAGLDGYVLEYC-FEGTEDW---IVA 767
               L  D     T          V ++ RP   +  A   G  L+    E T  +   IV 
Sbjct: 15555 IELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVG 15614

Query: 768   NKDLIDKTKF--TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII--------E 817
             N +  D  K+  T+         FV V+ ++  G        Q + VKE+         +
Sbjct: 15615 NVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPP------QDLKVKEVTKTSVTLTWD 15668

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI 877
             PP +     +K  YI    E+             + +WK D  +           E  + 
Sbjct: 15669 PPLLDGGSKIKN-YIVEKRESTRKAYSTVATNCHKTSWKVDQLQ-----------EGCSY 15716

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 937
              F   AE  +         +    ETA   ++  +RP PP  + + DV   +V+L+W  P
Sbjct: 15717 YFRVLAENEYG--------IGLPAETAE-SVKASERPLPPGKITLMDVTRNSVSLSWEKP 15767

Query: 938   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             + DG + I GY ++   K S +W T       T ATIT L+ G EY FRV ++N  G+S+
Sbjct: 15768 EHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFRVSAQNEKGISD 15826

Query: 998   DATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNP 1056
                ++    VIA+D  I              P   + L NT+ + AG +  ++    G P
Sbjct: 15827 PRQLSVP--VIAKDLVI--------------PPAFKLLFNTFTVLAGEDLKVDVPFIGRP 15870

Query: 1057  KPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              P +TW K+ V +    R    S +    L I+     D G Y  K  N  G
Sbjct: 15871 TPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG 15922



 Score =  131 bits (329), Expect = 4e-30
 Identities = 135/530 (25%), Positives = 203/530 (38%), Gaps = 77/530 (14%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETT 678
             P PP  P V +       ++W  PAYDGGSPI+GY +E K+  S  W+R N     ++T 
Sbjct: 13284 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13343

Query: 679   FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPP----------TLLTVDS 728
             FE   ++E   Y+ R++AVN IG S PS       P  +  PP          TL+    
Sbjct: 13344 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13403

Query: 729   VT-DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAK 787
             VT    V ++ RPP  I                   W   N +L D+    I    TD  
Sbjct: 13404 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKS--TDFD 13443

Query: 788   IFVRVKAVNAAGASE----------PKYYSQPILVKEIIEPP-KIRIPRHLKQT------ 830
              F+R + VN   A +           K Y+  + V +   PP  + +    K +      
Sbjct: 13444 TFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWE 13503

Query: 831   --YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHS 888
                I      +N V+  Q +     +W     E  K    + N E     F R    +  
Sbjct: 13504 PPIIDGGSPIINYVV--QKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEY 13561

Query: 889   GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 948
             G  D     D         ++    PGP   +K+  V   + ++ W  P  DG + I GY
Sbjct: 13562 GIGDPGETRDA--------VKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGY 13613

Query: 949   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1008
              +    +++ +W  V++       +  +L  G EY FRV +EN  G    + +T    V+
Sbjct: 13614 VVDFLTEEN-KWQRVMKSL-SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT----VV 13667

Query: 1009  ARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVA 1068
             ARD     + V  D D    P          A    N  L   ++G P P ++W K +  
Sbjct: 13668 ARD-----DVVAPDLDLKGLPDLCY-----LAKENSNFRLKIPIKGKPAPSVSWKKGEDP 13717

Query: 1069  IVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             +  D R  + S+    TL +      D G Y     N  GT E    ++V
Sbjct: 13718 LATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKV 13767



 Score =  130 bits (328), Expect = 5e-30
 Identities = 80/234 (34%), Positives = 120/234 (51%), Gaps = 8/234 (3%)

Query: 272  FVVELADPKLE-VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            F VEL  P ++ V+W KNG  +  + KY    KG    L I NC + D+S Y    G   
Sbjct: 2680 FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2739

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S  L V    + + K+ +D TA     V  E  VS D   VKWF    EI P  K  +R
Sbjct: 2740 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK--HR 2795

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            +  E K H L+++  + +DA EY+ +   GQ   K  + ++ L I   + +  V   K  
Sbjct: 2796 LVSERKVHKLMLQNISPSDAGEYTAVV--GQLECKAKLFVETLHITKTMKNIEVPETKTA 2853

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              +CE+S  N+P  W KNG+ ++ S++ K+V +G++H+L+I N  TED  +Y F
Sbjct: 2854 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF 2907



 Score =  129 bits (324), Expect = 2e-29
 Identities = 123/461 (26%), Positives = 196/461 (42%), Gaps = 58/461 (12%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVID 520
             KWTK G  +  S R  +       +LVI  A   D G Y  V         +  KV VI 
Sbjct: 23864 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIG 23921

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP------------------PKAMWSRG 562
              P      L+ D+             + +S  PP                  PKA W   
Sbjct: 23922 SPNSPEGPLEYDDIQV--------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTI 23973

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKV- 616
             D        R+R       ++LV+   + +    + ++ +N+ G     ++   +  K  
Sbjct: 23974 DS-------RVR------GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP 24020

Query: 617   VDFPDPPV-APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
             ++ P+PP   P V +V      ++W  P  DGGS + GY+IERK+  + +W+R N     
Sbjct: 24021 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 24080

Query: 676   ETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDT 732
              T +    ++    Y+ RI A N +G+S+ S  S P V   P    S P  L + S++  
Sbjct: 24081 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 24140

Query: 733   TVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 792
             +VT++W  P+  G   + GY +EY   G   W  +NK+ I   +FTI GL    +   RV
Sbjct: 24141 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRV 24200

Query: 793   KAVNAAGASEPKYYSQPILVKEII-EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 851
              A N  G S P+  +  I  K    E P IR  + +K     ++GEA  L     G+P P
Sbjct: 24201 FAENETGLSRPRRTAMSIKTKLTSGEAPGIR--KEMKDV-TTKLGEAAQLSCQIVGRPLP 24257

Query: 852   ELTWKKDGAEIDKNQINIRNSETDT-IIFIRKAERSHSGKY 891
             ++ W + G E+ +++    +S+  T  + +   E+   G Y
Sbjct: 24258 DIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 24298



 Score =  128 bits (322), Expect = 3e-29
 Identities = 101/352 (28%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V +G    FV EL+  K+ V W+KN  ++  S   +   +G    L +    + D S+  
Sbjct: 5280 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 5339

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
                +   + +L V E     T +L D TA   + + L+CEVS+ D  VKWFK+GEEI+P
Sbjct: 5340 AQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWFKDGEEIVP 5398

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
             PK  Y I+ +G + IL I+ A   D  EY       ++ A ++V+ + +K+  PL    
Sbjct: 5399 SPK--YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVE 5456

Query: 444  VNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V +G+    + E+SE ++ G+W   G P+  S   +++  G+ H L++ N      G+  
Sbjct: 5457 VFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVS 5516

Query: 503  FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
            F   A N    A + V + P I +  L   + V V   ++ + E  +S E P    W +G
Sbjct: 5517 F--QAANAKSAANLKVKELPLIFITPL---SDVKVFEKDEAKFECEVSRE-PKTFRWLKG 5570

Query: 563  DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
             + I  G  R          ++VI  A  +D   Y      EA + H S K+
Sbjct: 5571 TQEI-TGDDRFELIKDGTKHSMVIKSAAFEDEAKYMF----EAEDKHTSGKL 5617



 Score =  127 bits (320), Expect = 5e-29
 Identities = 123/540 (22%), Positives = 217/540 (40%), Gaps = 60/540 (11%)

Query: 597   YHINLKNEAG---EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             Y +  +N AG    +  S  ++  D    P PP  P + + G     + W  P +DGG+P
Sbjct: 19750 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19809

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
             I GY +E KK   + W + +    + T +    +  G  Y  R+ +VN +G S PS  S 
Sbjct: 19810 ITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 19868

Query: 711   PFVPLAVTSPP----------TLLTVDSVTDT-TVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             P +       P          TL+     + T TV  R RP  ++  +  D  +    + 
Sbjct: 19869 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYV 19928

Query: 760   GTED----WIVANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK 813
              T D      + N +  D  K+T+T   + + A + + VK ++  G          I V+
Sbjct: 19929 DTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTN------ITVQ 19982

Query: 814   EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSE 873
             ++ +   +     L        G A       + +   +  W       ++    + N +
Sbjct: 19983 DVTKESAV-----LSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQ 20037

Query: 874   TDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALT 933
                I + R      SG+ +  V +    ET    ++I ++P PP+ + +  +  ++V+LT
Sbjct: 20038 EGAIYYFRV-----SGENEFGVGIP--AETKE-GVKITEKPSPPEKLGVTSISKDSVSLT 20089

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWF--TVIEHYHRTSATITELVIGNEYYFRVFSEN 991
             W  P+ DG + I  Y ++  +K    W    V +  H   + + E    +EY+FRVF+EN
Sbjct: 20090 WLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRE---NSEYFFRVFAEN 20146

Query: 992   MCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCS 1051
               GLS+   +            +    + E  +  E  M   P    Y  AG N  ++  
Sbjct: 20147 QAGLSDPREL------------LLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIP 20194

Query: 1052  VRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVE 1111
             + G P PK+T  ++ V +    R+         T+ +++    D G Y   A N  GT +
Sbjct: 20195 ISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTK 20254



 Score =  125 bits (315), Expect = 2e-28
 Identities = 87/266 (32%), Positives = 123/266 (46%), Gaps = 11/266 (4%)

Query: 247  EEKKSAAFAKIL--DPAYQV---DKGGRVRFVVEL---ADPKLEVKWYKNGQEIRPSTKY 298
            +E  S A  K+L  DP + V   DK    +  + L       + VKW+K+G+EI PS KY
Sbjct: 5343 KELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKY 5402

Query: 299  IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGER 358
              +  G +RIL I    + D  EY    G +K    + V    I V K L     + GE 
Sbjct: 5403 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGET 5462

Query: 359  VELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
               E E+SE D + +W   G+ +   P     I  +GKKHILI+         E S    
Sbjct: 5463 AHFEIELSEPDVHGQWKLKGQPLTASPDC--EIIEDGKKHILILHNCQLGMTGEVSFQAA 5520

Query: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
              +S+A L V   PL  +TPL+D  V    E   +CE+S E    +W K    +   DR 
Sbjct: 5521 NAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRF 5580

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVF 503
            +++  G  H +VI +A  EDE  Y+F
Sbjct: 5581 ELIKDGTKHSMVIKSAAFEDEAKYMF 5606



 Score =  123 bits (308), Expect = 1e-27
 Identities = 235/1057 (22%), Positives = 377/1057 (35%), Gaps = 113/1057 (10%)

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KG+W+    + GKHL L       S  +   + I   K +  G Y    TYK      S 
Sbjct: 2603 KGEWL----RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSA 2654

Query: 156  DLEVH--ESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWEL 213
             L+V   +   T  N+ +          +     +     +K   V +  E+  + V   
Sbjct: 2655 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV--- 2711

Query: 214  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVD--KGGRVR 271
                K + Y        I D      RL R+    +      KI+     V   +   V 
Sbjct: 2712 ----KGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVA 2767

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F V ++   + VKW+    EI+PS K+    +     L + N   +D  EY    G  +C
Sbjct: 2768 FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLEC 2827

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +LFV    + +TK +++      +    ECEVS  +    W KNG EI    K  ++I
Sbjct: 2828 KAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK--FKI 2883

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             V+GK H LII   +  D+AEY+ +    Q SA L+V   P+ I + L D  +N  ++  
Sbjct: 2884 VVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMITSMLKD--INAEEKDT 2939

Query: 452  LKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD-- 506
            +  E++ N  G   KW KNG+ ++ +D+ ++  K   H L I N    D  DY F     
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                TL  +   I+  K I D       + V+   +   E  +S EP     W + D+  
Sbjct: 3000 TSTATLYVEARHIEFRKHIKD-------IKVLEKKRAMFECEVS-EPDITVQWMKDDQE- 3050

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK---------VKVV 617
            ++ + RI+ +       L+I      D+G Y +        A   ++          K V
Sbjct: 3051 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEV 3110

Query: 618  DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET 677
               +   A    EV +D    +W    Y  G  I     ER K    R  R++     ET
Sbjct: 3111 QVIEKQRAVVEFEVNEDDVDAHW----YKDGIEINFQVQERHKYVVER--RIHRMFISET 3164

Query: 678  TFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTS--PPTLLTVDSVTDTTVT 735
                      VA   R      +   +P    +   P+ V S  P     V S       
Sbjct: 3165 RQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQP-K 3223

Query: 736  MRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAV 795
            + W   + + +    G+  ++  +G E            T   I   P DA ++   +A 
Sbjct: 3224 ISWYKEEQLLST---GFKCKFLHDGQE-----------YTLLLIEAFPEDAAVYT-CEAK 3268

Query: 796  NAAGASEPKYYSQPILVKEIIE--------PPKIRIPRHLKQTYIRRVGEAVNLVIPFQG 847
            N  G +     S  + V E++         PP I  P    Q  +   G+         G
Sbjct: 3269 NDYGVATTS-ASLSVEVPEVVSPDQEMPVYPPAIITP---LQDTVTSEGQPARFQCRVSG 3324

Query: 848  KPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVK--VDKFVETA- 904
                   + KD          +   E    + I +A     G Y       V +   TA 
Sbjct: 3325 TDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3384

Query: 905  -SIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEW-FT 962
             S+++Q +DR    + V+ E    + VA +    ++   + I+   I+     S E+   
Sbjct: 3385 LSLEVQALDRQSSGKDVR-ESAKSQAVADSSFTKEE---SKISQKEIKSFQGSSYEYEVQ 3440

Query: 963  VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYED 1022
            V E   ++S      V   +        +   LS+ A  T+ S   A++           
Sbjct: 3441 VFESVSQSSIHTAASVQDTQLC------HTASLSQIAESTELSKECAKEST--------- 3485

Query: 1023 FDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1082
                EAP     L +     G  A   C ++ +    +TW      I +  R +   N  
Sbjct: 3486 ---GEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGN 3542

Query: 1083 VCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
            +  L I      D G Y C   ND G       L V+
Sbjct: 3543 IQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVE 3579



 Score =  122 bits (306), Expect = 2e-27
 Identities = 197/849 (23%), Positives = 321/849 (37%), Gaps = 123/849 (14%)

Query: 319   DSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAY-CGERVELECEV-SEDDANVKWFK 376
             DS   +TA DE       V  P I +  +  DT     GE   LE +V  +    ++W +
Sbjct: 17304 DSTGPITAKDE-------VELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 17356

Query: 377   NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL 436
               +EI     +R  I+    K +LI++ A + D  +Y +  +    S    V++K L   
Sbjct: 17357 GDKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 17414

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKL-------- 488
              P  +  V +      KC ++ + P +    G  +       VV K    +L        
Sbjct: 17415 GP-PEGPVQVTGVTSEKCSLTWSPPLQ--DGGSDISHY----VVEKRETSRLAWTVVASE 17467

Query: 489   VIANALTEDE----GDYVF---APDAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAG 540
             V+ N+L   +     +YVF   A + Y V  P +   V+     +L G      VT IA 
Sbjct: 17468 VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAK 17527

Query: 541   NKLRLEIPISGEPPPKAMWSRGDKA--------IMEGSGRIRTESYPDSSTLVIDIAER- 591
             + + +             W+R D          I+E   R        +   + D+  R 
Sbjct: 17528 DSMTV------------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 17575

Query: 592   -----DDSGVYHINLKNEAGEAH---ASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNW 640
                  D    + ++ +N AG      A++  K  D    P PP    + +   +   + W
Sbjct: 17576 TGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 17635

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNA 699
               P YDGGS ILGY +E  K     W  +      + T FE  K+ E   Y++R+ A+N 
Sbjct: 17636 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 17695

Query: 700   IGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMR------------WRPPDHIGAA 747
             +G+ + +       P      P L  +DS     + +R             RP   I  +
Sbjct: 17696 VGLGEATSVPGTVKPEDKLEAPEL-DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWS 17754

Query: 748   GLDG-YVLEYCFEGTEDWI---VANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGAS 801
               +G +  +   E   ++    + N D  D  K+ +           FV VK ++  G  
Sbjct: 17755 REEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPP 17814

Query: 802   EPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE 861
                   Q + VKE+ +     +    +   I    +  N VI  +   R    +    ++
Sbjct: 17815 ------QNLAVKEVRKDSAFLV---WEPPIIDGGAKVKNYVIDKRESTRK--AYANVSSK 17863

Query: 862   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 921
               K    + N     I + R    +  G       V   VET    ++  + P PP  V 
Sbjct: 17864 CSKTSFKVENLTEGAIYYFRVMAENEFG-------VGVPVETVDA-VKAAEPPSPPGKVT 17915

Query: 922   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 981
             + DV   + +L W  P+ DG + + GY ++   K + +W  V E     +A +T L  G 
Sbjct: 17916 LTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAVVTGLSSGQ 17974

Query: 982   EYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1041
             EY FRV + N  G S+   +     VIA+D  I              P    P  NTY+I
Sbjct: 17975 EYQFRVKAYNEKGKSDPRVLGVP--VIAKDLTIQ-------------PSLKLPF-NTYSI 18018

Query: 1042  -AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
              AG +  +   V G P+P I+W+K+   +    R  +        L I++ +  D G Y 
Sbjct: 18019 QAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYT 18078

Query: 1101  CKAVNDLGT 1109
               A N  GT
Sbjct: 18079 VTATNSAGT 18087



 Score =  121 bits (304), Expect = 3e-27
 Identities = 185/870 (21%), Positives = 323/870 (37%), Gaps = 146/870 (16%)

Query: 313   NCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDA 370
             N     DS   +TA DE       +  P   +  + +D    + GE   LE ++  +   
Sbjct: 18380 NFSEPSDSSGAITARDE-------IDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIP 18432

Query: 371   NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSV 428
             +V W K+G+E+     +R  I+   +K  L+++   + D  +Y   +   GG  S  ++V
Sbjct: 18433 DVVWSKDGKEL-EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITV 18491

Query: 429   DLK--------PLKIL------------TPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
              +         PLK+              PL D   N+   I  K E S      WT+  
Sbjct: 18492 KVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL---SWTQVS 18548

Query: 469   LPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVHVID----- 520
               VQ  +        ++ KL+  N       +Y+F   A + Y +  P +   +      
Sbjct: 18549 TEVQALNY-------KVTKLLPGN-------EYIFRVMAVNKYGIGEPLESGPVTACNPY 18594

Query: 521   -----PPKIILDGLDADNTVTVIA------GNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
                  P    +  +  D+ V   A      G ++   I +         W++ +K  +  
Sbjct: 18595 KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI-LEKRDKEGVRWTKCNKKTLTD 18653

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE-AHASIKVKVVDF---PDPPVA 625
               R+R     +  +    +A  + +GV         GE +  S+  +  D    P PP  
Sbjct: 18654 L-RLRVTGLTEGHSYEFRVAAENAAGV---------GEPSEPSVFYRACDALYPPGPPSN 18703

Query: 626   PTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT------F 679
             P VT+       + W  P YDGG+P+ GY +E K+  +  W       C   T      F
Sbjct: 18704 PKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-----CTPPTGLQGKQF 18758

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTL-----------LTVDS 728
                K+ E   Y  RI A+N+ G+ +P+      V      PP +           L   +
Sbjct: 18759 TVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASA 18818

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYC-FEGTEDW---IVANKDLIDKTKFTIT--GL 782
                  VT++ RP   +     +G + +    E T  +   ++ N    D  ++ +T    
Sbjct: 18819 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENN 18878

Query: 783   PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 842
                   FV V+ +++  A        P+ +  I E  K  +    +   I    +  N +
Sbjct: 18879 SGSKTAFVNVRVLDSPSA--------PVNLT-IREVKKDSVTLSWEPPLIDGGAKITNYI 18929

Query: 843   IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
             +  +   R       +     K    I N +     + R      S +Y + +  +    
Sbjct: 18930 VEKRETTRKAYATITNNCT--KTTFRIENLQEGCSYYFRVLA---SNEYGIGLPAE---- 18980

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
               +  +++ + P PP  V + DV      + W  P+ DG + ITGY ++   K S +W T
Sbjct: 18981 -TTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST 19039

Query: 963   VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYED 1022
               +      ATI+ L  G EY FRV + N  G S+   +     VIARD +I        
Sbjct: 19040 CTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP--VIARDIEI-------- 19088

Query: 1023  FDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1082
                   P    P       A     ++   +G P+  + W K+   + +  R  + S++ 
Sbjct: 19089 -----KPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKT 19143

Query: 1083  VCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1112
             V +L I++ S  D GTY     N  G++ +
Sbjct: 19144 VTSLSIKEASKEDVGTYELCVSNSAGSITV 19173



 Score =  120 bits (302), Expect = 6e-27
 Identities = 142/561 (25%), Positives = 214/561 (38%), Gaps = 83/561 (14%)

Query: 597   YHINLKNEAGEAHASIKVKVVDF------PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + ++ +NE G    S   K V        P PPV P   +   +   + W+PP +DGGS 
Sbjct: 10779 FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSK 10838

Query: 651   ILGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             ILGY +E +K     W R N   + C ET ++   + +G  Y+ R+ AVNA G S P+  
Sbjct: 10839 ILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHV 10898

Query: 709   SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTE----DW 764
               P +      PP L     + D  +        HI     D   L    +G       W
Sbjct: 10899 PEPVLVKDRLEPPEL-----ILDANMARE----QHIKVG--DTLRLSAIIKGVPFPKVTW 10947

Query: 765   IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG----ASEPKYYSQPILVKEIIEPPK 820
                ++D   K +  +T  P  +K+ +R  A    G      E    S+ + VK ++   K
Sbjct: 10948 KKEDRDAPTKARIDVT--PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD-K 11004

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK---DGAEIDKNQINIRNSETD-- 875
                PR L+ + IR              K    LTWK+   DG  +  N +  R       
Sbjct: 11005 PGPPRDLEVSEIR--------------KDSCYLTWKEPLDDGGSVITNYVVERRDVASAQ 11050

Query: 876   -TIIFIRKAERSHSGKY-------------DLQVKVDKFVETASIDIQIIDR---PGPPQ 918
              + +     ++SH  K+             + Q     FVET    I+ +D    PGPP+
Sbjct: 11051 WSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPK-PIKALDPLHPPGPPK 11109

Query: 919   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 978
              +   DV    V+L W  P  DG + ITGY ++  ++ + +W    +        +T L 
Sbjct: 11110 DLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-FKTVTNLECVVTGLQ 11168

Query: 979   IGNEYYFRVFSENMCGLS-EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1037
              G  Y FRV +EN+ GL   D T+  E        K+    V  D    E  +       
Sbjct: 11169 QGKTYRFRVKAENIVGLGLPDTTIPIEC-----QEKLVPPSVELDVKLIEGLVVK----- 11218

Query: 1038  TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1097
                 AG        +RG P P   W  +   I  D  Y + ++     L I+     D G
Sbjct: 11219 ----AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTG 11274

Query: 1098  TYCCKAVNDLGTVEIECKLEV 1118
              Y     N  G+  +   L V
Sbjct: 11275 EYQITVSNAAGSKTVAVHLTV 11295



 Score =  120 bits (301), Expect = 7e-27
 Identities = 89/317 (28%), Positives = 143/317 (45%), Gaps = 11/317 (3%)

Query: 256  KILDPAYQVD--KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINN 313
            K++ P + V+  +    RF  E+++  +   W   G+ +  +     + +G    L ++N
Sbjct: 5803 KLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHN 5862

Query: 314  CQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVK 373
            C++         A + K S  L V+   I + + L+D T   GE    +CE+S +D  V+
Sbjct: 5863 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 5922

Query: 374  WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL 433
            W+  G+++ P  K     R EGK H L +      DA E  +     ++ A L V   P+
Sbjct: 5923 WYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPV 5980

Query: 434  KILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
            +   PL DQTV  G    L+CE+S EN   KW KNG  + +S + ++V  GR+ KLVI +
Sbjct: 5981 EFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 6040

Query: 493  ALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
               ED   Y    DA +      ++V+ P    L  L     + V      R E  +S E
Sbjct: 6041 CTPEDIKTYTC--DAKDFKTSCNLNVVPPHVEFLRPL---TDLQVREKEMARFECELSRE 6095

Query: 553  PPPKAMWSRGDKAIMEG 569
               K  W +    I +G
Sbjct: 6096 -NAKVKWFKDGAEIKKG 6111



 Score =  119 bits (298), Expect = 2e-26
 Identities = 113/439 (25%), Positives = 181/439 (41%), Gaps = 46/439 (10%)

Query: 596   VYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF 655
             V  INL      +  S  V  +D  DPP  P V  +  +   + W  P YDGG  + GY 
Sbjct: 13945 VMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYI 14004

Query: 656   IERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVP 714
             +E++   S  WM+ N     E  F    ++EG  YE RI A N  G IS PS  +   + 
Sbjct: 14005 VEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIIC 14064

Query: 715   LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774
                   PT++   ++ D  +T++      + A  + G  L         W  A KD+   
Sbjct: 14065 KDEYEAPTIVLDPTIKD-GLTIKAGDTIVLNAISILGKPLP-----KSSWSKAGKDIRPS 14118

Query: 775   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834
                 IT  PT + + ++      AG       + P   K            H+K T +  
Sbjct: 14119 DITQITSTPTSSMLTIKYATRKDAG-EYTITATNPFGTK----------VEHVKVTVLDV 14167

Query: 835   VGEAVNLVIPFQGKPRPELTWK---KDGAEIDKNQINIRNSETDTIIFIRKAERSHS--- 888
              G    + I      +  LTW    +DG    K+ I +   ET  +++   +E   S   
Sbjct: 14168 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYI-LEKRETSRLLWTVVSEDIQSCRH 14226

Query: 889   --------GKYDLQVKV----DKFVETASIDIQIIDR---PGPPQIVKIEDVWGENVALT 933
                      +Y  +V       K     S  ++++DR   PGPP+  ++ +V      ++
Sbjct: 14227 VATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVS 14286

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIE-HYHRTSATITELVIGNEYYFRVFSENM 992
             W  P DDG + ITGY +++ +KKS+ W   I+         +T L  G+ Y FRV +EN 
Sbjct: 14287 WKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENR 14346

Query: 993   CGL-----SEDATMTKESA 1006
              G+     + D+ + K++A
Sbjct: 14347 AGIGPPSEASDSVLMKDAA 14365



 Score =  116 bits (291), Expect = 1e-25
 Identities = 187/859 (21%), Positives = 324/859 (37%), Gaps = 143/859 (16%)

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDANVKWFKNGEEI 381
             +TA DE       V  P I +  + +DT   + GE  +++ ++  +    ++W K  +E+
Sbjct: 16227 ITARDE-------VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 16279

Query: 382   IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
                  +R  I+       L ++ A + D+  Y +          ++V++K L    P   
Sbjct: 16280 --SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 16337

Query: 442   QTVNLGKEICLKCEISENIPGKWTKNGLPVQE--SDRLKVVHKGR-----IHKLVIANAL 494
               V  G     KC ++      W     P+Q+  SD +  + + R     +  +V AN  
Sbjct: 16338 PVVISGVT-AEKCTLA------WKP---PLQDGGSDIINYIVERRETSRLVWTVVDANVQ 16387

Query: 495   TED-------EG-DYVF---APDAYNVTLPAKVH--VIDPPKIILDGLDADNTVTVIAGN 541
             T         EG +Y F   A + Y V  P +    V   P ++ D   A    TV   +
Sbjct: 16388 TLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDS 16447

Query: 542   KLRL-EIPISG------------EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDI 588
              + + E P S                    W+R  K ++ G  R+R          V  +
Sbjct: 16448 MIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLI-GELRLR----------VTGL 16496

Query: 589   AERDDSGVYHINLKNEAGEAHAS---IKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEP 642
              E  D   + ++ +N AG +  S      K  D    P PP  P V ++      ++W  
Sbjct: 16497 IENHDYE-FRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSK 16555

Query: 643   PAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIG 701
             P YDGG  I GY +E+       W          +T  E +K++E   Y  RI A+N  G
Sbjct: 16556 PIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAG 16615

Query: 702   ISKPSMPSRPFVPLAVTSPPTL-----------LTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + + +    P +       P +           +         V ++ RP   +    +D
Sbjct: 16616 VGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVD 16675

Query: 751   GYVLEYCF----EGTEDWIVANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPK 804
             G + +             ++ N +  D  K+T+T          FV V+ ++    S P 
Sbjct: 16676 GEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTP--SPPV 16733

Query: 805   YYSQPILVKEII----EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
                   + K+ +    EPP +     +K   + +                 E T K   A
Sbjct: 16734 NLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK----------------REATRKSYAA 16777

Query: 861   EID---KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
              +    KN   I   +     + R    +  G       +    +TA   I++ + P PP
Sbjct: 16778 VVTNCHKNSWKIDQLQEGCSYYFRVTAENEYG-------IGLPAQTAD-PIKVAEVPQPP 16829

Query: 918   QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               + ++DV   +V+L+WT P+ DG + I  Y ++   K S +W +         A IT L
Sbjct: 16830 GKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW-SECARVKSLQAVITNL 16888

Query: 978   VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1037
               G EY FRV + N  G S+  ++     ++A+D  I  +               +P  +
Sbjct: 16889 TQGEEYLFRVVAVNEKGRSDPRSLAVP--IVAKDLVIEPD--------------VKPAFS 16932

Query: 1038  TYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG 1096
             +Y++  G +  +   + G PKP ITW K+ + +    R  +  +  + TL I++    DG
Sbjct: 16933 SYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDG 16992

Query: 1097  GTYCCKAVNDLG--TVEIE 1113
             G Y     N +G  T  IE
Sbjct: 16993 GQYGITVANVVGQKTASIE 17011



 Score =  115 bits (287), Expect = 3e-25
 Identities = 101/370 (27%), Positives = 158/370 (42%), Gaps = 34/370 (9%)

Query: 266  KGGRVRFVVELAD-----------------PKLEVKWYKNGQEIRPSTKYIFEHKGCQRI 308
            +G  V FV EL D                   +E KWY N  E++ + KY    +  ++ 
Sbjct: 2217 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2276

Query: 309  LFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            L + +    D  EY      +K + +L ++  PI + + L D     G+ V+LE +VS +
Sbjct: 2277 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE 2336

Query: 369  DANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
                 W K+G+E+   P  R  I ++ + H+L+IE  TK DA  YS        S    V
Sbjct: 2337 SVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV 2394

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIH 486
             +  + ++TPL D  V  G +  L+C++S  +    KW  N   ++  DR++ + KG   
Sbjct: 2395 SVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ 2454

Query: 487  KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLE 546
            +LVI      DEG Y              V  I     I+ GL  D T T        +E
Sbjct: 2455 RLVINRTHASDEGPYKLIVGRVETNCNLSVEKIK----IIRGL-RDLTCTETQNVVFEVE 2509

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            +  SG      +W+  DK I + S + + E++     L +    +DD G Y       AG
Sbjct: 2510 LSHSG---IDVLWNFKDKEI-KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAG 2561

Query: 607  EAHASIKVKV 616
            E   S K+ V
Sbjct: 2562 ENMTSGKLTV 2571



 Score =  115 bits (287), Expect = 3e-25
 Identities = 182/792 (22%), Positives = 302/792 (38%), Gaps = 105/792 (13%)

Query: 373   KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKP 432
             KW  +G EI       Y +  +    +L I+   + D  EY +  +    S  ++V L  
Sbjct: 11238 KWTTDGSEI--KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11295

Query: 433   LKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESDRLK----VVHKGRI 485
             L +  P T     L    + + +  +  ++  G    N + V++ D  K    VV  G  
Sbjct: 11296 LDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYI-VEKQDTRKDTWGVVSSGSS 11354

Query: 486   H-KLVIANALTEDEGDYVFAPDAYNV---------TLPAKVHVIDPPKIILDGLDADNTV 535
               KL I +   +   +YVF   A N          T     H   PP            V
Sbjct: 11355 KTKLKIPHL--QKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP-----PGKPVV 11407

Query: 536   TVIAGNKLRLE--IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERD- 592
             T I  N   +   +P S    P   +    + +     R+      D    V  + E + 
Sbjct: 11408 TDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNT 11467

Query: 593   -DSGVYHINLKNEAGEAHASIKVKV---VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
              +  V+  NL   +  + +S  +K    +  P PP+ P + +   +   + W  P  DGG
Sbjct: 11468 YEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGG 11527

Query: 649   SPILGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM 707
             SPILGY +E +K  +++W R+N D L ++  F    +IEG  Y  RI A N +G  +P  
Sbjct: 11528 SPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRE 11587

Query: 708   PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVA 767
              +   +   +  PP +  +D      +T+R      I  A + G       E    W   
Sbjct: 11588 LAESVIAKDILHPPEV-ELDVTCRDVITVRVGQTIRI-LARVKGRP-----EPDITWTKE 11640

Query: 768   NKDLI-DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKY---------YSQPILVKEIIE 817
              K L+ +K    I  LP      V ++   A  A   KY         ++Q   +  +++
Sbjct: 11641 GKVLVREKRVDLIQDLPR-----VELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD 11695

Query: 818   PPKIRIPRHLKQTYIRRVG--------------EAVNLVIPFQGKPRPELTWKKDGAEID 863
              P     ++LK T + +                E  N ++ ++ KP  +  W    +++ 
Sbjct: 11696 RPGPC--QNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR-KPNQK-GWSIVASDVT 11751

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--IDIQIIDRPGPPQIVK 921
             K  I       +   F   AE         +V V   +ET +  + I  IDRPG P+ + 
Sbjct: 11752 KRLIKANLLANNEYYFRVCAEN--------KVGVGPTIETKTPILAINPIDRPGEPENLH 11803

Query: 922   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 981
             I D     V L W  P  DG +    Y +++  K S +W  V +   + +  + +  + N
Sbjct: 11804 IADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVEN 11863

Query: 982   EYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYA 1040
             + Y FRV ++N  G S+   +  E  V+  D               + P+    L     
Sbjct: 11864 QIYEFRVQTKNEGGESD--WVKTEEVVVKED--------------LQKPVLDLKLSGVLT 11907

Query: 1041  I-AGYNATLNCSVRGNPKPKITWMKNKVA--IVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1097
             + AG    L   VRG P P++ W K+K A  +   PR ++ +        + K    DGG
Sbjct: 11908 VKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGG 11967

Query: 1098  TYCCKAVNDLGT 1109
              Y   A N  G+
Sbjct: 11968 KYVVTATNTAGS 11979



 Score =  112 bits (280), Expect = 2e-24
 Identities = 102/419 (24%), Positives = 166/419 (39%), Gaps = 35/419 (8%)

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFT 778
             SP   L  D +   +V + WRPP   G A + GY+LE        W   +   +  T   
Sbjct: 23925 SPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGTSLV 23983

Query: 779   ITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEA 838
             + GL  + +   RV A N  G S+P    +P+  K  + PP+   P       +     +
Sbjct: 23984 VKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPE---PPSNPPEVLDVTKSS 24040

Query: 839   VNLVIPFQGKPRPELTWKKDGAEIDKNQIN----IRNSETD-TIIFIRKAERSHSGKYDL 893
             V+L      +P+ +   +  G  I++ + +    +R+++T  T             +Y  
Sbjct: 24041 VSLS---WSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQF 24097

Query: 894   QVKVDKFV---ETASIDIQII-----DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945
             ++     V   ET+     ++     D+P  P  ++I  +  ++V L W  P+ DG   I
Sbjct: 24098 RIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI 24157

Query: 946   TGYTIQKADKKSMEWF-TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKE 1004
              GY ++        W  +  E       TI  L+   EY FRVF+EN  GLS        
Sbjct: 24158 LGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMS 24217

Query: 1005  SAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK 1064
                    G              EAP   + + +     G  A L+C + G P P I W +
Sbjct: 24218 IKTKLTSG--------------EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR 24263

Query: 1065  NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
                 ++   +Y+M S+    TL +      D G Y C A N++G VE   KL ++   Q
Sbjct: 24264 FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQ 24322



 Score =  111 bits (277), Expect = 4e-24
 Identities = 171/794 (21%), Positives = 305/794 (38%), Gaps = 96/794 (12%)

Query: 356   GERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHI--LIIEGATKADAAE 412
             G  V+L   +S   A  ++W+K+ +E+    ++   + VE    +  ++I+ A + ++  
Sbjct: 20582 GTSVKLRAGISGKPAPTIEWYKDDKEL----QTNALVCVENTTDLASILIKDADRLNSGC 20637

Query: 413   YSVMTTGGQSSAKLSVDL----KPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
             Y +       SA  ++ +    KP     P+  +TV   K   L    +++   K T   
Sbjct: 20638 YELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYI 20697

Query: 469   LPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH-VIDPPK 523
             +  +E+ R+   +    + + +I         +Y+F   A + Y +  P +   V+    
Sbjct: 20698 VEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNA 20757

Query: 524   IILDGLDADNTVTVIAGNKLRL----EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
              +  G      VT I  N + +     I   G         + DK  + G  ++  E+  
Sbjct: 20758 FVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSL-GWFKVLKETIR 20816

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGE---AHASIKVKVVDFPDPPVAPTVTEVGDDW- 635
             D+   V  + E  D   Y +   N AG+   +  S   K  D  DPP  P    + D   
Sbjct: 20817 DTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 20875

Query: 636   --CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETTFEPKKMIEGVAYEV 692
                 + W  P YDGGS + GY +E ++ +   W  ++     + T +    +  GV Y  
Sbjct: 20876 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 20935

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R+ AVN  G  +P   + P     +   P +       D  V +R      I  AG D  
Sbjct: 20936 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEI-------DLDVALR---TSVIAKAGEDVQ 20985

Query: 753   VLEYCFEG----TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN-----------A 797
             VL   F+G    T  W    K+L    +++I    TD+   + +  V             
Sbjct: 20986 VL-IPFKGRPPPTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQVTRNDTGKYILTIE 21042

Query: 798   AGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTYIRRVGE---------AVNLVIPF 845
              G  EPK  S  + VK +  P    K+++ +H+ +  +  + +          +N VI  
Sbjct: 21043 NGVGEPK--SSTVSVKVLDTPAACQKLQV-KHVSRGTVTLLWDPPLIDGGSPIINYVI-- 21097

Query: 846   QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 905
             + +   + TW     +       + +    T  F R    +  G       + +  ET  
Sbjct: 21098 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIG-------IGEPCETTE 21150

Query: 906   IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 965
               ++  + P P + + ++D    +V L+WT P  DG + IT Y +++  K    W +   
Sbjct: 21151 -PVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW-SHAG 21208

Query: 966   HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDF 1025
                     +++L   +   FRVF++N  GLS+  T+          G I    V E    
Sbjct: 21209 ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI----------GPI---TVKELIIT 21255

Query: 1026  SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCT 1085
              E  +   P        G+N  L    +G PKP I+W+K+ + + +    R    +   T
Sbjct: 21256 PEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT 21315

Query: 1086  LEIRKPSPYDGGTY 1099
             L I+      GG Y
Sbjct: 21316 LSIKNAKKEHGGKY 21329



 Score =  110 bits (276), Expect = 6e-24
 Identities = 178/826 (21%), Positives = 314/826 (38%), Gaps = 118/826 (14%)

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
             T   G  + L+  V  + +  + W K  +E+    K    ++  GK+   +I+   ++D+
Sbjct: 22753 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK--VSLQYTGKRATAVIKFCDRSDS 22810

Query: 411   AEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIP-----GKWT 465
              +Y++       +  +SV +K L    P    TV+   +   KC ++ ++P      + T
Sbjct: 22811 GKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQE--KCTLAWSLPQEDGGAEIT 22868

Query: 466   KNGLPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH---- 517
                +  +E+ RL  V+ +G    L           +Y+F   A + Y   +P +      
Sbjct: 22869 HYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA 22928

Query: 518   ----VIDPPKIILDGLDADNTVTVI--------AGNKLRLEIPISGEPPPKAMWSRGDKA 565
                  I  P  I + +       +I         GN++   + +         W+R +K 
Sbjct: 22929 RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYL-VDKREKKSLRWTRVNKD 22987

Query: 566   IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF-PDPPV 624
              +    R++  S  +       +   + +G       +E  EA   I  +   + P PP 
Sbjct: 22988 YVVYDTRLKVTSLMEGCDYQFRVTAVNAAG------NSEPSEASNFISCREPSYTPGPPS 23041

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC-KETTFEPKK 683
             AP V +       + W  P YDGG+ I+GY +E ++K + +W R++ +   + T F    
Sbjct: 23042 APRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPD 23101

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTT---------- 733
             +  G  Y  R+ AVN  G+S+ S       P+     P L   D +  T           
Sbjct: 23102 LKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRL 23161

Query: 734   -VTMRWRPPDHI--GAAGLDGYVLEYCFEGTEDW---IVANKDLIDKTKFTITGLPTDAK 787
              V++  RPP  I     G+D        + TE +   IV   +  D  K+TI        
Sbjct: 23162 MVSVSGRPPPVITWSKQGID-LASRAIIDTTESYSLLIVDKVNRYDAGKYTI-------- 23212

Query: 788   IFVRVKAVNAAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTY-----IRRV--GE 837
                  +A N +G       S  +LVK    P   P +++    + +      I  +  G 
Sbjct: 23213 -----EAENQSGKK-----SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23262

Query: 838   AVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKV 897
              VN  I  + +      +K    +  K    I      T+ + R    +  G       +
Sbjct: 23263 PVNNYI-VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYG-------I 23314

Query: 898   DKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKS 957
              +  ET+   + + + P  P  +++ DV    V L W  P  DG + +TGY ++     +
Sbjct: 23315 GEPCETSDA-VLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGT 23373

Query: 958   MEWF-------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIAR 1010
               W        TV+EH      T+T L  G +Y FR+ ++N  G+SE       +AV  +
Sbjct: 23374 ERWMKVVTLKPTVLEH------TVTSLNEGEQYLFRIRAQNEKGVSEPRETV--TAVTVQ 23425

Query: 1011  DGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
             D ++         D S     T P    +  AG    L   + G P P  +W      + 
Sbjct: 23426 DLRVLPT-----IDLS-----TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR 23475

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
             +  R  + ++  V  L IR+ +  D G Y  +  N  GT     K+
Sbjct: 23476 ESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKV 23521



 Score =  110 bits (275), Expect = 7e-24
 Identities = 108/438 (24%), Positives = 170/438 (38%), Gaps = 62/438 (14%)

Query: 702   ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
             + KP +P+ P            +  D VT   +T++W PP   G + +  Y+LE      
Sbjct: 13768 VGKPGIPTGP------------IKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVN 13815

Query: 762   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-----SEPKYYSQPILVKEII 816
               W+      + KT F +T L    +   RV A N  G      SEP     P  V +  
Sbjct: 13816 NKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAP 13874

Query: 817   EPPKIRIPRH----LKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
              PP I   RH    L  T  ++ G +       + K R  L WK+     +K  I +R+ 
Sbjct: 13875 PPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKR----ANKTPIRMRDF 13930

Query: 873   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------IDIQIIDRPGPPQIVKIED 924
             +   +        +   +Y+ +V                  + +  ID PG P+++ I  
Sbjct: 13931 KVTGL--------TEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITR 13982

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE-HYHRTSATITELVIGNEY 983
                 +V L WT PK DG   +TGY ++K D  S  W      +    + T+T+LV G +Y
Sbjct: 13983 ---NSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKY 14039

Query: 984   YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-- 1041
              FR+ ++N  G     + + E+ +I +D            ++    +   P +       
Sbjct: 14040 EFRIRAKNTAGAISAPSESTET-IICKD------------EYEAPTIVLDPTIKDGLTIK 14086

Query: 1042  AGYNATLNC-SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
             AG    LN  S+ G P PK +W K    I      ++ S      L I+  +  D G Y 
Sbjct: 14087 AGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYT 14146

Query: 1101  CKAVNDLGTVEIECKLEV 1118
               A N  GT     K+ V
Sbjct: 14147 ITATNPFGTKVEHVKVTV 14164



 Score =  109 bits (273), Expect = 1e-23
 Identities = 118/440 (26%), Positives = 185/440 (42%), Gaps = 69/440 (15%)

Query: 597   YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
             Y +N    +  + AS  +   +  D P  P VT+V      + W  PAYDGGS ++GY I
Sbjct: 22611 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYII 22670

Query: 657   ERK---KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPF 712
             ERK   +    RW++ N+ +  +  F    + EG  YE R+ A NA G ISK S  + P 
Sbjct: 22671 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 22730

Query: 713   VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTED----WIVAN 768
                   +PP       +    VT+R         AG D  VL+    G  +    W   +
Sbjct: 22731 TCRDEYAPPKAELDARLHGDLVTIR---------AGSD-LVLDAAVGGKPEPKIIWTKGD 22780

Query: 769   K--DLIDKTKFTITGLPTDAKIFVRVKA------VNAAGASEPKYYSQPILVKEIIEPPK 820
             K  DL +K     TG    A I    ++      +    AS  K  S  ++VK +  P  
Sbjct: 22781 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVS--VMVKVLDSP-- 22836

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW----KKDGAEI--------DKNQIN 868
                            G    L +    + +  L W    +  GAEI        + +++N
Sbjct: 22837 ---------------GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLN 22881

Query: 869   --IRNSETDTIIFIRKAERSHSGKYDLQVK-VDKFVETASIDIQ-IIDR-----PGPPQI 919
               I   E  T+ ++       + +Y  +V+ V+K+     ++ + I+ R     P PP I
Sbjct: 22882 WVIVEGECPTLSYV-VTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGI 22940

Query: 920   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY--HRTSATITEL 977
              +      E++ + WT P+ DG   I+ Y + K +KKS+ W  V + Y  + T   +T L
Sbjct: 22941 PEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSL 23000

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + G +Y FRV + N  G SE
Sbjct: 23001 MEGCDYQFRVTAVNAAGNSE 23020



 Score =  107 bits (268), Expect = 5e-23
 Identities = 123/468 (26%), Positives = 198/468 (42%), Gaps = 56/468 (11%)

Query: 196  RREVKQQEEE---PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA 252
            R + K++ EE     +   EL    K   YE++  +        +L   K +  EEKK+ 
Sbjct: 1952 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRK----TKDELLHWTKELTEEEKKAL 2007

Query: 253  AF-AKILDPAYQVDK-----------------------GGRVRFVVELAD-PKLEVKWYK 287
            A   KI  P ++ DK                       G    F V +   P  E +WYK
Sbjct: 2008 AEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYK 2067

Query: 288  NGQEIRPSTK---YIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTELFVREP 340
            NG +I  S +   Y  E   C+  L I +    D +   V     AG+      L V+  
Sbjct: 2068 NGVKIERSDRIYWYWPEDNVCE--LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2125

Query: 341  PIMV-TKQLEDTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             ++  T++L+D  A   + +   ECE SE    VKW+K+G E+  G K  YR+  + K H
Sbjct: 2126 QLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK--YRMHSDRKVH 2183

Query: 399  ILIIEGATKADAAEYS---VMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
             L I     +DA +YS   V     +++AKL V+   ++ +  L D  V       L+C 
Sbjct: 2184 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S ENI GKW  N + ++ + +  +  +     L + +   ED+G+Y F  D    T   
Sbjct: 2244 VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT--C 2301

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR 574
            K+ +   P  IL GL       V  G+ ++LE+ +S E   + +W + D   ++ S R+ 
Sbjct: 2302 KLKMKPRPIAILQGLSDQK---VCEGDIVQLEVKVSLE-SVEGVWMK-DGQEVQPSDRVH 2356

Query: 575  TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                  S  L+I+   ++D+G Y   +          + V  VD   P
Sbjct: 2357 IVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITP 2404



 Score =  106 bits (265), Expect = 1e-22
 Identities = 127/538 (23%), Positives = 203/538 (37%), Gaps = 68/538 (12%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP  P V +       + W+PPA DGGSPI GY +E +++ ++ W R+N      TT 
Sbjct: 9400 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 9459

Query: 680  E--PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTV--- 734
            E     + E   Y  R+ AVN  G S+PS  +       +   P +       D  V   
Sbjct: 9460 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKA 9519

Query: 735  --------TMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDA 786
                     ++ RP     +   DG   +   +G  D I  +  L      ++  +P   
Sbjct: 9520 GSQIRIPAVIKGRPTPK-SSWEFDGKAKKAMKDGVHD-IPEDAQLETAENSSVIIIPECK 9577

Query: 787  KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP-- 844
            +      ++ A   +  K  +  + V ++  PPK      LK + I R    ++  +P  
Sbjct: 9578 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDD 9632

Query: 845  ----------FQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR-KAERSHSGKYDL 893
                       + +      W K   +       + +  ++   F R +AE     ++ +
Sbjct: 9633 DGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAEN----RFGI 9688

Query: 894  QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ-- 951
               V+    T + D   I  P PP  +KI  +    V L+W PPK+DG + +T Y ++  
Sbjct: 9689 GPPVETIQRTTARDP--IYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECL 9746

Query: 952  ---KADKKSMEWFTVIEH-YHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAV 1007
                   K   W    +        T+ +LV G EY FRV + N  G+S+ +        
Sbjct: 9747 AWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDC 9806

Query: 1008 IARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK--- 1064
               D      P  +  +F E               G N  +   ++G P P +TW K   
Sbjct: 9807 QRPD----MPPSIDLKEFMEVE------------EGTNVNIVAKIKGVPFPTLTWFKAPP 9850

Query: 1065 ----NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                NK  ++ D           CTL I +    D G Y   AVN+LGT   E +L V
Sbjct: 9851 KKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9908



 Score =  105 bits (263), Expect = 2e-22
 Identities = 101/375 (26%), Positives = 158/375 (42%), Gaps = 21/375 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +G  V+  V+++   +E  W K+GQE++PS +          +L I +    D   Y
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDD-ANVKWFKNGEEI 381
              T      ST   V    + V   L+D     G +  LEC+VS  D  +VKW+ N E+I
Sbjct: 2380 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2439

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
               P  R +  V+G K  L+I     +D   Y ++    +++  LSV+   +KI+  L D
Sbjct: 2440 --KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRD 2495

Query: 442  QTVNLGKEICLKCEISEN-IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T    + +  + E+S + I   W      ++ S + K+   G+I+KL + N + +DEG 
Sbjct: 2496 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2555

Query: 501  YVF--APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAM 558
            Y F    +  +  L      I  P         D TV          E+     P  K  
Sbjct: 2556 YTFYAGENMTSGKLTVAGGAISKPL-------TDQTVAESQEAVFECEV---ANPDSKGE 2605

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            W R  K  +  +  IR+ES      L+I   + DD G Y    K    +  A +KV+ V 
Sbjct: 2606 WLRDGKH-LPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVK 2662

Query: 619  FPDPPVAPTVTEVGD 633
                    TVTE  D
Sbjct: 2663 IKKTLKNLTVTETQD 2677



 Score =  102 bits (255), Expect = 2e-21
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 15/389 (3%)

Query: 248  EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK-GCQ 306
            E+    F K L+    V KG  +    EL + + +V W K+G+ +      I     G  
Sbjct: 4903 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 4961

Query: 307  RILFINNCQMTDDSEYYVT---AGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELE 362
            R L IN+   TD   Y VT   A + +CS+ + V E     + K + D            
Sbjct: 4962 RALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFA 5021

Query: 363  CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQS 422
            C++++D  N+KWFK  +EI   P  +  I  +G    L I+ A   D AEY+V   G + 
Sbjct: 5022 CDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRY 5081

Query: 423  SAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVH 481
             AKL++  + +++L P+ D T+   +      EISE +IPG+W   G  ++ S   ++  
Sbjct: 5082 PAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKA 5141

Query: 482  KGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGN 541
            +G    L +     +  G+ ++   A N    A   ++   +I LD       VTV    
Sbjct: 5142 EGGKRFLTLHKVKLDQAGEVLY--QALNAITTA---ILTVKEIELDFAVPLKDVTVPERR 5196

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINL 601
            + R E  ++ E     +WS+G   I++ S +    +      LVI+ ++ DD GVY   +
Sbjct: 5197 QARFECVLTRE--ANVIWSKGPD-IIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEV 5253

Query: 602  KNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
            + +   A   +    + F  P    TV E
Sbjct: 5254 EGKKTSARLFVTGIRLKFMSPLEDQTVKE 5282



 Score =  102 bits (254), Expect = 2e-21
 Identities = 85/281 (30%), Positives = 121/281 (43%), Gaps = 16/281 (5%)

Query: 283  VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
            V W K    I+ S K+     G + IL IN+ Q  D+  Y      +K S  LFV    +
Sbjct: 5210 VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRL 5269

Query: 343  MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                 LED T   GE     CE+S +  +V WFKN  ++         I  EGK H L +
Sbjct: 5270 KFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL--HTSRTVLISSEGKTHKLEM 5327

Query: 403  EGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG 462
            +  T  D ++         S+A+L V          L D+T     EI LKCE+S+++P 
Sbjct: 5328 KEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPV 5387

Query: 463  KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV----FAPDAYNVTLPAKVHV 518
            KW K+G  +  S +  +   G    L I  A  +D+G+YV          NVT+ A++  
Sbjct: 5388 KWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIK 5447

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
            ++ P   L G      V V  G     EI +S EP     W
Sbjct: 5448 VEKP---LYG------VEVFVGETAHFEIELS-EPDVHGQW 5478



 Score =  102 bits (254), Expect = 2e-21
 Identities = 174/746 (23%), Positives = 285/746 (38%), Gaps = 121/746 (16%)

Query: 340   PPIMVTKQLEDTTAYCGERVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             P I++ +Q+   T   G+++ +E  V  +     KW K  +E++    S   +       
Sbjct: 12595 PKILMPEQI---TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTS--SHLAVHKADSSS 12649

Query: 399   ILIIEGATKADAAEYSVMT--TGGQSSAKLSV--------------------DLKPLKIL 436
             ILII+  T+ D+  YS+    + G  + K+ V                    D   L   
Sbjct: 12650 ILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWH 12709

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKW-TKNGLPVQESDRLKVVHKGRIH--------K 487
              PL D   N+   I  KC++S    G W T      + S R+  +  G+ +        +
Sbjct: 12710 IPLEDGGSNITNYIVEKCDVSR---GDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENR 12766

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL--DGLDADNTVTVIAGNKLRL 545
               I+  LT  +    F     +    A+V  ++   I +  D  D+D    +I       
Sbjct: 12767 FGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG------ 12820

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
                I  +     +W + +  +      +R+  YP +   +++  E      + I   N+A
Sbjct: 12821 -YLIERKERNSLLWVKANDTL------VRSTEYPCAG--LVEGLEYS----FRIYALNKA 12867

Query: 606   GEAHASIKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
             G +  S   + V      DPP  P V +V      + W  P +DGGS I+GYF+E  K  
Sbjct: 12868 GSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLP 12927

Query: 663   SSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
               +W+R N       +  +    + E   Y+ R  A  A+ IS PS PS P   LA   P
Sbjct: 12928 GDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVP 12987

Query: 721   P---------TLLTVDSVT----DTTV------TMRWRPPDHI--GAAGLDGYVLEYCFE 759
             P         +LLTV + T    D TV      T+ W+    +   A G+    ++    
Sbjct: 12988 PRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIK-MAMQRNLC 13046

Query: 760   GTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP----KYYSQPILVKEI 815
               E + V  KD  D T  T           +++K ++  G        K YS   ++   
Sbjct: 13047 TLELFSVNRKDSGDYT-ITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSW- 13104

Query: 816   IEPPKIRIPRHLKQTYIRRVG-EAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSET 874
              EPP            +   G E  N ++  +   RP   W +  A +     ++     
Sbjct: 13105 -EPP------------LEDGGSEITNYIVDKRETSRPN--WAQVSATVPITSCSVEKLIE 13149

Query: 875   DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTW 934
                   R    +  G  D       F E A I     D PG      I ++  +++ ++W
Sbjct: 13150 GHEYQFRICAENKYGVGD-----PVFTEPA-IAKNPYDPPGRCDPPVISNITKDHMTVSW 13203

Query: 935   TPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI--TELVIGNEYYFRVFSENM 992
              PP DDG + ITGY ++K + +++ W T +        T+  T L  G EY FRV + N 
Sbjct: 13204 KPPADDGGSPITGYLLEKRETQAVNW-TKVNRKPIIERTLKATGLQEGTEYEFRVTAINK 13262

Query: 993   CGLSEDATMTKESAVIARDGKIYKNP 1018
              G  + +  +K  A  ARD +    P
Sbjct: 13263 AGPGKPSDASK--AAYARDPQYPPGP 13286



 Score =  101 bits (251), Expect = 5e-21
 Identities = 123/553 (22%), Positives = 204/553 (36%), Gaps = 63/553 (11%)

Query: 597   YHINLKNEAGEAHASIKVKVV---DFPDPPVAPTVTEVGDDW---CIMNWEPPAYDGGSP 650
             + +  +NE G    S+  + V   D  +PP  PT   V D       + W  P YDGG+P
Sbjct: 12163 FRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 12222

Query: 651   ILGYFIERKKKQSSR-----WMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             I+GY +E + K +       W R N         F    + E   YE R+ A N +GI +
Sbjct: 12223 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 12282

Query: 705   PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVT-----------MRWRPPDHIG--AAGLDG 751
             P+       P  +  PP +    S+    +            +R RP   +     G+D 
Sbjct: 12283 PAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDN 12342

Query: 752   YVLEYCFEGTEDW---IVANKDLIDKTKFTITGL-PTDAK-IFVRVKAVNAAGASEPKYY 806
              V +   +  +     ++ N    D  K+++T + P   K +FV V+ ++  G       
Sbjct: 12343 VVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPG------- 12395

Query: 807   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ 866
               P+   ++ +  K     H+        G +       + +     TW     E+ K  
Sbjct: 12396 --PVSDLKVSDVTKTSC--HVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTS 12451

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
              ++ N       + R    +  G       V   V    +    +  P PP+ +++ ++ 
Sbjct: 12452 FHVTNLVPGNEYYFRVTAVNEYGP-----GVPTDVPKPVLASDPLSEPDPPRKLEVTEMT 12506

Query: 927   GENVALTWTPPKDDGNAAITGY-TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYF 985
               +  L W PP  DG A I GY T  + +++  + +T        S  +T L  G +Y F
Sbjct: 12507 KNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKF 12566

Query: 986   RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1045
             RV + N  G+S           + R+ +     VYE  +    P    P   T   AG  
Sbjct: 12567 RVAARNAVGVS-----------LPREAE----GVYEAKEQLLPPKILMPEQITIK-AGKK 12610

Query: 1046  ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVN 1105
               +   V G P P   W K +  +V      +        L I+  +  D G Y   A N
Sbjct: 12611 LRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAEN 12670

Query: 1106  DLGTVEIECKLEV 1118
               GT   + K+ V
Sbjct: 12671 SSGTDTQKIKVVV 12683



 Score =  100 bits (249), Expect = 8e-21
 Identities = 93/398 (23%), Positives = 157/398 (39%), Gaps = 40/398 (10%)

Query: 728   SVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAK 787
             +VT   +T+ WRPP   G A +  Y++E        W + ++ L ++   T T +    +
Sbjct: 20672 TVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL-EECIITTTKIIKGNE 20730

Query: 788   IFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT-------YIRRVGEAVN 840
                RV+AVN  G  EP      +     + P    IP   K T       + R + +  +
Sbjct: 20731 YIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGS 20790

Query: 841   LVIPF--QGKPRPELTW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 895
              +  +  + + +  L W    K+     + ++      +D    +     +  G +    
Sbjct: 20791 DISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFS--- 20847

Query: 896   KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
             +  +F + A      ID PGPP  ++I D    ++ L W+ P  DG +A+TGY ++    
Sbjct: 20848 EPSEFYKAADP----IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQG 20903

Query: 956   KSMEWFTVIE--HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1013
             +  EW TV        T   ++ L  G  YYFRV + N  G  E   M            
Sbjct: 20904 EEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEM------------ 20951

Query: 1014  IYKNPVYEDFDFSEAPMFTQPLV---NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
                N   +  D  EAP     +    +  A AG +  +    +G P P +TW K++  + 
Sbjct: 20952 ---NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLG 21008

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              D RY + +      L I + +  D G Y     N +G
Sbjct: 21009 SDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVG 21046



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 93/361 (25%), Positives = 149/361 (41%), Gaps = 12/361 (3%)

Query: 271  RFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            +F  E++      +W K  QEI    ++     G +  + I +    D+++Y   A D+ 
Sbjct: 5553 KFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH 5612

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S +L +    +     L+D TA   E      E+S D+  VKWFKN + +         
Sbjct: 5613 TSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL--HTTRSVS 5670

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            ++ EGK H +  +  +  D ++  V   G  S AKL+V          L D T     E+
Sbjct: 5671 MQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV 5730

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN 509
             L+CEIS+ + P KW K+G  ++ S    +   G+   L++  AL  D G Y    D   
Sbjct: 5731 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC--DCGT 5788

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS-RGDKAIME 568
                 K+ + D    ++  L   ++V V+     R E  IS E    A W  +G+  +  
Sbjct: 5789 DKTSGKLDIEDREIKLVRPL---HSVEVMETETARFETEIS-EDDIHANWKLKGEALLQT 5844

Query: 569  GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
                I+ E    S  LV+     D +G       N    AH  +K +V+    P    TV
Sbjct: 5845 PDCEIKEEGKIHS--LVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 5902

Query: 629  T 629
            T
Sbjct: 5903 T 5903



 Score = 95.5 bits (236), Expect = 2e-19
 Identities = 111/492 (22%), Positives = 196/492 (39%), Gaps = 52/492 (10%)

Query: 648   GSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             G P+    + R        MR N ++  E  T   K+ +   A    I A N+ G +K  
Sbjct: 20197 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 20256

Query: 707   MPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
             +     V L    PPT  + +  +T+ +VT++W PP + G + +  Y+L      T  W 
Sbjct: 20257 IN---IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWT 20313

Query: 766   VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK---EIIEPPKIR 822
               +   + +T   +  L T  +   R+KA N  G S+    S  + VK       PP   
Sbjct: 20314 EVSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISD-HIDSACVTVKLPYTTPGPPSTP 20371

Query: 823   IPRHLKQTYI-----RRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETD 875
                ++ +  I       V    + V+ +  + K R  + W+K       N++ IR +   
Sbjct: 20372 WVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK------ANKLVIRTTH-- 20423

Query: 876   TIIFIRKAERSHSGKYDLQVKVDKFVETA-----SIDIQIIDRPGPPQIVKIEDVWGENV 930
                  +    S    Y+ +V  +           S  +  ID   PP+ V+I D+   +V
Sbjct: 20424 ----FKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSV 20479

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFS 989
             +L+W  P  DG + ITGY +++ D     W      +   T   I+ L   ++Y FRVF+
Sbjct: 20480 SLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFA 20539

Query: 990   ENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI---AGYNA 1046
              N  G     +++  S V+         P+    D    P+   PL  T  +   AG + 
Sbjct: 20540 RNAVG-----SISNPSEVVG--------PI-TCIDSYGGPVIDLPLEYTEVVKYRAGTSV 20585

Query: 1047  TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1106
              L   + G P P I W K+   +  +    + +   + ++ I+     + G Y  K  N 
Sbjct: 20586 KLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNA 20645

Query: 1107  LGTVEIECKLEV 1118
             +G+     ++++
Sbjct: 20646 MGSASATIRVQI 20657



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 105/462 (22%), Positives = 179/462 (38%), Gaps = 52/462 (11%)

Query: 672   DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTD 731
             D C+E        +   A E  I  +N I + KP  P+ P            + +D VT 
Sbjct: 15904 DACREDVGHYVVKLTNSAGEA-IETLNVIVLDKPGPPTGP------------VKMDEVTA 15950

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVR 791
              ++T+ W PP + G + ++ Y++E     T  W + +   + +T      L T  +   R
Sbjct: 15951 DSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSAT-VARTTIKACRLKTGCEYQFR 16009

Query: 792   VKAVNAAGAS-----EPKYYSQPILVKEIIEPPKIRIPRH--LKQTYIRRVGEAVNLVIP 844
             + A N  G S     EP     P  V      P + +     ++  +   + +  + VI 
Sbjct: 16010 IAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIG 16069

Query: 845   F--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
             +  + K R  + W K    ++K  I     +T  +    + E   S +  + +     V 
Sbjct: 16070 YHLERKERNSILWVK----LNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVS 16125

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
                +     D PG P+ + +      +V L W  P  DG + ITGY ++K +     W  
Sbjct: 16126 ECYVARDPCDPPGRPEAIIVTR---NSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMK 16182

Query: 963   V-IEHYHRTSATITELVIGNEYYFRVFSENMCGL-SEDATMTKESAVIARDG----KIYK 1016
                 +   T   +T LV  + Y FRV + N  G+ SE +  T   A+ ARD     +I  
Sbjct: 16183 ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSEST--GAITARDEVDPPRISM 16240

Query: 1017  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1076
             +P Y+D                   AG +  ++  + G P P I W+K    + +  R  
Sbjct: 16241 DPKYKD--------------TIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLE 16286

Query: 1077  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             + S     +L ++     D G Y  KA N  G   +   ++V
Sbjct: 16287 IKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 16328



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 147/655 (22%), Positives = 260/655 (39%), Gaps = 108/655 (16%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E+ SK  E   +  K      T   E +A +  +S+  I  +   Q  TV       F  
Sbjct: 26511 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVI--VTGLQDTTVSSDSVAKFAV 26568

Query: 80    KVKAEDLLRKPTIKWFK--------GKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
             K   E    +PT  W K        GK+     K G  L++ +T    S +YT  ++   
Sbjct: 26569 KATGEP---RPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVK--- 26622

Query: 132   AKDNFAGNYR--CEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELD 189
                N AG+    C++T K   D+ +  +   +++  TP        K++   +E + +  
Sbjct: 26623 ---NSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQ-------KKAVVQEEISQKAL 26672

Query: 190   FSGLLKRREVKQQE------EEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKR 243
              S  +K  E K QE      E  +V + E +K +  +  EK      IT           
Sbjct: 26673 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTS-------- 26724

Query: 244   MRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
                EE ++ A  K       +++G R+     +A    +VKW  NG E+  S +Y +   
Sbjct: 26725 QASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVS 26783

Query: 304   GCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYC---- 355
             G  + L I      D+      +    G  KC  +L        ++K+L D  A+     
Sbjct: 26784 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDL-------TLSKELSDAPAFISQPR 26836

Query: 356   ------GERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
                   G+ V   CE+S E    ++WFKN   I     S   I      + L I  A+ +
Sbjct: 26837 SQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI--SISSNVSISRSRNVYSLEIRNASVS 26894

Query: 409   DAAEYSVMTTG--GQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTK 466
             D+ +Y++      GQ SA  S+      ++ PL ++     +E+ L+     ++ G ++ 
Sbjct: 26895 DSGKYTIKAKNFRGQCSATASL------MVLPLVEEP---SREVVLRTSGDTSLQGSFSS 26945

Query: 467   NGLPVQESDR-----------LKVVHKGRIHKLVIANALTEDEGDYVFAPDAY----NVT 511
               + +  S +              + + +   +   +  +  E     +  ++    N+T
Sbjct: 26946 QSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT 27005

Query: 512   ---------LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
                      L A +  I PPKI  + L +D  +++  G  L +    +GEP P+  WS G
Sbjct: 27006 QLESSTSKMLKAGIRGI-PPKI--EALPSD--ISIDEGKVLTVACAFTGEPTPEVTWSCG 27060

Query: 563   DKAI-MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              + I  +  GR   E+  D +TL+I   ++ D G+Y ++L NE G   A++ + +
Sbjct: 27061 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 201/953 (21%), Positives = 329/953 (34%), Gaps = 190/953 (19%)

Query: 259   DPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMT 317
             D  Y   +    R  + +   P   V W K    +   T+   E       L + +CQ +
Sbjct: 13684 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 13743

Query: 318   DDSEYYVT----AGDEKCSTELFVREPPIMVTKQL--EDTTAYC------------GERV 359
             D  +Y +T    AG ++ +  + V   P + T  +  ++ TA              G  +
Sbjct: 13744 DAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEI 13803

Query: 360   ELECEVSEDDANVKWFKNGEEIIPGPKSRYRI-----------RVEGKKHILIIEGATKA 408
                     D  N KW      +    K+ +R+           RV  +    + EG    
Sbjct: 13804 TNYILEKRDSVNNKWVTCASAV---QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSE 13860

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC-LKCEISENIPGKWTK- 466
                                VD++   +    TD     G  I     E  E     W + 
Sbjct: 13861 PIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA 13920

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL 526
             N  P++  D  KV              LTE   +Y F   A N+    K  +   P + L
Sbjct: 13921 NKTPIRMRD-FKVT------------GLTEGL-EYEFRVMAINLAGVGKPSLPSEPVVAL 13966

Query: 527   DGLDAD----------NTVTVI-------AGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             D +D            N+VT+I        G+KL   I    + P K+ W + +      
Sbjct: 13967 DPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS-WMKANHV---- 14021

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYH--INLKNEAGEAHA-SIKVKVVDFPDPPVAP 626
                    + P+ +  V D+ E    G Y   I  KN AG   A S   + +   D   AP
Sbjct: 14022 -------NVPECAFTVTDLVE---GGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 14071

Query: 627   TVTEVGDDWCIMNWEPPAYDG-----GSPIL--GYFIERKKKQSSRWMRLNFDL----CK 675
             T+            +P   DG     G  I+     I  K    S W +   D+      
Sbjct: 14072 TIV----------LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDIT 14121

Query: 676   ETTFEPKKMIEGVAYEVR-------IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             + T  P   +  + Y  R       I A N  G     +       L V  PP  + + +
Sbjct: 14122 QITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPVEISN 14178

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKI 788
             V+    T+ W PP   G + +  Y+LE        W V ++D I   +   T L    + 
Sbjct: 14179 VSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSED-IQSCRHVATKLIQGNEY 14237

Query: 789   FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 848
               RV AVN  G  EP   S+P+ + +   PP                G      +    K
Sbjct: 14238 IFRVSAVNHYGKGEP-VQSEPVKMVDRFGPP----------------GPPEKPEVSNVTK 14280

Query: 849   PRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETA 904
                 ++WK+     G+EI    +  R  E  ++ ++R  +   S   DL+ KV    E +
Sbjct: 14281 NTATVSWKRPVDDGGSEITGYHVERR--EKKSLRWVRAIKTPVS---DLRCKVTGLQEGS 14335

Query: 905   SIDIQIIDR-----------------------PGPPQIVKIEDVWGENVALTWTPPKDDG 941
             + + ++                          PGPP    + D   ++ +L W  P  DG
Sbjct: 14336 TYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDG 14395

Query: 942   NAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN-----EYYFRVFSENMCGLS 996
                ITGY ++        W   I+    T+  IT+ V+ +     +Y FR+ + N  G+ 
Sbjct: 14396 GLEITGYVVEHQKVGDEAW---IKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVG 14452

Query: 997   EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGN 1055
             E A +         D +I +  +  DF+          L  T  + AG +  +   ++G 
Sbjct: 14453 EPAVIP--------DVEIVEREMAPDFELDAE------LRRTLVVRAGLSIRIFVPIKGR 14498

Query: 1056  PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
             P P++TW K+ + + +  R  + + +    L I + + YD G +     N  G
Sbjct: 14499 PAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTGKFVMTIENPAG 14549



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 127/584 (21%), Positives = 221/584 (37%), Gaps = 94/584 (16%)

Query: 581   SSTLVIDIAERDDSGV--YHINLKNEAGEAH----ASIKVKV------VDFPDPPVAPTV 628
             S T  I++++  +  V  + +  KNE G +       I VK       VD  D P A   
Sbjct: 21210 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVT 21269

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEG 687
               +G +   ++ E P      P + +  +    + S ++R +    K T + +  K   G
Sbjct: 21270 VRIGHN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHG 21326

Query: 688   VAYEVRI--------FAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
               Y V +          +  I +  PS P  P            +  D +   +V + W 
Sbjct: 21327 GKYTVILDNAVCRIAVPITVITLGPPSKPKGP------------IRFDEIKADSVILSWD 21374

Query: 740   PPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 799
              P+  G   +  Y +E       +W +     + +T F +  L  DA+   RV+A N  G
Sbjct: 21375 VPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VARTTFKVPNLVKDAEYQFRVRAENRYG 21433

Query: 800   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD- 858
              S      QP++   I+   + RIP           G+ V   +   G     LTW    
Sbjct: 21434 VS------QPLVSSIIVAKHQFRIPGP--------PGKPVIYNVTSDGM---SLTWDAPV 21476

Query: 859   ---GAEIDKNQINIRNSETDTIIFIRKAERSHSGK------------YDLQVKVDKFVET 903
                G+E+     ++   E ++I++ +      SG+            Y  +V  +     
Sbjct: 21477 YDGGSEV--TGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGL 21534

Query: 904   AS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
             +S        + +  +D PG P  +   DV  E + L W PP  DG + I GY+I+K   
Sbjct: 21535 SSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEKRQG 21591

Query: 956   KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1015
                              T+T L  G+ Y FR+ + N  G     + +    ++ RD  + 
Sbjct: 21592 NERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSS-GIIMTRDENV- 21649

Query: 1016  KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1075
               P   +F     P +   L+     +G +  +   V+G P P++TW K+ V I      
Sbjct: 21650 --PPIVEF----GPEYFDGLIIK---SGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNM 21700

Query: 1076  RMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              +    G  +L +R  +    G Y  +A N  G+ + E K++V+
Sbjct: 21701 EITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21744



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 113/454 (24%), Positives = 172/454 (37%), Gaps = 74/454 (16%)

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R  AVN   + KP  P+ P            L ++ +T    ++ W  P   G A +D Y
Sbjct: 19566 RSVAVNCKVLDKPGPPAGP------------LEINGLTAEKCSLSWGRPQEDGGADIDYY 19613

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
             ++E        W +   +L   T   +T L    +   RV  VN  G  EP    + + +
Sbjct: 19614 IVEKRETSHLAWTICEGEL-QMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPL---ESVAI 19669

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
             K +        P  L+ T + +  E++ L        RPE      G+EI    I  R  
Sbjct: 19670 KALDPFTVPSPPTSLEITSVTK--ESMTLCWS-----RPE---SDGGSEISGYIIERR-- 19717

Query: 873   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI---------------------- 910
             E +++ ++R  ++     YDL+VK     E    + ++                      
Sbjct: 19718 EKNSLRWVRVNKKP---VYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAED 19774

Query: 911   -IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 969
              +  P PP   KI D     + + W  P  DG A ITGYT++       +W T I+    
Sbjct: 19775 PVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRG 19834

Query: 970   TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1029
             T  TI+ L  G EY FRV S N  G S+ +  +        D +I K    E     ++ 
Sbjct: 19835 TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSS--------DPQIAKEREEEPLFDIDSE 19886

Query: 1030  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMF--SNQGVCTLE 1087
             M    +V     AG + T+    RG P P + W K       D R R +  +     +L 
Sbjct: 19887 MRKTLIVK----AGASFTMTVPFRGRPVPNVLWSKPDT----DLRTRAYVDTTDSRTSLT 19938

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
             I   +  D G Y     N L    +   L VKV+
Sbjct: 19939 IENANRNDSGKYTLTIQNVLSAASL--TLVVKVL 19970



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 133/609 (21%), Positives = 230/609 (37%), Gaps = 111/609 (18%)

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            WSR +K+++    +   +   +  T V  +   + +G    +  ++   AH  I      
Sbjct: 8643 WSRVNKSLLNAL-KANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISP---- 8697

Query: 619  FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT 678
             P PP+ P VT+       + WEPPA++GG  I+GYF++++   ++ W R    + K   
Sbjct: 8698 -PGPPI-PRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQ 8755

Query: 679  FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRW 738
            +  K++ EG  Y++R+ AVNA G   P        P+ V  P                  
Sbjct: 8756 YTVKEIREGADYKLRVSAVNAAGEGPPGETQ----PVTVAEPQ----------------- 8794

Query: 739  RPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 798
             PP    A  LD  V      G +  I+A K L  +    +TG P   K++ +       
Sbjct: 8795 EPP----AVELDVSVKG----GIQ--IMAGKTL--RIPAVVTGRPVPTKVWTK------- 8835

Query: 799  GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV--------IPFQGKPR 850
               E +     +++  +    ++ I   L++ + R V  A N          +     P 
Sbjct: 8836 --EEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPG 8893

Query: 851  PELTWKKDGAEIDKNQINIRNSETDT------IIFIRKAERSHSGKYDLQVKVDKFVETA 904
            P L  K          +N  + E D        I  RK  + H+ +  ++ +  K   T 
Sbjct: 8894 PVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITG 8953

Query: 905  SID------------------------IQIIDRPGPP---QIVKIEDVWGENVALTWTPP 937
             ++                        I  +D  GPP   + +   +     + L W  P
Sbjct: 8954 LLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEP 9013

Query: 938  KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY-FRVFSENMCGLS 996
            + +G + I GY I+K      ++  V +    T++ + E +  ++ Y FRV + N  G S
Sbjct: 9014 RSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGES 9073

Query: 997  EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGN 1055
            E +       V+ +D ++               +      +T  + AG    +   V G 
Sbjct: 9074 EPSLPLN---VVIQDDEVPPT----------IKLRLSVRGDTIKVKAGEPVHIPADVTGL 9120

Query: 1056 PKPKITWMKNKVAI------VDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGT 1109
            P PKI W KN+  I      +   +  +  ++    L I K    D GTY   A N LG+
Sbjct: 9121 PMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGS 9180

Query: 1110 VEIECKLEV 1118
            V     +EV
Sbjct: 9181 VFRNVHVEV 9189



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 98/417 (23%), Positives = 169/417 (40%), Gaps = 47/417 (11%)

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTI 779
             PP  + +D V+  ++T+ W PP++ G   +  Y++E     +  W + ++  + +T   I
Sbjct: 19185 PPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ-AVARTSIKI 19243

Query: 780   TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP----KIRIPRHLKQTYIRR- 834
               L T ++   RV A N  G S     S  ++ +    PP      ++    K T +   
Sbjct: 19244 VRLTTGSEYQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTW 19302

Query: 835   ---VGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG 889
                V +  + VI +  + K R  + W K       N+I I     DT + +   +     
Sbjct: 19303 QVPVNDGGSRVIGYHLEYKERSSILWSK------ANKILI----ADTQMKVSGLDEGLMY 19352

Query: 890   KYDLQVKVDKFVETASIDIQII------DRPGPPQIVKIEDVWGENVALTWTPPKDDGNA 943
             +Y +  +    +   S   + +      D PG P++  I     ++V+L W+ P  DG A
Sbjct: 19353 EYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITR---KSVSLKWSKPHYDGGA 19409

Query: 944   AITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMC-GLSEDATM 1001
              ITGY +++ +     W      +   T   +TEL     Y FRVF+ N    +SE +  
Sbjct: 19410 KITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSES 19469

Query: 1002  TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKIT 1061
             T    +I +D  +    V  D  F +  +           AG    +N  + G P P I+
Sbjct: 19470 T--GPIIVKDD-VEPPRVMMDVKFRDVIVVK---------AGEVLKINADIAGRPLPVIS 19517

Query: 1062  WMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGT--VEIECKL 1116
             W K+ + I +  R  + S      L ++     D G Y     N  GT  V + CK+
Sbjct: 19518 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 19574



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 18/216 (8%)

Query: 912   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRT 970
             ++PG P    I  V  ++  + W PP  DG A I  Y ++K +KK  +W +V  E    T
Sbjct: 24518 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 24577

Query: 971   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFS-EAP 1029
               ++  L+ G EY FRV  EN+ G SE + +++              P+    D   +AP
Sbjct: 24578 VFSVKNLIEGLEYEFRVKCENLGGESEWSEISE--------------PITPKSDVPIQAP 24623

Query: 1030  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFS-NQGVCTLE 1087
              F + L N       NATL C V G+PKP + W +  K  I D  +YR+     G   L 
Sbjct: 24624 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 24683

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
             I   +  D   Y  +A N  G+V     LEV+V A+
Sbjct: 24684 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAK 24719



 Score = 90.9 bits (224), Expect = 6e-18
 Identities = 99/442 (22%), Positives = 167/442 (37%), Gaps = 60/442 (13%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  + +  P  P  PF             +  +     ++ W  P   G + +  Y++E 
Sbjct: 12679 IKVVVMDAPGPPQPPF------------DISDIDADACSLSWHIPLEDGGSNITNYIVEK 12726

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI- 815
             C     DW+ A    + KT   +  L    +   RV+A N  G SEP   + P +V +  
Sbjct: 12727 CDVSRGDWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFP 12783

Query: 816   ----IEPPKIRIPRHLKQ----TYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKN 865
                  EP   R+ +  K      + R   +  + +I +  + K R  L W K       N
Sbjct: 12784 FGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVK------AN 12837

Query: 866   QINIRNSETDTIIFIRKAERS------HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI 919
                +R++E      +   E S      +        K  ++V TA + +   D PG P++
Sbjct: 12838 DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV-TARMPV---DPPGKPEV 12893

Query: 920   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF---TVIEHYHRTSATITE 976
             +   DV    V+L W  PK DG + I GY ++       +W    T      +   T T 
Sbjct: 12894 I---DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATG 12950

Query: 977   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV 1036
             L    +Y FR  +     +S  +  +    ++A +      P   D   +   + T    
Sbjct: 12951 LEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV-----PPRIDLSVAMKSLLTVK-- 13003

Query: 1037  NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG 1096
                  AG N  L+ +V G P P ++W K+   +      +M   + +CTLE+   +  D 
Sbjct: 13004 -----AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDS 13058

Query: 1097  GTYCCKAVNDLGTVEIECKLEV 1118
             G Y   A N  G+     KL+V
Sbjct: 13059 GDYTITAENSSGSKSATIKLKV 13080



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 117/543 (21%), Positives = 204/543 (37%), Gaps = 60/543 (11%)

Query: 603   NEAGEAHASIKVKVVDFPDP-----PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N AG   AS+        DP     P  P VT+       + W PP  DGGS + GY +E
Sbjct: 10094 NAAGVGPASLPSDPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVE 10153

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
              K++    W +      + T      + EG  Y+   F V A+ I+    P    V   +
Sbjct: 10154 YKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYK---FRVRAVNIAGIGEPGE--VTDVI 10208

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKF 777
                  L++ D   D +V  R R   H G        +      T  W +  + L  +   
Sbjct: 10209 EMKDRLVSPDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATI 10266

Query: 778   TITGLPTDAKI---------FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIP---- 824
               T + +   I            + A N AG  +     + I+V  +  P  +  P    
Sbjct: 10267 ETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERK-----KTIIVDVLDVPGPVGTPFLAH 10321

Query: 825   ----RHLKQTYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTII 878
                    K T+     +  + +  +  + +      W      + +    ++        
Sbjct: 10322 NLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAY 10381

Query: 879   FIRKAERSHSGKYDLQVKVDKFVETASIDI--QIIDRPGPPQIVKIEDVWGENVALTWTP 936
             F R A  +  G       +  FVET+   +  + I  P  P+ +++++V    V LTW P
Sbjct: 10382 FFRIAAENSIG-------MGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNP 10434

Query: 937   PKDDGNAAITGYTIQKADKKSMEWFTVI-EHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             PK DG + I  Y ++     + ++  V  ++      T+  L  G+ Y +RV + N+ G 
Sbjct: 10435 PKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ 10494

Query: 996   SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
              + +  TK    I    ++    ++ DF        T  +   +A+ G  +       G 
Sbjct: 10495 GKPSFCTKP---ITCKDELAPPTLHLDF----RDKLTIRVGEAFALTGRYS-------GK 10540

Query: 1056  PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
             PKPK++W K++  +++D R  + +      LE  K    D G YC    N  G+ +  C+
Sbjct: 10541 PKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQ 10600

Query: 1116  LEV 1118
             + V
Sbjct: 10601 VNV 10603



 Score = 87.0 bits (214), Expect = 9e-17
 Identities = 96/437 (21%), Positives = 162/437 (37%), Gaps = 75/437 (17%)

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
             N+  ++  +  S  +  +D  DPP  P    +      + W  P Y GG  I  Y +E++
Sbjct: 15032 NMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKR 15091

Query: 660   KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVPLAVT 718
                + RW++ NF    E  F    + E  AYE R+ A NA G IS PS PS         
Sbjct: 15092 DLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDV 15151

Query: 719   SPPTLLTVDSVTDTTV-------------------TMRWRP--PDHIGAAGLDGYVLEYC 757
               P +       DT +                   TM W     +  G A L+  + ++ 
Sbjct: 15152 EAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFS 15211

Query: 758   FEGTEDWIVANKDLI--DKTKFTITGLPTD--AKIFVRVKAVNAAGASEPKYYSQPILVK 813
                     + NKD    D   +T+T       AK    VK ++  G  E      P+ V 
Sbjct: 15212 TN------LVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-----GPLAVT 15260

Query: 814   EIIE--------PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
             E+          PP            +   G  ++  I  Q +    L W    +E+   
Sbjct: 15261 EVTSEKCVLSWFPP------------LDDGGAKIDHYI-VQKRETSRLAWTNVASEVQVT 15307

Query: 866   QINI-RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIED 924
             ++ + +  + +  IF   A   +     L+           + +     P PP+  ++  
Sbjct: 15308 KLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-------SEPVLAVNPYGPPDPPKNPEVTT 15360

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-----TVIEHYHRTSATITELVI 979
             +  +++ + W  P  DG + I  Y +++ DK    W      T+ +  ++ S     L  
Sbjct: 15361 ITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSG----LTE 15416

Query: 980   GNEYYFRVFSENMCGLS 996
             G+EY FR+ +EN  G+S
Sbjct: 15417 GHEYEFRIMAENAAGIS 15433



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 94/359 (26%), Positives = 158/359 (44%), Gaps = 23/359 (6%)

Query: 285  WYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT---AGDEKCST-ELFVREP 340
            W K+G  IR S K+ F   G  R L I + Q++D  EY         EK ST +L V E 
Sbjct: 4846 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 4905

Query: 341  PIMVTKQL-EDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHI 399
            P+   K L E+ T   G+ + L CE+++ + +V W K+G+ ++  P  R    V G    
Sbjct: 4906 PVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKP-GRIVPGVIGLMRA 4963

Query: 400  LIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL-----TPLTDQTVNLGKEICLKC 454
            L I  A   DA  Y+V T    ++ + S  +K ++++      P+ DQ V         C
Sbjct: 4964 LTINDADDTDAGTYTV-TVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 5022

Query: 455  EISENIPG-KWTK--NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 511
            +I+++ P  KW K  + +P + +D+ +++  G    L I NA+ ED  +Y  A +     
Sbjct: 5023 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEY--AVEIEGKR 5080

Query: 512  LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             PAK+ + +    +L  ++    VT+        +  IS    P     +G+  ++  S 
Sbjct: 5081 YPAKLTLGEREVELLKPIE---DVTIYEKESASFDAEISEADIPGQWKLKGE--LLRPSP 5135

Query: 572  RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                ++      L +   + D +G       N    A  ++K   +DF  P    TV E
Sbjct: 5136 TCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPE 5194



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 104/434 (23%), Positives = 164/434 (37%), Gaps = 44/434 (10%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             ++ I + KP  P  P            +  D V+   V + W PP + G   +  Y++E 
Sbjct: 18092 LSVIVLEKPGPPVGP------------VRFDEVSADFVVISWEPPAYTGGCQISNYIVEK 18139

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV---- 812
                 T  W + +   + +T   IT L T  +   R+ A N  G S P   S+ ++V    
Sbjct: 18140 RDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAP-LDSKAVIVQYPF 18197

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVN------LVIPFQGKPRPELTWKKDGAEIDKNQ 866
             KE   P    +    K   + +  E VN      +    + K +  + W K    ++K  
Sbjct: 18198 KEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVK----LNKTP 18253

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
             I     +T  +    + E   S +  + +     V    +     D PG P+ + I    
Sbjct: 18254 IQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITR-- 18311

Query: 927   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYF 985
               NV L W  P  DG + ITGY ++K D     W      +   T  T++ LV    Y F
Sbjct: 18312 -NNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEF 18370

Query: 986   RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1045
             RV + N  G   + +     A+ ARD     N   +       P +   +V     AG  
Sbjct: 18371 RVIARNAAGNFSEPS-DSSGAITARDEIDAPNASLD-------PKYKDVIV---VHAGET 18419

Query: 1046  ATLNCSVRGNPKPKITWMKNKVAIVDD-PRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAV 1104
               L   +RG P P + W K+   + +   R  + S     TL ++     DGG Y  K  
Sbjct: 18420 FVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLS 18479

Query: 1105  NDLGTVEIECKLEV 1118
             N  GT  I   ++V
Sbjct: 18480 NVGGTKSIPITVKV 18493



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 78/292 (26%), Positives = 125/292 (42%), Gaps = 60/292 (20%)

Query: 265   DKGGRVRFV--VELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             ++GG V++V  +E  D   +V WY   +++  S KY   ++    IL++ +    DD  Y
Sbjct: 25275 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 25334

Query: 323   YVTA----GDEKCSTELFVR---------------------------EPPIMVTKQLEDT 351
                     G++    ELFV+                           E P   T  L + 
Sbjct: 25335 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 25394

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK-SRYRIRVEGKKHILIIEGATKAD 409
             TAY GE V     ++   + +V W+K+G++I PG    +Y    +   + L I   T  D
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25454

Query: 410   AAEYSVMTTG--GQSS--AKLSVDLKPLKILTPLTDQTV-------------NLGKEICL 452
              AEY+V+     G+ S  AKL+V L P     P TD T+               G+ +C 
Sbjct: 25455 DAEYTVVARNKYGEDSCKAKLTVTLHP-----PPTDSTLRPMFKRLLANAECQEGQSVCF 25509

Query: 453   KCEISENIPG--KWTKNGLPVQESDRLKVVHKG-RIHKLVIANALTEDEGDY 501
             +  +S   P   KW K+G P+     ++++H+G   + L I + L ED G Y
Sbjct: 25510 EIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 25561



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 102/444 (22%), Positives = 169/444 (38%), Gaps = 63/444 (14%)

Query: 696   AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             ++  + + KP  P  P            +  D V+  ++T+ W PP + G   +  Y+++
Sbjct: 17009 SIEIVTLDKPDPPKGP------------VKFDDVSAESITLSWNPPLYTGGCQITNYIVQ 17056

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
                  T  W V +   + +T   +T L T  +   R+ A N  G S     S PI+ +  
Sbjct: 17057 KRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFAENRYGQSFA-LESDPIVAQYP 17114

Query: 816   IE---PPKIRIPRHL-KQTYIRRVGEAVN------LVIPFQGKPRPELTWKKDGAEIDKN 865
              +   PP       + K + + +  E VN      +    + K R  + W K    ++K 
Sbjct: 17115 YKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTK----VNKT 17170

Query: 866   QINIRNSETDTIIFIRKAERSHSG-KYDLQVKVDKFVETAS--------IDIQIIDRPGP 916
              I+      DT     KA+    G +Y+ +V  +  V            +     D PG 
Sbjct: 17171 IIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGT 17221

Query: 917   PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATIT 975
             P+ + ++      + L WT P  DG + ITGY ++K D     W      +   T  T++
Sbjct: 17222 PEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVS 17278

Query: 976   ELVIGNEYYFRVFSENMCG-LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQP 1034
              L     Y FRV ++N  G +S+ +  T         G I      E    S  P F   
Sbjct: 17279 GLTEDQRYEFRVIAKNAAGAISKPSDST---------GPITAKDEVELPRISMDPKFRDT 17329

Query: 1035  LVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPY 1094
             +V     AG    L   V G P P I W++    I +  R  + +      L ++     
Sbjct: 17330 IVVN---AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRI 17386

Query: 1095  DGGTYCCKAVNDLGTVEIECKLEV 1118
             DGG Y  +A N  G+      ++V
Sbjct: 17387 DGGQYILRASNVAGSKSFPVNVKV 17410



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 105/451 (23%), Positives = 168/451 (37%), Gaps = 79/451 (17%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  I + KP  P+ P            + +D +  T++T+ W PP+  G A L GYV+E 
Sbjct: 23519 IKVIILDKPGPPTGP------------IKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 23566

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
                    W+  ++  + ++ F  T L    +   RV A N  G           L  E+I
Sbjct: 23567 RDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGS-------YLQSEVI 23618

Query: 817   E-PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW---KKDGAE------IDKNQ 866
             E    IRIP           G    L I    +    LTW   + DG        +++ +
Sbjct: 23619 ECRSSIRIP-----------GPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKE 23667

Query: 867   INIR-----NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------IDIQIIDR 913
             +        N    T+   R    +   +Y+ +V       +          + +  I  
Sbjct: 23668 VRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAP 23727

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF------TVIEHY 967
             PG PQ  ++ D    +V+L W+ P+D+G + +TGY I+       EW       T I  Y
Sbjct: 23728 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 23787

Query: 968   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1027
                  T+T L  G EY FRV + N  G  E A        +    K+ +   Y D++  E
Sbjct: 23788 -----TLTHLPQGAEYRFRVLACNAGGPGEPAE-------VPGTVKVTEMLEYPDYELDE 23835

Query: 1028  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
                  +     +   G    L   ++G P P   W K    I    R  + +++    L 
Sbjct: 23836 -----RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSETHTELV 23888

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             I++    D GTY     N  G   +  K+ V
Sbjct: 23889 IKEADRGDSGTYDLVLENKCGKKAVYIKVRV 23919



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 21/194 (10%)

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTE-------SYPDSSTLVIDIAERDDSGVYHI 599
            + +  EPP         + ++E   R+ T        + PD +  V D+ E  +   + +
Sbjct: 7895 VDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQ-FQV 7953

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPVAPT------VTEVGDDWCIMNWEPPAYDGGSPILG 653
              +NEAG  H S   +++   DP   P+      VT+ G     + W+PP  +GGSPI+G
Sbjct: 7954 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 8013

Query: 654  YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVA----YEVRIFAVNAIGISKPSMPS 709
            Y +E     + +WMR+N    K+  F   K+ EGV     Y +R+ AVNAIG+S+PS  S
Sbjct: 8014 YHVEMCPVGTEKWMRVNSRPIKDLKF---KVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 8070

Query: 710  RPFVPLAVTSPPTL 723
               V       PT+
Sbjct: 8071 ENVVAKDPDCKPTI 8084



 Score = 80.9 bits (198), Expect = 6e-15
 Identities = 77/261 (29%), Positives = 107/261 (40%), Gaps = 22/261 (8%)

Query: 464  WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
            W K+G  V+ SDRL + +      L +  ++  D G Y    +    + T    V VI  
Sbjct: 8115 WHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGL 8174

Query: 522  PKIILDGLDADNTVTVIAGNKLRLEIP--ISGEPPPKAMWSRGDKA------IMEGSGRI 573
            P    D   +D T    +  KL  E P    G P    +  R +        +M G  ++
Sbjct: 8175 PGPCKDIKASDITK---SSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKL 8231

Query: 574  R---TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                 +  P+        A     G  +I LKN        I       PDPPV   V  
Sbjct: 8232 SWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPV------IAQDPKQPPDPPVDVEVHN 8285

Query: 631  VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAY 690
               +   + W+PP YDGGS I+GY IE+  K   RW R N  L    T+  K + EG  Y
Sbjct: 8286 PTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEY 8345

Query: 691  EVRIFAVNAIGISKPSMPSRP 711
            + R+ A NA GIS+PS  + P
Sbjct: 8346 QFRVRAENAAGISEPSRATPP 8366



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 105/447 (23%), Positives = 173/447 (38%), Gaps = 58/447 (12%)

Query: 696   AVNAIGISKPSMPSR-PFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVL 754
             A NA G +K  +  +    P  V  P   +   ++T   +T+ W  P + G A +  Y++
Sbjct: 21728 AKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWWDAPLNDGCAPITHYII 21784

Query: 755   EYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK- 813
             E        W +  +D  +   +T   L    +   RV AVN  G   P   S P++ + 
Sbjct: 21785 EKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRP-LDSDPVVAQI 21842

Query: 814   --EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRN 871
                + + P I  P ++        G ++ L        RPE      G+EI +  +  R 
Sbjct: 21843 QYTVPDAPGIPEPSNI-------TGNSITLTWA-----RPE---SDGGSEIQQYILERRE 21887

Query: 872   SE-TDTIIFIRKAERSHS----------GKYDLQVKVDKF--VETASIDIQII------D 912
              + T  +  I K   S +           +Y+  V  +    V  AS   ++I      +
Sbjct: 21888 KKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVN 21947

Query: 913   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTS 971
              PGPP +VK+ D     V+L W+ P  DG   I GY I+       +W  V  E   +T 
Sbjct: 21948 PPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTR 22007

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1031
              T+T+L  G EY FRV + N  G  +   +T     I    ++    +  D +F +  + 
Sbjct: 22008 YTVTDLQAGEEYKFRVSAINGAGKGDSCEVT---GTIKAVDRLTAPELDIDANFKQTHVV 22064

Query: 1032  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1091
                       AG +  L  + +G P P   W K    +    R  + +     TL +   
Sbjct: 22065 R---------AGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENC 22113

Query: 1092  SPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             +  D G Y     N+ G+  I   ++V
Sbjct: 22114 NRNDAGKYTLTVENNSGSKSITFTVKV 22140



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 64/235 (27%), Positives = 91/235 (38%), Gaps = 46/235 (19%)

Query: 914  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT-SA 972
            P PP  V++ +   E + +TW PP  DG + I GY I+K  K    W    EH     + 
Sbjct: 8275 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 8334

Query: 973  TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1032
            T   L  G EY FRV +EN  G+SE +  T  +  +            +  D  +  + T
Sbjct: 8335 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAV------------DPIDAPKVILRT 8382

Query: 1033 QPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-------PRYRM-------- 1077
               V      G    L+ S+ G+P P ITW+K++  IV +       P  R         
Sbjct: 8383 SLEVKR----GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEE 8438

Query: 1078 --------------FSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                           S +G   L +R     D G Y  K  ND G  +  C + V
Sbjct: 8439 EPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8493



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 59/203 (29%), Positives = 83/203 (40%), Gaps = 14/203 (6%)

Query: 908   IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY 967
             ++  + P PP  + I D+    V+L W  PK DG + ITGY I+   K S +W T I   
Sbjct: 14654 VKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTV 14712

Query: 968   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1027
                   +  L  G EY F+V + N  G S      +ES  +     + +  +  + D   
Sbjct: 14713 KGLECVVRNLTEGEEYTFQVMAVNSAGRSAP----RESRPVI----VKEQTMLPELDLRG 14764

Query: 1028  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
                  Q LV   A AG N  +   V G PKP +TW K    +    R    +      L 
Sbjct: 14765 ---IYQKLV--IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILN 14819

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTV 1110
             I +    D G Y   A N +G V
Sbjct: 14820 INECVRSDSGPYPLTARNIVGEV 14842



 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 13/197 (6%)

Query: 912   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 971
             ++P PP+ + + D    +  L W  P  DG + ITGY ++   K S  W     H  + +
Sbjct: 22239 EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLT 22297

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1031
              T+  LV   EY FRV ++N  G SE       S+VI ++ +I           ++    
Sbjct: 22298 FTVERLVEKTEYEFRVKAKNDAGYSEPREAF--SSVIIKEPQIEPT--------ADLTGI 22347

Query: 1032  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1091
             T  L+   A  G   T++  + G P PK+TW   ++ + +  R  + + +   TL ++  
Sbjct: 22348 TNQLITCKA--GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22405

Query: 1092  SPYDGGTYCCKAVNDLG 1108
                D G Y     N  G
Sbjct: 22406 MRGDSGRYFLTLENTAG 22422



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 134/663 (20%), Positives = 230/663 (34%), Gaps = 120/663 (18%)

Query: 2     PEPTKKEENEVPAP----APPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLS 57
             PEP  K    V +P    +P P  P       T P        TP  + Q    +     
Sbjct: 26364 PEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP--------TPTEKVQHLPVSAPPKI 26415

Query: 58    ILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFE 117
               F++       +  ++I  +  V    +LR   + W+K          GK L+    F+
Sbjct: 26416 TQFLK------AEASKEIAKLTCVVESSVLRAKEVTWYKD---------GKKLKENGHFQ 26460

Query: 118   RH-SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFK 176
              H S   T+E++I    ++  G Y CE+                                
Sbjct: 26461 FHYSADGTYELKINNLTESDQGEYVCEI-------------------------------- 26488

Query: 177   RSGEGQEDAGELDFSG---------LLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF 227
              SGEG      L F G         + K  E K+ +++       + +  +P   E I+ 
Sbjct: 26489 -SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTEST--VTRKTEPKAPEPIS- 26544

Query: 228   QYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYK 287
                                   K      + D     D   +   V    +P+    W K
Sbjct: 26545 ---------------------SKPVIVTGLQDTTVSSDSVAKFA-VKATGEPRPTAIWTK 26582

Query: 288   NGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT----AGDEKCSTELFVREPPIM 343
             +G+ I    KY          L I+    +D   Y  T    AG    S +L ++   I 
Sbjct: 26583 DGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--IK 26640

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
              T+  + +T    E    +  V +++ + K  ++ E  +   KS+ ++ ++ +   ++I 
Sbjct: 26641 DTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLIS 26700

Query: 404   GATKADAA---EYSVMTTGGQSSAKLSVDLKP-LKILTPLTDQTVNLGKEICLKCEISEN 459
                K  AA   E S++      +++ S +++   +I    T  ++N G+ + LK  I+  
Sbjct: 26701 EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA 26760

Query: 460   IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--------FAPDAYNVT 511
                KW  NG+ +  S+  +    G    L I  A   DEG                Y++T
Sbjct: 26761 TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLT 26820

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             L  ++   D P  I        +  +  G  +     ISGEP P+  W + +  I   S 
Sbjct: 26821 LSKELS--DAPAFI----SQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISS 26873

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
              +      +  +L I  A   DSG Y I  KN  G+  A+  + V+   + P    V   
Sbjct: 26874 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRT 26933

Query: 632   GDD 634
               D
Sbjct: 26934 SGD 26936



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 94/408 (23%), Positives = 146/408 (35%), Gaps = 40/408 (9%)

Query: 717   VTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKT 775
             +  PPT  +  D V+   VT  W PP++ G   +  YV+E     +  W+     +I +T
Sbjct: 14853 IPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVI-RT 14911

Query: 776   KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ-TYIRR 834
              +  T L T  +   RVKA N  G   P   S  I+      P K+  P    Q T + +
Sbjct: 14912 TYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANY---PFKVPGPPGTPQVTAVTK 14967

Query: 835   VGEAVNLVIPF------------QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIF-IR 881
                 ++   P             + K R  + W+     +    I   +  TD I +  R
Sbjct: 14968 DSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFR 15027

Query: 882   KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
                 + +GK     K  K  E   + +  ID PG P  + I       V L W  P+  G
Sbjct: 15028 VIAENMAGKS----KPSKPSEPM-LALDPIDPPGKPVPLNITR---HTVTLKWAKPEYTG 15079

Query: 942   NAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1000
                IT Y ++K D  +  W      +      T++ L     Y FRV ++N  G     +
Sbjct: 15080 GFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPS 15139

Query: 1001  MTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKI 1060
                ++     D +  K  V  D  F +  +           AG    L   V G P P +
Sbjct: 15140 EPSDAITCRDDVEAPKIKV--DVKFKDTVILK---------AGEAFRLEADVSGRPPPTM 15188

Query: 1061  TWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              W K+   +    +  +        L  +  +  D G Y   A N  G
Sbjct: 15189 EWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGG 15236



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 19/303 (6%)

Query: 341  PIMVTKQLEDT----TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
            P+   K+++D     + + G     EC VS   A   W K+G  I   PK  +R   +GK
Sbjct: 4809 PLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPK--HRFIADGK 4866

Query: 397  KHILIIEGATKADAAEYSVMTTGGQ----SSAKLSVDLKPLKILTPLTDQ-TVNLGKEIC 451
               L I     +DA EY+ +   G     S+AKL V+  P++ +  L ++ TV  G+ + 
Sbjct: 4867 DRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 4926

Query: 452  LKCEISENIPGKWTKNG-LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYN 509
            L CE+++     W K+G + V++  R+     G +  L I +A   D G Y V   +A N
Sbjct: 4927 LSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANN 4986

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
            +   + V V++   +I D L        +      +      +  P   W +G   I   
Sbjct: 4987 LECSSCVKVVE---VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI-PA 5042

Query: 570  SGRIRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
                +TE   D + L + I  A  +D   Y + ++ +   A  ++  + V+   P    T
Sbjct: 5043 EPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVT 5102

Query: 628  VTE 630
            + E
Sbjct: 5103 IYE 5105



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 31/92 (33%), Positives = 43/92 (46%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
            P     L N   I G + TL C + G P P +TW +    I     +++    G+  L I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1089 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
            R+    D G + C AVN+ GTV   C L V+V
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 988



 Score = 61.2 bits (147), Expect = 5e-09
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 913   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH-YHRTS 971
             RP PP++ K+     E + + W PP+ DG  +ITGY ++K +K S  W  V +       
Sbjct: 12093 RPDPPEVTKVSK---EEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERR 12149

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1011
               +  L+  +EY FRV +EN  G+ E +  ++   V+A+D
Sbjct: 12150 MKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR--PVVAKD 12187



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/324 (22%), Positives = 129/324 (39%), Gaps = 19/324 (5%)

Query: 811  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID----- 863
            L +E   P +   P  + +  ++++ E  ++V   Q  G P+P + WKK G  +      
Sbjct: 1023 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 864  KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 923
            K   N +  E   +I +  A+   +G+Y + V+ +K  ET S    +++      ++K +
Sbjct: 1083 KVSYNKQTGECKLVISMTFAD--DAGEYTIVVR-NKHGET-SASASLLEEADYELLMKSQ 1138

Query: 924  DVWGENVALTWTPPKDDGNAAITGYTIQKADKK-SMEWFTVIEHYHRTSATITELVIGNE 982
                    +T    +        G+   + +K+   E   + +   + +  +   V   E
Sbjct: 1139 QEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQE 1198

Query: 983  YYFRVFSENMCGLSEDATM-TKESAVIARDGKIYKNPVYEDFDFSEAPM--FTQPLVNTY 1039
            ++   F E +    E   + T    ++  DG+     +  D   SEA    F   + N  
Sbjct: 1199 FHISSFEERLIKEIEYRIIKTTLEELLEEDGE---EKMAVDISESEAVESGFDSRIKNYR 1255

Query: 1040 AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRM-FSNQGVCTLEIRKPSPYDGGT 1098
             + G   T +C + G P PKI W K+   I    RY+M F   G  +L I    P D G 
Sbjct: 1256 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1315

Query: 1099 YCCKAVNDLGTVEIECKLEVKVIA 1122
            Y   A N  G      KL V+  A
Sbjct: 1316 YTAFASNIKGNAICSGKLYVEPAA 1339



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 345 TKQLEDTTAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
           T+ L+      G     E  +S      V WF++G+ I        +I     +  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 404 GATKADAAEYSVMTTGGQSSAKLSVDL------KPLKILTPLTDQTVNLGKEICLKCEIS 457
             TKA++  YS+  T G   A  + +L       P   +  L   TV  G ++ L+  ++
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 458 ENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             IP    K+ ++G  +Q S   ++  +G ++ L+IA A  ED G Y
Sbjct: 129 -GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 39/140 (27%), Positives = 56/140 (40%), Gaps = 9/140 (6%)

Query: 985   FRVFSENMCGLSEDATM---TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1041
             F+   E +  +SE       T ES V  +       P+      S  P+    L +T   
Sbjct: 26506 FKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI------SSKPVIVTGLQDTTVS 26559

Query: 1042  AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1101
             +   A       G P+P   W K+  AI    +Y++  ++G   LEI K    D G Y C
Sbjct: 26560 SDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTC 26619

Query: 1102  KAVNDLGTVEIECKLEVKVI 1121
                N  G+V   CKL +K I
Sbjct: 26620 TVKNSAGSVSSSCKLTIKAI 26639



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 74/348 (21%), Positives = 121/348 (34%), Gaps = 77/348 (22%)

Query: 847   GKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYD------------- 892
             G+PRP   W KDG  I +  +  +   +    + I K + S SG Y              
Sbjct: 26572 GEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSS 26631

Query: 893   --LQVKVDKFVETASIDIQIIDRPGPPQIVKIED------VWGENVALTWTPP------K 938
               L +K  K  E   +  Q      P +   +++      +  E + ++          K
Sbjct: 26632 CKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALK 26691

Query: 939   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS-------------ATITELVIGNEYYF 985
             ++ +  +    ++K+   S+E   V E   +TS             A  T++ I NE   
Sbjct: 26692 EEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSI-NEGQR 26750

Query: 986   RVFSENMCGLSE-----------------------DATMT------KESAVIARDGKIYK 1016
              V   N+ G ++                       D T+T      ++  ++    K  +
Sbjct: 26751 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 26810

Query: 1017  NPVYEDFDF------SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
               V   +D       S+AP F     +     G N    C + G P P+I W KN + I 
Sbjct: 26811 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 26870

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                   +  ++ V +LEIR  S  D G Y  KA N  G       L V
Sbjct: 26871 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26918



 Score = 54.7 bits (130), Expect = 5e-07
 Identities = 52/221 (23%), Positives = 77/221 (34%), Gaps = 45/221 (20%)

Query: 902  ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 961
            +TA  D++++ RP P      E  W             DG   +  YT +          
Sbjct: 1426 QTARFDLKVVGRPMP------ETFWFH-----------DGQQIVNDYTHK---------- 1458

Query: 962  TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1021
             VI+     S  I      +   + V ++N  G S  + +    AV              
Sbjct: 1459 VVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV-------------- 1504

Query: 1022 DFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFS 1079
              +    PMF + L N     G    +     GNP P I W+KN   IV    P+ R+  
Sbjct: 1505 --EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEG 1562

Query: 1080 NQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
             +G   L+I      D   Y   A+N  G     CK+ V+V
Sbjct: 1563 TKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1603



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 56/305 (18%), Positives = 122/305 (40%), Gaps = 22/305 (7%)

Query: 824   PRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID-KNQINIRNSETDTIIFI 880
             P  + Q   + + E  N++   +  G+P PE+ W K+   I   + ++I  S     + I
Sbjct: 26829 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 26888

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDR-PGPPQIVKIEDVWGENVALTWTPPKD 939
             R A  S SGKY ++ K  +   +A+  + ++     P + V +      ++  +++    
Sbjct: 26889 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 26948

Query: 940   DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 999
               +A+    +       S    T ++    ++ +++ +    E +  + S +  G+S   
Sbjct: 26949 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM---QESFVEMSSSSFMGISNMT 27005

Query: 1000  TMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKP 1058
              +   ++ + + G                P   + L +  +I  G   T+ C+  G P P
Sbjct: 27006 QLESSTSKMLKAG------------IRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTP 27053

Query: 1059  KITWM--KNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
             ++TW     K+   +  R+ + +   + TL I      DGG Y     N+ G+      +
Sbjct: 27054 EVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 27113

Query: 1117  EVKVI 1121
              ++ I
Sbjct: 27114 HIRSI 27118



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 111/565 (19%), Positives = 201/565 (35%), Gaps = 77/565 (13%)

Query: 110  LQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNI 169
            L++ E +      YTF       + +   N   EV   D+  S     +V ES  +    
Sbjct: 3355 LEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGK---DVRESAKSQAVA 3411

Query: 170  DIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQY 229
            D     + S   Q++     F G     EV+  E   Q  +      A   +  ++    
Sbjct: 3412 DSSFTKEESKISQKEIKS--FQGSSYEYEVQVFESVSQSSI----HTAASVQDTQLCHTA 3465

Query: 230  GITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPK-LEVKWYKN 288
             ++ +    +  K   +E    A    +      V  G   +F+  L D   ++V W   
Sbjct: 3466 SLSQIAESTELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHE 3525

Query: 289  GQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY----YVTAGDEKCSTELFVREPPIMV 344
            G +I  S +      G  + L I N Q+ D   Y    +   G+   S  L V   P  +
Sbjct: 3526 GAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESI 3585

Query: 345  TKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEG 404
                        ER+E E E+   + +  +    EE +   + +   ++     +L    
Sbjct: 3586 LH----------ERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLS-KINETLELL---- 3630

Query: 405  ATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG-- 462
                  +E  V  T   S  + +  +     +  +++  +++G    L   +   IP   
Sbjct: 3631 ------SESPVYPTKFDSEKEGTGPI----FIKEVSNADISMGDVATLSVTVI-GIPKPK 3679

Query: 463  -KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV-FAPDAYNVTLPAKVHVID 520
             +W  NG+ +  S   K V  G  H L+I     EDEG+Y   A + Y  T+ +    I+
Sbjct: 3680 IQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKIN 3739

Query: 521  PPKIILDGLDADNTVTVIAGNKLRL-------------------------EIPISGEPPP 555
                  +G     T + +A +  +L                         E  + GEP P
Sbjct: 3740 SKG---EGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAP 3796

Query: 556  KAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVK 615
               W + +K +          +   S T +++  +R+DSG+Y    +N  GE+  + ++ 
Sbjct: 3797 TVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELL 3856

Query: 616  VV----DFPDPPV-APTVTEVGDDW 635
            V+    D  D P  A +  E  +D+
Sbjct: 3857 VLLEDTDMTDTPCKAKSTPEAPEDF 3881



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 96/424 (22%), Positives = 163/424 (38%), Gaps = 79/424 (18%)

Query: 714  PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLID 773
            PLA+     LL  +   +  +     PPD I  +  +   ++   E      V  +DL+ 
Sbjct: 4160 PLALEEKQVLLKEEHSDNVVM-----PPDQIIESKREPVAIKKVQE------VQGRDLLS 4208

Query: 774  KTKFTITGLPTDAKIFVRV---KAVNAAGASE-PKYYSQPILVKEIIEPPKIRI---PRH 826
            K    ++G+P + ++ +++   +A+ AA ASE P  +S+ +   E +E   + I   PRH
Sbjct: 4209 KESL-LSGIPEEQRLNLKIQICRALQAAVASEQPGLFSEWLRNIEKVEVEAVNITQEPRH 4267

Query: 827  LKQTYI----RRVGEAVNLVIPFQGKPRPELTWKKDGA--EIDKNQINIRNSETDTIIFI 880
            +   Y+    + V E V ++I         L  +   A   I   +I+I  +E   I   
Sbjct: 4268 IMCMYLVTSAKSVTEEVTIIIEDVDPQMANLKMELRDALCAIIYEEIDILTAEGPRI--- 4324

Query: 881  RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVA-----LTWT 935
                     K  LQ ++D F  +  ++           ++  E+V   NV      L  T
Sbjct: 4325 -----QQGAKTSLQEEMDSFSGSQKVEPITEPEVESKYLISTEEVSYFNVQSRVKYLDAT 4379

Query: 936  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
            P      +A+       +D+K  E     E    +S+                     G 
Sbjct: 4380 PVTKGVASAVV------SDEKQDESLKPSEEKEESSSE-------------------SGT 4414

Query: 996  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
             E AT+  + A    +G + K          + PM   PLV+T +  G    L  S+  N
Sbjct: 4415 EEVATVKIQEA----EGGLIKE---------DGPMIHTPLVDTVSEEGDIVHLTTSIT-N 4460

Query: 1056 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG-GTYCCKAVNDLGTVEIEC 1114
             K ++ W      +  D +++   +Q   TL I K +  D  G Y C+A+ND G      
Sbjct: 4461 AK-EVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSA 4519

Query: 1115 KLEV 1118
            KL V
Sbjct: 4520 KLTV 4523



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 59/283 (20%), Positives = 97/283 (34%), Gaps = 70/283 (24%)

Query: 836  GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 895
            GE+V L     G P P +TW ++  +I+                                
Sbjct: 911  GESVTLECHISGYPSPTVTWYREDYQIE-------------------------------- 938

Query: 896  KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
                    +SID QI  + G  +++  E    ++   T +   + G  + + Y   +   
Sbjct: 939  --------SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ--- 987

Query: 956  KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1015
                   V E + + +  +TE     E   + F E+   +  D ++T+E A        Y
Sbjct: 988  -------VSEEFEKETTAVTEKFTTEE---KRFVESRDVVMTDTSLTEEQAGPGEPAAPY 1037

Query: 1016 KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1075
                            T+P+V    + G +    C V GNPKP + W K+ V +    RY
Sbjct: 1038 --------------FITKPVVQKL-VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 1076 RMFSNQ--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
            ++  N+  G C L I      D G Y     N  G       L
Sbjct: 1083 KVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 47.8 bits (112), Expect = 6e-05
 Identities = 61/279 (21%), Positives = 101/279 (36%), Gaps = 22/279 (7%)

Query: 266  KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
            +G   RF   ++   L+V WY   ++I+PS  +          L I      D+  Y   
Sbjct: 3312 EGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFV 3371

Query: 326  A----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEI 381
            A    G    +  L +    +      +D       +   +   +++++ +    + +EI
Sbjct: 3372 ASNAVGQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSSFTKEESKI----SQKEI 3427

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL----------K 431
                 S Y   V+  + +      T A   +  +  T   S    S +L          +
Sbjct: 3428 KSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGE 3487

Query: 432  PLKILTPLTDQTVNLGKEICLKCEISEN--IPGKWTKNGLPVQESDRLKVVHKGRIHKLV 489
              KI   L D TV  G      C + ++  I   WT  G  ++ES+RLK    G I  L 
Sbjct: 3488 APKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFLT 3547

Query: 490  IANALTEDEGDY--VFAPDAYNVTLPAKVHVIDPPKIIL 526
            I N    D+G Y  +   D    T  A + V   P+ IL
Sbjct: 3548 ICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESIL 3586



 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 1026 SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFSNQGV 1083
            ++AP FTQPL +   + G  AT    + G P P+++W ++   I     P  ++  + G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1084 CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              L I   +  + G Y  KA N  G      +L VK
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 36/105 (34%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 512 LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
           +PA V +   P  ++ GL     VTVI G  + LE  ISG P P   W R D  I E S 
Sbjct: 886 VPAPVEIPVTPPTLVSGL---KNVTVIEGESVTLECHISGYPSPTVTWYREDYQI-ESSI 941

Query: 572 RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
             +       + L+I  A  +DSG +  +  NEAG    S  + V
Sbjct: 942 DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 1029  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV---DDPRYRMFSNQGVCT 1085
             P FT PL N  A  G N     ++  +P+P +TW K+   I    +D +Y   S++G+  
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25444

Query: 1086  LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             L I   +  D   Y   A N  G    + KL V
Sbjct: 25445 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 1016 KNPVYEDFDFSE----APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1071
            ++PVY     SE     P+F + + N     G  ATL+ +V G PKPKI W  N V +  
Sbjct: 3632 ESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTP 3691

Query: 1072 DPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
               Y+   +    +L I      D G Y C A ND G       L++
Sbjct: 3692 SADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3738



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 42/93 (45%)

Query: 1028 APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
            AP+  + +       G+ A   C ++  P  +  W K    I +  +  + S++ + +LE
Sbjct: 4528 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLE 4587

Query: 1088 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
            I +    D G Y CKA N+ G+V     L V V
Sbjct: 4588 ILRTQVVDCGEYTCKASNEYGSVSCTATLTVTV 4620



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 3/96 (3%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN-QGVCTLE 1087
            P F + L       G  A    +V G P P +TW K    +     Y +  N  G  T  
Sbjct: 3767 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3826

Query: 1088 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
            +  P   D G Y CKA N LG  E  C  E+ V+ +
Sbjct: 3827 VNDPQREDSGLYICKAENMLG--ESTCAAELLVLLE 3860



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH--YHRTS 971
             P  P    + +V  ++  +TW  P D G   IT Y ++K +  S  W  V +   +  T 
Sbjct: 10707 PDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETMSKRWARVTKDPIHPYTK 10765

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1011
               + +L+ G +Y FRV +EN  G+ + +  +K   V A+D
Sbjct: 10766 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK--PVFAKD 10803



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 120/582 (20%), Positives = 208/582 (35%), Gaps = 92/582 (15%)

Query: 316  MTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDA-NVKW 374
            MTD S     AG  + +   F+ +P  +V K +E      G  V   C+V  +   +V W
Sbjct: 1018 MTDTSLTEEQAGPGEPAAPYFITKP--VVQKLVE------GGSVVFGCQVGGNPKPHVYW 1069

Query: 375  FKNGEEIIPGPKSRYRIRVEGKKHI----LIIEGATKADAAEYSVMTTG--GQSSAKLSV 428
             K+G  +  G    YR +V   K      L+I      DA EY+++     G++SA  S+
Sbjct: 1070 KKSGVPLTTG----YRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125

Query: 429  DLKPLKILTPLTDQTVNLGKEICL---KCEISENIPGKWTKNGLPVQESDRLKVVHKGRI 485
              +    L   + Q +    ++     + ++ E  PG +  +    +      ++ K   
Sbjct: 1126 LEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPG-FVYSEYEKEYEKEQALIRKKMA 1184

Query: 486  HKLVIANALTEDEGDYVFAPDA----------YNVTLPAKVHVIDPPKIILD-------- 527
               V+     ED+  ++ + +              TL   +      K+ +D        
Sbjct: 1185 KDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVE 1244

Query: 528  -GLDAD-NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STL 584
             G D+      ++ G  +     +SG P PK  W +  K I  G  R + +   D  ++L
Sbjct: 1245 SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE-RYQMDFLQDGRASL 1303

Query: 585  VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPA 644
             I +   +D G+Y     N  G A  S K+ V      P AP    +G    I   EP  
Sbjct: 1304 RIPVVLPEDEGIYTAFASNIKGNAICSGKLYV-----EPAAP----LGAPTYIPTLEP-- 1352

Query: 645  YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
                       + R +  S R +  +          P +M        R+     +  + 
Sbjct: 1353 -----------VSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETD 1401

Query: 705  PSMPSRPFVPLAVTSPPTLLTVDSVT---DTTVTMRWRPPD---HIGAAGLDGYVLEYCF 758
             S   R + P+ V  P +   ++  T   D  V  R  P     H G   ++ Y  +   
Sbjct: 1402 ESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVI 1461

Query: 759  --EGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
              +GT+  I+      D  ++T+              A N AG S     S  + V+ + 
Sbjct: 1462 KEDGTQSLIIVPATPSDSGEWTVV-------------AQNRAGRSS---ISVILTVEAVE 1505

Query: 817  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 858
               K      LK   I+  G  + + +   G P P++ W K+
Sbjct: 1506 HQVKPMFVEKLKNVNIKE-GSRLEMKVRATGNPNPDIVWLKN 1546



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 62/284 (21%), Positives = 105/284 (36%), Gaps = 51/284 (17%)

Query: 851  PELT--WKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDL----QVKVDK-FVE 902
            P++T  W KD  E+   ++I I+  +    + I     S +GKY +     V   K FVE
Sbjct: 3038 PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3097

Query: 903  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA------AITGYTIQKADKK 956
               + I+ I +       +++ +  +   + +   +DD +A          + +Q+  K 
Sbjct: 3098 GRDVRIRSIKK-------EVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK- 3149

Query: 957  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1016
                + V    HR   + T      EY F V   N   ++                 +Y 
Sbjct: 3150 ----YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVT-----------------LYV 3187

Query: 1017 NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1076
            N         E P   Q L      +G  A     + G P+PKI+W K +  +    + +
Sbjct: 3188 NA-------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3240

Query: 1077 MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
               +    TL + +  P D   Y C+A ND G       L V+V
Sbjct: 3241 FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV 3284



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
           ++TV  G+++RL++ ++G P P   + R D A ++ S   +     D  +L+I  A  +D
Sbjct: 112 SMTVRQGSQVRLQVRVTGIPTPVVKFYR-DGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170

Query: 594 SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
           SG Y +N  N  G A ++ ++ V    + P   T T V
Sbjct: 171 SGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIV 208



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 64/320 (20%), Positives = 110/320 (34%), Gaps = 40/320 (12%)

Query: 315   QMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SEDDANVK 373
             Q T + +Y      E  S + F  +    +T ++      CG+       V S+  A VK
Sbjct: 26048 QKTSERKY------EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVK 26101

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT-------------KADAAEYSVM-TTG 419
             W+ NG E+    K  Y     G   + I++  T             K +A++Y+ +  TG
Sbjct: 26102 WYHNGVELQESSKIHYT-NTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG 26160

Query: 420   GQSSAKLSV---DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDR 476
             G  +   S    +  P  +   LT              E+  +   +  K+ +       
Sbjct: 26161 GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESL 26220

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                 H       + + AL E   +          TL A++            L    ++T
Sbjct: 26221 SSYEHSASAE--MKSAALEEKSLEEKSTTRKIKTTLAARI------------LTKPRSMT 26266

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
             V  G   R      GEP P   W R  + ++  S R +  +    ST  I   +  D G 
Sbjct: 26267 VYEGESARFSCDTDGEPVPTVTWLRKGQ-VLSTSARHQVTTTKYKSTFEISSVQASDEGN 26325

Query: 597   YHINLKNEAGEAHASIKVKV 616
             Y + ++N  G+  A   + +
Sbjct: 26326 YSVVVENSEGKQEAEFTLTI 26345



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 94/440 (21%), Positives = 160/440 (36%), Gaps = 71/440 (16%)

Query: 246  REEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKG 304
            ++EK+        +P  +V +G   RF   +   P+ +V WY NGQ IR S ++   + G
Sbjct: 1789 QKEKQKPDIVLYPEPV-RVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG 1847

Query: 305  CQRILFINNCQMTDDSEYYVTAG------DEKCSTELFVREP------------------ 340
                L I +C+  D  E  VTA       + K   E+  RE                   
Sbjct: 1848 I-HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH 1906

Query: 341  --------------PIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGE-----EI 381
                          P+  T+  E       ER+  E    E +     FK        E 
Sbjct: 1907 EPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEA 1966

Query: 382  IPGPKSRYRIRVEGKKHIL-------------IIEGATKADAAEYSV-MTTGGQSSAKLS 427
            I   + + R + E  + +L             + E   KA A E  + + T      +LS
Sbjct: 1967 ITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELS 2026

Query: 428  VDLKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLK-VVHKGR 484
              ++  KI   +  QTV  G +   +  +    +   +W KNG+ ++ SDR+     +  
Sbjct: 2027 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2086

Query: 485  IHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH---VIDPPKIILDGLDADNTVTVIAGN 541
            + +LVI +   ED    +    A N+      H   ++   ++I    +  + V      
Sbjct: 2087 VCELVIRDVTAEDSASIMV--KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2144

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE-SYPDSSTLVIDIAERDDSGVYHI 599
                E   S EP  K  W +    + EG   R+ ++      S L ID ++ +D     +
Sbjct: 2145 MATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2203

Query: 600  NLKNEAGEAHASIKVKVVDF 619
              +N    A   ++  VV+F
Sbjct: 2204 EDENVKTTAKLIVEGAVVEF 2223



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1041 IAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
            + G  A   C V G P+PK+ W  N   I    R+R+    G+  L+I     YD G   
Sbjct: 1807 LEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVK 1865

Query: 1101 CKAVNDLGTVEIECKLEVK 1119
              A N  G +E + KLE++
Sbjct: 1866 VTAENPEGVIEHKVKLEIQ 1884



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 59/286 (20%), Positives = 102/286 (35%), Gaps = 24/286 (8%)

Query: 836   GEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894
             G+    ++  Q KP  E+ W  +G E+ + ++I+  N+     + I       SG Y  +
Sbjct: 26083 GQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY--R 26140

Query: 895   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954
                  +   AS D   +D  G            E V  +  P      A    Y +    
Sbjct: 26141 AVCTNYKGEAS-DYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA----YAVSSFK 26195

Query: 955   KKS-MEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1013
             K S ME  + +       + +TE             E++      A+   +SA +     
Sbjct: 26196 KTSEMEASSSVRE---VKSQMTET-----------RESLSSYEHSASAEMKSAALEEKSL 26241

Query: 1014  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1073
               K+   +      A + T+P   T    G +A  +C   G P P +TW++    +    
Sbjct: 26242 EEKSTTRKIKTTLAARILTKPRSMT-VYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 26300

Query: 1074  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
             R+++ + +   T EI      D G Y     N  G  E E  L ++
Sbjct: 26301 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 26346



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 61/263 (23%), Positives = 104/263 (39%), Gaps = 35/263 (13%)

Query: 261   AYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDD 319
             +++V  G   RF++ + + P  EVKWY NG E++ S+K  + +      L I +C  TDD
Sbjct: 26077 SHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCH-TDD 26135

Query: 320   SEYY------------------VTAGD-EKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
             S  Y                  VT GD    +++    E P  V  +L  T AY     +
Sbjct: 26136 SGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFK 26195

Query: 361   LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
                E+ E  ++V+  K+         +  R  +   +H      + +  +A     +   
Sbjct: 26196 KTSEM-EASSSVREVKS-------QMTETRESLSSYEH----SASAEMKSAALEEKSLEE 26243

Query: 421   QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLK 478
             +S+ +        +ILT     TV  G+     C+   E +P   W + G  +  S R +
Sbjct: 26244 KSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQ 26303

Query: 479   VVHKGRIHKLVIANALTEDEGDY 501
             V          I++    DEG+Y
Sbjct: 26304 VTTTKYKSTFEISSVQASDEGNY 26326



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 41/170 (24%), Positives = 67/170 (39%), Gaps = 16/170 (9%)

Query: 464  WTKNGLPVQESDRLKVVHK-GRIHKLVIANALTEDEGDYVFAPD--------AYNVTLPA 514
            W  +G  +      KVV K      L+I  A   D G++             +  +T+ A
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1503

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS-GRI 573
              H + P  +     +    V +  G++L +++  +G P P  +W +    I+     +I
Sbjct: 1504 VEHQVKPMFV-----EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKI 1558

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV-VDFPDP 622
            R E     + L ID     DS  Y     N+AG      KV V V+F +P
Sbjct: 1559 RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEP 1608



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 67/327 (20%), Positives = 116/327 (35%), Gaps = 65/327 (19%)

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDAN--VKWFKNGEEIIPGPKSRYRIRVEGKKHILI 401
             V+ Q+       G  V+  C++   D +  V W+    ++    K  Y I  E    IL 
Sbjct: 25265 VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEK--YEITYEDGVAILY 25322

Query: 402   IEGATKADAAEY--SVMTTGGQSSAKLSVDLK---------------------------- 431
             ++  TK D   Y   V+   G+ S+   + +K                            
Sbjct: 25323 VKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLE 25382

Query: 432   -PLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVV----HKGR 484
              P +   PL ++T  +G+ +     I+ +      W K+G  ++  D  K       KG 
Sbjct: 25383 RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG- 25441

Query: 485   IHKLVIANALTEDEGDYV------FAPDAYNVTLPAKVHVIDPP---------KIILDGL 529
             +++L I +  T+D+ +Y       +  D+    L   +H   PP         K +L   
Sbjct: 25442 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH--PPPTDSTLRPMFKRLLANA 25499

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             +         G  +  EI +SG PPP   W +  + +  G          D   L I   
Sbjct: 25500 ECQE------GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT 25553

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKV 616
               +D+G Y +   N AG       ++V
Sbjct: 25554 LPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 5/111 (4%)

Query: 1003 KESAVIARDGKI----YKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1058
            +E   +A +GKI    +K    E     EAP   + + +     G +A     V G P P
Sbjct: 2002 EEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDP 2061

Query: 1059 KITWMKNKVAIVDDPR-YRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
            +  W KN V I    R Y  +    VC L IR  +  D  +   KA+N  G
Sbjct: 2062 ECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2112



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 75/321 (23%), Positives = 117/321 (36%), Gaps = 33/321 (10%)

Query: 813  KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ-GKPRPELTWKKDGAEIDKNQINIRN 871
            K  +E   +RI    K+    +V E    V+ F+  +   +  W KDG EI+        
Sbjct: 3093 KLFVEGRDVRIRSIKKEV---QVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK 3149

Query: 872  SETDTII---FIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGE 928
               +  I   FI +  +S +G+Y      ++   T       ++ P PPQ+++      E
Sbjct: 3150 YVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL-----YVNAPEPPQVLQ------E 3198

Query: 929  NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY---YF 985
               +T    K     A+    I    +  + W+   E    T      L  G EY     
Sbjct: 3199 LQPVTVQSGKPARFCAV----ISGRPQPKISWYKE-EQLLSTGFKCKFLHDGQEYTLLLI 3253

Query: 986  RVFSENM----CGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1041
              F E+     C    D  +   SA ++ +     +P  E   +   P    PL +T   
Sbjct: 3254 EAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP--PAIITPLQDTVTS 3311

Query: 1042 AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1101
             G  A   C V G    K++W      I     +RM   +    LEI +  P D GTY  
Sbjct: 3312 EGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTF 3370

Query: 1102 KAVNDLGTVEIECKLEVKVIA 1122
             A N +G V     L ++V A
Sbjct: 3371 VASNAVGQVSSTANLSLEVQA 3391



 Score = 40.0 bits (92), Expect = 0.012
 Identities = 44/211 (20%), Positives = 95/211 (45%), Gaps = 28/211 (13%)

Query: 245  RREEKKSAAFAKILDPAYQVD-------KGGRVRFVVELAD-PKLEVKWYKNGQEIRP-- 294
            R EE   +   ++  P + +        +G   RF +++   P  E  W+ +GQ+I    
Sbjct: 1396 RLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY 1455

Query: 295  STKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFV--------REPPIMVTK 346
            + K + +  G Q ++ +     +D  E+ V A +    + + V         +   M  +
Sbjct: 1456 THKVVIKEDGTQSLIIVP-ATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1514

Query: 347  QLEDTTAYCGERVELECEVSED-DANVKWFKNGEEIIPGPKSRY-RIRVEGKK--HILII 402
            +L++     G R+E++   + + + ++ W KN + I+P    +Y +IR+EG K    L I
Sbjct: 1515 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVP---HKYPKIRIEGTKGEAALKI 1571

Query: 403  EGATKADAAEY--SVMTTGGQSSAKLSVDLK 431
            +     D+A Y  + +   G+ + +  V+++
Sbjct: 1572 DSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602



 Score = 40.0 bits (92), Expect = 0.012
 Identities = 96/465 (20%), Positives = 165/465 (35%), Gaps = 92/465 (19%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E  S  + + +   K   L E    E+   +   + L+   + KP+  TV  GE   F  
Sbjct: 26218 ESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSC 26277

Query: 80    KVKAEDLLRKPTIKWF-KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAG 138
                 E +   PT+ W  KG+   + S + +H      ++      TFE+  ++A D   G
Sbjct: 26278 DTDGEPV---PTVTWLRKGQ---VLSTSARHQVTTTKYKS-----TFEISSVQASDE--G 26324

Query: 139   NYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRRE 198
             NY   V   +      F L + ++  T   +      K S E +  + E     +   + 
Sbjct: 26325 NYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVK-SPEPRVKSPE----AVKSPKR 26379

Query: 199   VKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKIL 258
             VK  E      V       KP+  EK+        +    K  + ++ E  K  A     
Sbjct: 26380 VKSPEPSHPKAVSP--TETKPTPTEKVQH----LPVSAPPKITQFLKAEASKEIA----- 26428

Query: 259   DPAYQVDKGGRVRFVVELADPKL-EVKWYKNGQEIRPSTKYIFEHKGCQRI-LFINNCQM 316
                       ++  VVE +  +  EV WYK+G++++ +  + F +       L INN   
Sbjct: 26429 ----------KLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26478

Query: 317   TDDSEYY---------------------------------VTAGDEKCSTELFVR--EP- 340
             +D  EY                                      D+K +     R  EP 
Sbjct: 26479 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 26538

Query: 341   --------PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRI 391
                     P++VT  L+DTT       +   + + E      W K+G+ I  G K  Y++
Sbjct: 26539 APEPISSKPVIVT-GLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK--YKL 26595

Query: 392   RVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSVDLKPLK 434
               +     L I     +D+  Y  +V  + G  S+   + +K +K
Sbjct: 26596 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIK 26640



 Score = 39.7 bits (91), Expect = 0.016
 Identities = 25/98 (25%), Positives = 37/98 (37%)

Query: 1021  EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1080
             + F    AP  T  + +     G N     +V+  P  ++ W  N V + +  +    + 
Sbjct: 26061 QPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNT 26120

Query: 1081  QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
              GV TLEI      D GTY     N  G       L+V
Sbjct: 26121 SGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 39.3 bits (90), Expect = 0.021
 Identities = 58/327 (17%), Positives = 107/327 (32%), Gaps = 45/327 (13%)

Query: 836  GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYD 892
            G+     +   G+P PE  W  DG +I  +   ++ I+   T ++I +  A  S SG++ 
Sbjct: 1425 GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIV-PATPSDSGEWT 1483

Query: 893  L--QVKVDKFVETASIDIQIIDRPGPPQIV----------------KIEDVWGENVALTW 934
            +  Q +  +   +  + ++ ++    P  V                K+      N  + W
Sbjct: 1484 VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1543

Query: 935  TPPKD------------DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 982
                D            +G        I     +   W+T     ++     T   +  E
Sbjct: 1544 LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATA-INKAGRDTTRCKVNVE 1602

Query: 983  YYFR--------VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQP 1034
              F         +         E A    E   +    + ++     D +  + P F + 
Sbjct: 1603 VEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKK 1662

Query: 1035 LVNTYAIAGYNATLNCSVR--GNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPS 1092
            L +        A   C +   G+P   + W+ +   +    R RM +  G C+L+     
Sbjct: 1663 LTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAY 1722

Query: 1093 PYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              D G   C+A N  GT      L VK
Sbjct: 1723 SRDSGIITCRATNKYGTDHTSATLIVK 1749



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 44/162 (27%), Positives = 69/162 (42%), Gaps = 13/162 (8%)

Query: 279 PKLEVKWYKNGQEIRPST--KYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
           P  EV W+++GQ I  ST           +  L I      +   Y + A    G    +
Sbjct: 33  PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATST 92

Query: 333 TELFVR---EPPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGPKSR 388
            EL V+    PP  V ++L+  T   G +V L+  V+      VK++++G EI       
Sbjct: 93  AELLVKAETAPPNFV-QRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI--QSSLD 149

Query: 389 YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL 430
           ++I  EG  + L+I  A   D+  YSV  T     A  + +L
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAEL 191



 Score = 38.1 bits (87), Expect = 0.047
 Identities = 38/173 (21%), Positives = 68/173 (39%), Gaps = 11/173 (6%)

Query: 337  VREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
            ++E   M+   L DT +  G+ V L   ++       +F+N  +++P  + +++   +  
Sbjct: 4430 IKEDGPMIHTPLVDTVSEEGDIVHLTTSITNAKEVNWYFEN--KLVPSDE-KFKCLQDQN 4486

Query: 397  KHILIIEGATKAD-AAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN-----LGKEI 450
             + L+I+     D   EY             S  L  +K   P+  + +      LG   
Sbjct: 4487 TYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGHLA 4546

Query: 451  CLKCEISE--NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
               CEI    N+  +W K G  + ESD+  +     I  L I      D G+Y
Sbjct: 4547 KFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEY 4599



 Score = 38.1 bits (87), Expect = 0.047
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 3/98 (3%)

Query: 1024  DFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGV 1083
             D +  PMF + L N     G +      V G P P + W K+   +   P   +  ++G+
Sbjct: 25485 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII-HEGL 25543

Query: 1084  --CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
                 L IR   P D G Y   A N  G+   +  L+V+
Sbjct: 25544 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 25581



 Score = 37.7 bits (86), Expect = 0.062
 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 5/83 (6%)

Query: 264   VDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             V  G  VRF   +   P    KW  +G EI+    Y  E      +L I NC   D  EY
Sbjct: 11217 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 11276

Query: 323   YVT----AGDEKCSTELFVREPP 341
              +T    AG +  +  L V + P
Sbjct: 11277 QITVSNAAGSKTVAVHLTVLDVP 11299



 Score = 37.7 bits (86), Expect = 0.062
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 1059  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             ++TW      + +  +Y +    GV  L ++  +  D GTY CK VND G      +L V
Sbjct: 25294 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25353

Query: 1119  KVIAQ 1123
             K + +
Sbjct: 25354 KGVRE 25358



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR-MFSNQGVCTLE 1087
            P+F    V+   + G  A  +  V G P P+  W  +   IV+D  ++ +    G  +L 
Sbjct: 1411 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1470

Query: 1088 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
            I   +P D G +   A N  G   I   L V+ +
Sbjct: 1471 IVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV 1504



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 45/250 (18%), Positives = 92/250 (36%), Gaps = 31/250 (12%)

Query: 855  WKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 913
            W KDG EI  + + +I+      I+ I+KA+    G+Y      DK     +++ ++I  
Sbjct: 5389 WFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKV 5448

Query: 914  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
              P   V++      +  +  + P   G   + G  +                   T++ 
Sbjct: 5449 EKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPL-------------------TASP 5489

Query: 974  ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQ 1033
              E++   + +  +      G++ + +    +A  A + K+ + P+          +F  
Sbjct: 5490 DCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPL----------IFIT 5539

Query: 1034 PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1093
            PL +        A   C V   PK    W+K    I  D R+ +  +    ++ I+  + 
Sbjct: 5540 PLSDVKVFEKDEAKFECEVSREPK-TFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAF 5598

Query: 1094 YDGGTYCCKA 1103
             D   Y  +A
Sbjct: 5599 EDEAKYMFEA 5608



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 39/146 (26%), Positives = 56/146 (38%), Gaps = 11/146 (7%)

Query: 276   LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
             L  PK  V W K  Q ++ + +  FE      IL IN C  +D   Y +TA +       
Sbjct: 14785 LGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN------- 14837

Query: 336   FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
              V E   ++T Q+ D        ++ + EVS D     W    E     P S Y + +  
Sbjct: 14838 IVGEVGDVITIQVHDIPGPPTGPIKFD-EVSSDFVTFSW-DPPENDGGVPISNYVVEMRQ 14895

Query: 396   KKHILIIEGATKADAAEYSV--MTTG 419
                   +E AT      Y    +TTG
Sbjct: 14896 TDSTTWVELATTVIRTTYKATRLTTG 14921



 Score = 35.8 bits (81), Expect = 0.23
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STLVIDIAERD 592
           +V V+ G+    E  ISG P P+  W R  + I   +      S+ D  + L I    + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 593 DSGVYHINLKNEAGEAHASIKVKVVDFPDPP 623
           +SG Y +   N +G+A ++ ++ V     PP
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 35.8 bits (81), Expect = 0.23
 Identities = 23/89 (25%), Positives = 34/89 (38%), Gaps = 2/89 (2%)

Query: 536   TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG--RIRTESYPDSSTLVIDIAERDD 593
             T   G  +R  + I+  P P   W +  + I  G    +   ES      L I+    DD
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25454

Query: 594   SGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                Y +  +N+ GE     K+ V   P P
Sbjct: 25455 DAEYTVVARNKYGEDSCKAKLTVTLHPPP 25483



 Score = 35.0 bits (79), Expect = 0.40
 Identities = 23/91 (25%), Positives = 37/91 (40%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
            P F Q L +     G    L   V G P P + + ++   I     +++     + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1089 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
             +  P D GTY   A N +G      +L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.0 bits (79), Expect = 0.40
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
            P FT  L +  A+     TL C V  +   K  W K+   IV  P+Y + ++     L+I
Sbjct: 5358 PYFTVKLHDKTAVEKDEITLKCEVSKDVPVK--WFKDGEEIVPSPKYSIKADGLRRILKI 5415

Query: 1089 RKPSPYDGGTYCCKAVND--LGTVEIECKL 1116
            +K    D G Y C    D     V +E +L
Sbjct: 5416 KKADLKDKGEYVCDCGTDKTKANVTVEARL 5445



 Score = 33.9 bits (76), Expect = 0.89
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 11/119 (9%)

Query: 393 VEGKKHILIIEGATKADAAEYSVM-------TTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
           VE KK + +    T      + V+       T   +  A + + + P  +++ L + TV 
Sbjct: 850 VEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVI 909

Query: 446 LGKEICLKCEISENIPGK---WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
            G+ + L+C IS   P     W +    ++ S   ++  +  I +L+I  A  ED G +
Sbjct: 910 EGESVTLECHIS-GYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRF 967



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 774 KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 833
           + K TI  +         +KA N +G +     +  +LVK    PP     + L+   +R
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATS---TAELLVKAETAPPNF--VQRLQSMTVR 116

Query: 834 RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI--IFIRKAERSHSGKY 891
           + G  V L +   G P P + + +DGAEI ++ ++ + S+   +  + I +A    SG Y
Sbjct: 117 Q-GSQVRLQVRVTGIPTPVVKFYRDGAEI-QSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174

Query: 892 DLQV--KVDKFVETASIDIQ 909
            +     V +   TA + +Q
Sbjct: 175 SVNATNSVGRATSTAELLVQ 194



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 105/543 (19%), Positives = 203/543 (37%), Gaps = 71/543 (13%)

Query: 3     EPTKKEENEVP-APAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFI 61
             +P K EE   P  P  PPE PS   E         +L  + P     K +  S+++  +I
Sbjct: 24007 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRP-----KDDGGSRVTGYYI 24061

Query: 62    EKPQGGTVK-VGEDITFIAKVKAEDLLRKPTIKWF------KGKWMDLASKAGKHLQLKE 114
             E+ +  T K V  + T I           P  ++           +   S A + +  K+
Sbjct: 24062 ERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD 24121

Query: 115   TFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSA 174
              F++ S+    E+  I                    DS +   E  E  G    +     
Sbjct: 24122 PFDKPSQPGELEILSISK------------------DSVTLQWEKPECDGGKEILGYWVE 24163

Query: 175   FKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF---QYGI 231
             +++SG+               ++  K++ ++ Q  +  LL+    +EYE   F   + G+
Sbjct: 24164 YRQSGDSAW------------KKSNKERIKDKQFTIGGLLE---ATEYEFRVFAENETGL 24208

Query: 232   TDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQE 291
             +  R     +K      +      ++ D   ++ +  ++   + +  P  ++KWY+ G+E
Sbjct: 24209 SRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQI-VGRPLPDIKWYRFGKE 24267

Query: 292   IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVT-- 345
             +  S KY     G    L +   +  D+  Y   A    G+ + S++L ++  P      
Sbjct: 24268 LIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGY 24327

Query: 346   KQLEDTTAYCGERVELE-CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEG 404
                E      G  + L    +      + WF +G++++   ++      E   H+++   
Sbjct: 24328 PLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNV 24386

Query: 405   ATKADAAEYSVMTTG--GQSSAKLSVDL--KPLKILTPLTDQTVNLGKEICLKCEISENI 460
               K  A +Y V  +   G   A L V++  KP K   P+  + + L     +  +   + 
Sbjct: 24387 QRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEAL-LKNSAVISWKPPADD 24445

Query: 461   PGKWTKNGL----PVQESDRLKVVHKG-RIHKLVIANALTEDEGDY--VFAPDAYNVTLP 513
              G W  N +      +E    ++V     +    I N LTE+ G Y  V A + + ++ P
Sbjct: 24446 GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVN-LTENAGYYFRVSAQNTFGISDP 24504

Query: 514   AKV 516
              +V
Sbjct: 24505 LEV 24507



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 43/147 (29%), Positives = 59/147 (40%), Gaps = 10/147 (6%)

Query: 279   PKLEVKWYKNGQE-IRPSTKY-IFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
             PK  VKWY+ G+E I    KY I E KG    L I +    D + Y V A    G    +
Sbjct: 24650 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGT 24709

Query: 333   TELFVREP-PIMVTKQLED---TTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               L V  P  I + K LE      A  GE V ++   S     V  ++ G+++I      
Sbjct: 24710 ASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHY 24769

Query: 389   YRIRVEGKKHILIIEGATKADAAEYSV 415
               I       ++   G  + DA  Y V
Sbjct: 24770 QVIVTRSFTSLVFPNGVERKDAGFYVV 24796



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 3/96 (3%)

Query: 829 QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ---INIRNSETDTIIFIRKAER 885
           Q+ +   G          G P PE++W +DG  I  +    + I  S+    + I    +
Sbjct: 13  QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72

Query: 886 SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 921
           ++SG+Y L+        T++ ++ +     PP  V+
Sbjct: 73  ANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQ 108



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 1046 ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVN 1105
            AT  C     P  K+ W K+ + + +  +YRM S++ V  L I      D   Y C  V 
Sbjct: 2146 ATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2204

Query: 1106 D 1106
            D
Sbjct: 2205 D 2205



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 105  KAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTG 164
            KAG+ +   +     S  Y   ++I++ +    G Y C+ + +    SC+  L V     
Sbjct: 4564 KAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV----- 4618

Query: 165  TTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPS 220
            T P  + +          E   E+    +L++R    +EEEP+V+  +L K  KP+
Sbjct: 4619 TVPGGEKKVRKLLPERKPEPKEEVVLKSVLRKR---PEEEEPKVEPKKLEKVKKPA 4671



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 862
             PP+  +P + K  Y   VGE V   +     P P +TW K G +I
Sbjct: 25384 PPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQKI 25425



 Score = 32.0 bits (71), Expect = 3.4
 Identities = 27/97 (27%), Positives = 39/97 (40%), Gaps = 5/97 (5%)

Query: 249  KKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
            K++A   K      +V  G   +F  E+   P +  +W+K G+EI  S K          
Sbjct: 4525 KRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYIS 4584

Query: 308  ILFINNCQMTDDSEYYVTAGDE----KCSTELFVREP 340
             L I   Q+ D  EY   A +E     C+  L V  P
Sbjct: 4585 SLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVP 4621



 Score = 31.6 bits (70), Expect = 4.4
 Identities = 26/88 (29%), Positives = 33/88 (37%), Gaps = 4/88 (4%)

Query: 1034 PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1093
            PL +   I G  A L C V       + W  N   I  D R +         L I +   
Sbjct: 2404 PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHA 2463

Query: 1094 YDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
             D G Y  K +  +G VE  C L V+ I
Sbjct: 2464 SDEGPY--KLI--VGRVETNCNLSVEKI 2487



 Score = 31.2 bits (69), Expect = 5.8
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 262   YQVDKGGRVRFVVE-LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDS 320
             Y +  G  ++  +  +  P+  + W K+G+ ++ +T+   E      +L I      D  
Sbjct: 18016 YSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFG 18075

Query: 321   EYYVTA 326
             +Y VTA
Sbjct: 18076 KYTVTA 18081


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  299 bits (766), Expect = 9e-81
 Identities = 218/756 (28%), Positives = 346/756 (45%), Gaps = 52/756 (6%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F  +L+  K  VKWY+NG+EI+   KY FE  G    L I +C++ D+ EY     D K 
Sbjct: 6470 FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS 6529

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
               LFV E P+ + +  +D     G  V    E+++D   V+W +N   ++ G K  +++
Sbjct: 6530 RARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDK--HQM 6587

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
              EGK H L I      D  EY  +    ++ AKL +   P KI T   D  V++GK + 
Sbjct: 6588 MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVGKPLT 6646

Query: 452  LKC--EISENIPGKWTKNGLPV----------QESDRL---KVVHKGRIHKLVIANALTE 496
            +    +       +W K   P+          Q S R+   K   KGR +K+V+ N   +
Sbjct: 6647 MVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGR-YKIVLQNKHGK 6705

Query: 497  DEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             EG                + VID P  + +    + T T      L  E P++      
Sbjct: 6706 AEGFI-------------NLKVIDVPGPVRN---LEVTETFDGEVSLAWEEPLTDGGSKI 6749

Query: 557  AMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHAS 611
              +    + I   +  + T+        V  + +     ++ ++ +N  G     E    
Sbjct: 6750 IGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNP 6809

Query: 612  IKVKV-VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLN 670
            ++ +   D P PP+  T+T+V      + WEPP YDGG+ I  Y IE + K S RW    
Sbjct: 6810 VEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 6869

Query: 671  FDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTSPPTLLTV 726
                ++ +     ++EG  Y  R+ A N IG+ KPS  + PFV    P+   SPP  LT 
Sbjct: 6870 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLTS 6928

Query: 727  DSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDA 786
               T ++V ++W PP   G + + GY++E C EG ++WI  N  L+ +  + +TGL    
Sbjct: 6929 SDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGN 6988

Query: 787  KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 846
            K   RV A N AG S+P     P+   +    P + +    K      V   + +++P  
Sbjct: 6989 KYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSA-FKDGLEVIVPNPITILVPST 7047

Query: 847  GKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 905
            G PRP  TW      ++  +++ ++       + I  +ERS  G Y L  K++  V+T S
Sbjct: 7048 GYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTL--KLENRVKTIS 7105

Query: 906  --IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 963
              ID+ +I RP  P+ +K  D+  ++V LTW PP DDG + +TGY ++K +     W  V
Sbjct: 7106 GEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV 7165

Query: 964  IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 999
            ++       T+ +LV G EY F+V + N CG  E A
Sbjct: 7166 MDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 7201



 Score =  288 bits (737), Expect = 2e-77
 Identities = 165/503 (32%), Positives = 269/503 (53%), Gaps = 17/503 (3%)

Query: 511   TLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             TLP  V     I+PP+I LD  D    V + A   LRL + I G P P+  W + +  + 
Sbjct: 18719 TLPGSVVAQERIEPPEIELDA-DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 18777

Query: 568   EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
             +   R + E     + LVID   R DSG Y++ L+N +G   A + V+V+D P  PV  T
Sbjct: 18778 D---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLT 18834

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             + EV  D   ++WEPP  DGG+ I  Y +E+++     +  +  + C +TTF  + + EG
Sbjct: 18835 IREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEG 18893

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
              +Y  R+ A N  GI  P+  + P        PP  +T+  VT  T T++W  P+  G +
Sbjct: 18894 CSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGS 18953

Query: 748   GLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 807
              + GYV+E   +G+E W    +  +   + TI+GL    +   RV AVN  G S+P+   
Sbjct: 18954 KITGYVVEMQTKGSEKWSTCTQ--VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLG 19011

Query: 808   QPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQ 866
              P++ ++I   P + +P H   T+  +  E + + +PF+G+P+  + W+KDG  + +  +
Sbjct: 19012 VPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTR 19068

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
             +N+ +S+T T + I++A +   G Y+L V       T  I I ++DRPGPP  ++I++V 
Sbjct: 19069 VNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVS 19128

Query: 927   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFR 986
              +++ ++W PP+ DG   I+ Y ++K +  S  W  V +   RTS  I  L  G+EY FR
Sbjct: 19129 CDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFR 19188

Query: 987   VFSENMCGLSEDATMTKESAVIA 1009
             V +EN  G S   + ++ SAV+A
Sbjct: 19189 VCAENRYGKS---SYSESSAVVA 19208



 Score =  276 bits (707), Expect = 6e-74
 Identities = 176/570 (30%), Positives = 286/570 (50%), Gaps = 35/570 (6%)

Query: 438   PLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQ------ESDRLKVVHKGRIHKLVIA 491
             P+ D    +   I  KC++S    G+WT    P        E ++L   H+       I 
Sbjct: 16489 PIYDGGCEIQGYIVEKCDVSV---GEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAIN 16545

Query: 492   NALTEDEGDYVFAPDAYNVTLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIP 548
              A   +  D           +P  + V   ++ P I LD L+    + + AG  LRL +P
Sbjct: 16546 KAGVGEHAD-----------VPGPIIVEEKLEAPDIDLD-LELRKIINIRAGGSLRLFVP 16593

Query: 549   ISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEA 608
             I G P P+  W + D  I + +    T S+   ++LV+D   R DSG Y + L+N +G  
Sbjct: 16594 IKGRPTPEVKWGKVDGEIRDAAIIDVTSSF---TSLVLDNVNRYDSGKYTLTLENSSGTK 16650

Query: 609   HASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
              A + V+V+D P PPV   VTE+  D   + WEPP  DGGS I  Y +E+++     +  
Sbjct: 16651 SAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAA 16710

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             +  + C + +++  ++ EG +Y  R+ A N  GI  P+  + P     V  PP  +TVD 
Sbjct: 16711 VVTN-CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDD 16769

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKI 788
             VT  +V++ W  P+H G + +  Y++E   + +E W    +  +   +  IT L    + 
Sbjct: 16770 VTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECAR--VKSLQAVITNLTQGEEY 16827

Query: 789   FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 848
               RV AVN  G S+P+  + PI+ K+++  P +   +    +Y  +VG+ + + +P  G+
Sbjct: 16828 LFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV---KPAFSSYSVQVGQDLKIEVPISGR 16884

Query: 849   PRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASID 907
             P+P +TW KDG  + +  +IN+ +S   T + I++  +   G+Y + V      +TASI+
Sbjct: 16885 PKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIE 16944

Query: 908   IQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 966
             I  +D+P PP+  VK +DV  E++ L+W PP   G   IT Y +QK D  +  W  V   
Sbjct: 16945 IVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSAT 17004

Query: 967   YHRTSATITELVIGNEYYFRVFSENMCGLS 996
               RT+  +T+L  G EY FR+F+EN  G S
Sbjct: 17005 VARTTLKVTKLKTGTEYQFRIFAENRYGQS 17034



 Score =  272 bits (695), Expect = 1e-72
 Identities = 159/562 (28%), Positives = 280/562 (49%), Gaps = 19/562 (3%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++ P++ LD  +    + V AG   R+ IP  G P P+  WSR +    E + +++ E  
Sbjct: 17647 LEAPELDLDS-ELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEG---EFTDKVQIEKG 17702

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
              + + L ID  +R+D+G Y + L+N +G   A + VKV+D P PP    V EV  D   +
Sbjct: 17703 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFL 17762

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              WEPP  DGG+ +  Y I++++     +  ++   C +T+F+ + + EG  Y  R+ A N
Sbjct: 17763 VWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKTSFKVENLTEGAIYYFRVMAEN 17821

Query: 699   AIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
               G+  P             SPP  +T+  V+ T+ ++ W  P+H G + + GYV+E   
Sbjct: 17822 EFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 17881

Query: 759   EGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEP 818
             +GTE W +  +  +      +TGL +  +   RVKA N  G S+P+    P++ K++   
Sbjct: 17882 KGTEKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQ 17939

Query: 819   PKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTI 877
             P +++P +   TY  + GE + + IP  G+PRP ++W KDG  + +  ++N+  + T T+
Sbjct: 17940 PSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTV 17996

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENVALTWTP 936
             + I++  +   GKY +         T ++ + ++++PGPP   V+ ++V  + V ++W P
Sbjct: 17997 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEP 18056

Query: 937   PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 996
             P   G   I+ Y ++K D  +  W  V     RT+  IT+L  G EY FR+F+EN  G S
Sbjct: 18057 PAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKS 18116

Query: 997   EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT--LNCSVRG 1054
               A +  ++ ++      +K P      F  +    Q LV  +       T  +   +  
Sbjct: 18117 --APLDSKAVIVQYP---FKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQ 18171

Query: 1055  NPKPKITWMKNKVAIVDDPRYR 1076
               K  I W+K     + D +++
Sbjct: 18172 KEKNSILWVKLNKTPIQDTKFK 18193



 Score =  258 bits (658), Expect = 3e-68
 Identities = 148/478 (30%), Positives = 252/478 (52%), Gaps = 12/478 (2%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PP+I LD  D    VT+ A   LRL +PI G P P+  W+R     ++ +    T SY  
Sbjct: 15485 PPEIELDA-DLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSY-- 15541

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              + L++    R DSG Y + ++N +G   A + V+V+D P PP    V EV      + W
Sbjct: 15542 -TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTW 15600

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGGS I  Y +E+++     +  +  + C +T+++  ++ EG +Y  R+ A N  
Sbjct: 15601 DPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENEY 15659

Query: 701   GISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
             GI  P+  +          PP  +T+  VT  +V++ W  P+H G + + GY++E   +G
Sbjct: 15660 GIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKG 15719

Query: 761   TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             ++ W  A    +  T+ TITGL    +   RV A N  G S+P+  S P++ K+++ PP 
Sbjct: 15720 SDKW--ATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPA 15777

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIF 879
              ++   L  T+    GE + + +PF G+P P +TW KD   + +  ++N  ++E ++++ 
Sbjct: 15778 FKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLT 15834

Query: 880   IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPK 938
             I+ A R   G Y +++         ++++ ++D+PGPP   VK+++V  +++ L+W PPK
Sbjct: 15835 IKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPK 15894

Query: 939   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 996
              DG ++I  Y ++K D  +  W  V     RT+     L  G EY FR+ +EN  G S
Sbjct: 15895 YDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKS 15952



 Score =  255 bits (651), Expect = 2e-67
 Identities = 157/482 (32%), Positives = 251/482 (52%), Gaps = 13/482 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P + LD    D  V V AG  +R+   +SG+PPP   W+  ++ + + +     E+   S
Sbjct: 10150 PDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAIS 10205

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-VGDDWCIMNW 640
             S++VI   +R   GVY +  KNEAGE   +I V V+D P P   P +   + ++ C + W
Sbjct: 10206 SSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTW 10265

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGGSPI  Y IE+++     W  + + + ++     + +I+G AY  RI A N+I
Sbjct: 10266 FSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSI 10324

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+      S   V   P+ V   P  L V  VT  TVT+ W PP + G + +  YVLE  
Sbjct: 10325 GMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESR 10384

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
               GTE +     D +   K+T+ GL        RV AVN  G  +P + ++PI  K+ + 
Sbjct: 10385 LIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELA 10444

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDT 876
             PP + +    K T   RVGEA  L   + GKP+P+++W KD A++ + ++ +I+ +    
Sbjct: 10445 PPTLHLDFRDKLTI--RVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10502

Query: 877   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENVALTWT 935
              +   KA+RS SGKY + V+           + ++DRPGPP   V  ++V  + + ++W 
Sbjct: 10503 ALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWK 10562

Query: 936   PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             PP DDG + IT Y I+K +     W  V     +T+  +++L+ G +Y FR+ +EN+ G+
Sbjct: 10563 PPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIHAENLYGI 10622

Query: 996   SE 997
             S+
Sbjct: 10623 SD 10624



 Score =  255 bits (651), Expect = 2e-67
 Identities = 143/470 (30%), Positives = 242/470 (51%), Gaps = 16/470 (3%)

Query: 534   TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSS----TLVIDIA 589
             T+ V AG    + +P  G P P  +WS+ D  +       RT +Y D++    +L I+ A
Sbjct: 19823 TLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-------RTRAYVDTTDSRTSLTIENA 19875

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R+DSG Y + ++N    A  ++ VKV+D P PP   TV +V  +  +++W+ P  DGG+
Sbjct: 19876 NRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGA 19935

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y IE+++     W+ +  + C   +++   + EG  Y  R+   N  G+  P+   
Sbjct: 19936 PVKNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETK 19994

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANK 769
                      SPP  L V S++  +V++ W  P+H G + +  YV+E   +G ++W+    
Sbjct: 19995 EGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC-- 20052

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 829
              +   T   ++GL  +++ F RV A N AG S+P+    P+L+KE +EPP+I +      
Sbjct: 20053 AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNFPSH 20112

Query: 830   TYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHS 888
             T   R G  + + IP  GKP P++T  +DG  +    + N   +  +  I ++++  + +
Sbjct: 20113 TVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADA 20172

Query: 889   GKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITG 947
             G+Y++          A I+I ++DRPGPP   V I D+  E+V L W PPK DG + +T 
Sbjct: 20173 GRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTN 20232

Query: 948   YTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             Y + K +  +  W  V     RT   + +L  G EY FR+ +EN  G+S+
Sbjct: 20233 YILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGISD 20282



 Score =  252 bits (644), Expect = 1e-66
 Identities = 152/470 (32%), Positives = 240/470 (51%), Gaps = 10/470 (2%)

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             D   TVT+ AG  LRL + +SG PPP   WS+    +   +    TESY   S L++D  
Sbjct: 23079 DLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY---SLLIVDKV 23135

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R D+G Y I  +N++G+  A++ VKV D P P  +  V EV  D   + WE P  DGG+
Sbjct: 23136 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23195

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y +E K++ + R  +     C +T +    ++EG  Y  R+   N  GI +P   S
Sbjct: 23196 PVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETS 23254

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDW--IVA 767
                +   V   P  L V  VT +TVT+ W  P + G + L GYVLE C  GTE W  +V 
Sbjct: 23255 DAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVT 23314

Query: 768   NKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHL 827
              K  +   + T+T L    +   R++A N  G SEP+     + V+++   P I +    
Sbjct: 23315 LKPTV--LEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMP 23372

Query: 828   KQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERS 886
             ++T     G  V LVIP  G+P P  +W   G+++ +  ++ +        + IR+    
Sbjct: 23373 QKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIR 23432

Query: 887   HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAI 945
              +G+Y L++K      + +I + I+D+PGPP   +KI+++   ++ ++W PP+ DG A +
Sbjct: 23433 DTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPELDGGAPL 23492

Query: 946   TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             +GY +++ D     W  V E   R++   T L  GNEY FRV + N  G+
Sbjct: 23493 SGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGI 23542



 Score =  249 bits (636), Expect = 1e-65
 Identities = 151/508 (29%), Positives = 245/508 (48%), Gaps = 22/508 (4%)

Query: 508  YNVTLPAKVHVIDPPKIILDGLDADNT--------------VTVIAGNKLRLEIPISGEP 553
            Y V+   K  V DP +I L  L AD+               + VI  N + + +P +G P
Sbjct: 6992 YRVSAENKAGVSDPSEI-LGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYP 7050

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
             P A W  GDK ++E   R++ ++    + LVI  +ER D G+Y + L+N        I 
Sbjct: 7051 RPTATWCFGDK-VLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEID 7109

Query: 614  VKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL 673
            V V+  P  P      ++  D   + WEPP  DGGSP+ GY +E+++     W ++  D 
Sbjct: 7110 VNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDF 7168

Query: 674  CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPF---VPLAVTSPPTLLTVDSVT 730
              +  F    +++G  Y  ++ A N  G  +P+    P     P  V  PP  +     T
Sbjct: 7169 VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRT 7228

Query: 731  DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFV 790
              ++ + W PP + G + + GY++E C  G++ W+   +  + +TK  +TGL        
Sbjct: 7229 ANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEP-VAETKMEVTGLEEGKWYAY 7287

Query: 791  RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPR 850
            RVKA+N  GAS+P   ++ I   +  E P+I +   L      + G  + L     GKP 
Sbjct: 7288 RVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPE 7347

Query: 851  PELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQ 909
            P++TW K    + ++ +I I N    + + I  ++RS +G Y ++        TA +++ 
Sbjct: 7348 PKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVN 7407

Query: 910  IIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 969
            ++D+PGPP    I DV  E+  LTW PP+DDG + IT Y +++    S  W  +      
Sbjct: 7408 VLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKD 7467

Query: 970  TSATITELVIGNEYYFRVFSENMCGLSE 997
            T+   T+L+   EY FRV +ENM G+ E
Sbjct: 7468 TNFKATKLIPNKEYIFRVAAENMYGVGE 7495



 Score =  247 bits (631), Expect = 4e-65
 Identities = 170/584 (29%), Positives = 278/584 (47%), Gaps = 33/584 (5%)

Query: 436   LTPLTDQTVNL--GKEICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIA 491
             L+ +  +T+++  G+ + L   I+   P    W   G  ++ES+R+ V    ++ KL I 
Sbjct: 23368 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIR 23427

Query: 492   NALTEDEGDYVFAPDAYNVTLPA----KVHVIDPP-----KIILDGLDADNTVTVIAGNK 542
                  D G+Y    +  NVT       KV ++D P      I +D +DA +        +
Sbjct: 23428 ETTIRDTGEYTL--ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPE 23485

Query: 543   LRLEIPISG-----EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
             L    P+SG         +  W    +++   + +    +  +     +    R   G Y
Sbjct: 23486 LDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 23545

Query: 598   HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
                L++E  E  +SI++     P PP    + +V  D   + W PP  DGGS + GY +E
Sbjct: 23546 ---LQSEVIECRSSIRI-----PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVE 23597

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK+ ++ RW+R+N      T +    + EG+ YE R+ A+NA G  KPS PS+P V +  
Sbjct: 23598 RKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDP 23657

Query: 718   TSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774
              +PP       VTDTT   V++ W  P+  G + + GY++E       +W   N      
Sbjct: 23658 IAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKI 23717

Query: 775   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834
              ++T+T LP  A+   RV A NA G  EP      + V E++E P   +    ++    R
Sbjct: 23718 REYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIFVR 23777

Query: 835   VGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894
              G  + L IP +GKP P   W K+G +I K  + I  SET T + I++A+R  SG YDL 
Sbjct: 23778 QGGVIRLTIPIKGKPFPICKWTKEGQDISKRAM-IATSETHTELVIKEADRGDSGTYDLV 23836

Query: 895   VKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 953
             ++     +   I +++I  P  P+  ++ +D+   +V ++W PP DDG A I GY +++ 
Sbjct: 23837 LENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERR 23896

Query: 954   DKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             +     W+T+      TS  +  L    EY+FRV +EN  G+S+
Sbjct: 23897 EVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISK 23940



 Score =  245 bits (626), Expect = 1e-64
 Identities = 153/493 (31%), Positives = 238/493 (48%), Gaps = 17/493 (3%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG--DKAIMEGSGRIRT 575
             +++PP+I LD       V V AG  +RL   + G P PK  W +   D  + +G    + 
Sbjct: 12228 ILEPPEIDLDA-SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG----QV 12282

Query: 576   ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
             +     + LVI  + RDDSG Y + L N AGE    + V+V+D P P     V++V    
Sbjct: 12283 DLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTS 12342

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++W PP  DGGS +  Y +E+++     W  +  ++ K+T+F    ++ G  Y  R+ 
Sbjct: 12343 CHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNLVPGNEYYFRVT 12401

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             AVN  G   P+   +P +   PL+   PP  L V  +T  + T+ W PP   G A +DGY
Sbjct: 12402 AVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 12461

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
             +  Y  E           ++      +TGL    K   RV A NA G S P+        
Sbjct: 12462 ITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEA 12521

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE-IDKNQINIRN 871
             KE + PPKI +P  +      + G+ + +     GKP P   WKK   E +  + + +  
Sbjct: 12522 KEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHK 12577

Query: 872   SETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENV 930
             +++ +I+ I+   R  SG Y L  +     +T  I + ++D PGPPQ    I D+  +  
Sbjct: 12578 ADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC 12637

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 990
             +L+W  P +DG + IT Y ++K D    +W T +    +TS  + +L+ G EY FRV +E
Sbjct: 12638 SLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAE 12697

Query: 991   NMCGLSEDATMTK 1003
             N  G+SE  T  K
Sbjct: 12698 NRFGISEPLTSPK 12710



 Score =  243 bits (621), Expect = 6e-64
 Identities = 152/515 (29%), Positives = 259/515 (50%), Gaps = 25/515 (4%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP+  LD  D   T+ + AG  +RL +P+ G PPPK  WS+ +  + +  G +  +S
Sbjct: 13315 ILIPPEGELDA-DLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIG-LDIKS 13372

Query: 578   YPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCI 637
                 + L  +   + D+G Y + L+N  G+   +I VKV+D P PPV  TV E+  D   
Sbjct: 13373 TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAY 13432

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + WEPP  DGGSPI+ Y ++++  +   W  +  + C +T+F    + EG +Y  R+FA 
Sbjct: 13433 VTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAE 13491

Query: 698   NAIGISKPSMPSRPFVPLAVTSPPTL-LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             N  GI  P   +R  V  + T  P + L V SV+ ++ ++ W+ P   G + + GYV+++
Sbjct: 13492 NEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 13550

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
               E  + W    K L    +++   L    +   RV A N  G   P   +  ++ ++ +
Sbjct: 13551 LTEENK-WQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT--VVARDDV 13605

Query: 817   EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-DGAEIDKNQINIRNSETD 875
               P + +       Y+ +      L IP +GKP P ++WKK +       ++++ +S  +
Sbjct: 13606 VAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVN 13665

Query: 876   TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-PPQIVKIEDVWGENVALTW 934
             T + +   ++S +GKY + +K     +  +I I+++ +PG P   +K ++V  E + L W
Sbjct: 13666 TTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKW 13725

Query: 935   TPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
              PPKDDG + IT Y ++K D  + +W T      +T+  +T L  G EY FRV +EN  G
Sbjct: 13726 APPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYG 13785

Query: 995   LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1029
             + E     K   ++AR            FD  +AP
Sbjct: 13786 VGEG---LKSEPIVAR----------HPFDVPDAP 13807



 Score =  243 bits (620), Expect = 7e-64
 Identities = 202/709 (28%), Positives = 322/709 (45%), Gaps = 69/709 (9%)

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKW----FKNGEEIIP---- 383
             S  L +REP I V ++ ED        +E++ EV+++   + W    +  G EII     
Sbjct: 10333 SEALVIREP-ITVPERPED--------LEVK-EVTKNTVTLTWNPPKYDGGSEIINYVLE 10382

Query: 384   ----GPKSRYRIRVEGK-KHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTP 438
                 G +  +++  +        ++G  + D  EY V         K S   KP+     
Sbjct: 10383 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 10442

Query: 439   LTDQTVNLGKEICLKCEISE------NIPGK------WTKNGLPVQESDRLKVVHKGRIH 486
             L   T++L     L   + E         GK      W K+   V E DR  +       
Sbjct: 10443 LAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10502

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVIDPPKIILDGLDADNTVTVIAGNK 542
              L    A   D G Y    +  N T   K    V+V+D P   +  +  D          
Sbjct: 10503 ALEKIKAKRSDSGKYCVVVE--NSTGSRKGFCQVNVVDRPGPPVGPVSFDEVT------- 10553

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR------TESYPDSSTLVIDIAERDDSGV 596
              +  + IS +PP     S+    I+E     +      T +   ++  V  + E  D  +
Sbjct: 10554 -KDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY-I 10611

Query: 597   YHINLKNEAG--EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 651
             + I+ +N  G  +   S  +K  D    PD P  P VTEV  D  ++ W  P +DGG PI
Sbjct: 10612 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPI 10670

Query: 652   LGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
               Y +E+++  S RW R+  D +   T F    ++EG  YE R+ A N IGI  PS PS+
Sbjct: 10671 TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK 10730

Query: 711   PFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVA 767
             P     P+A  SPP        T  +V + W+PP H G + + GY++EY   G E+W  A
Sbjct: 10731 PVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRA 10790

Query: 768   NK--DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
             N   +   +TK+ +TGL        RV AVNAAG S+P +  +P+LVK+ +EPP++ +  
Sbjct: 10791 NHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDA 10850

Query: 826   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAER 885
             ++ +    +VG+ + L    +G P P++TWKK+  +    +  I  +   + + IR A  
Sbjct: 10851 NMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAP-TKARIDVTPVGSKLEIRNAAH 10909

Query: 886   SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945
                G Y L V+     +T S+ + ++D+PGPP+ +++ ++  ++  LTW  P DDG + I
Sbjct: 10910 EDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVI 10969

Query: 946   TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
             T Y +++ D  S +W  +     + S     L  GN+Y FRV +EN  G
Sbjct: 10970 TNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYG 11018



 Score =  243 bits (620), Expect = 7e-64
 Identities = 166/560 (29%), Positives = 272/560 (48%), Gaps = 26/560 (4%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH--VIDP 521
             W K+G+ ++E  R +++       L + + +  D G YV        T    V+  V+D 
Sbjct: 19451 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 19510

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + ++GL A+         +      I      K   S     I EG  ++   
Sbjct: 19511 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQM--- 19567

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEV 631
                 +S  V  + + ++  ++ +   N+   GE   S+ +K +D    P PP +  +T V
Sbjct: 19568 ----TSCKVTKLLKGNEY-IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSV 19622

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               +   + W  P  DGGS I GY IER++K S RW+R+N     +   +   + EG  YE
Sbjct: 19623 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 19682

Query: 692   VRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAG 748
              R++A NA G+S PS  S   R   P+ + SPP+   +     TT+T+ W  P   G A 
Sbjct: 19683 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19742

Query: 749   LDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 808
             + GY +EY      DW  + + L   T++TI+GL T A+   RVK+VN  GAS+P   S 
Sbjct: 19743 ITGYTVEYKKSDDTDWKTSIQSLRG-TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 19801

Query: 809   PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN 868
             P + KE  E P   I   +++T I + G +  + +PF+G+P P + W K   ++ + +  
Sbjct: 19802 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-RTRAY 19860

Query: 869   IRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGE 928
             +  +++ T + I  A R+ SGKY L ++      + ++ ++++D PGPP  + ++DV  E
Sbjct: 19861 VDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKE 19920

Query: 929   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 988
             +  L+W  P++DG A +  Y I+K +     W +V  + +R S  +T L  G  YYFRV 
Sbjct: 19921 SAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVS 19980

Query: 989   SENMCGLSEDATMTKESAVI 1008
              EN  G+   A  TKE   I
Sbjct: 19981 GENEFGVGIPAE-TKEGVKI 19999



 Score =  241 bits (614), Expect = 4e-63
 Identities = 135/381 (35%), Positives = 198/381 (51%), Gaps = 3/381 (0%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT V  D   ++W  P  DGGSPILGY +ERK++    W  ++  L     F
Sbjct: 14887 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIF 14946

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   + +G+AYE R+ A N  G SKPS PS P + L    PP      ++T  TVT++W 
Sbjct: 14947 KSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWA 15006

Query: 740   PPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 799
              P++ G   +  Y++E        W+ AN   I + +FT++GL  DA    RV A NAAG
Sbjct: 15007 KPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAG 15066

Query: 800   A-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 858
             A S P   S  I  ++ +E PKI++    K T I + GEA  L     G+P P + W KD
Sbjct: 15067 AISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKD 15126

Query: 859   GAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
             G E++   ++ I+ ++  T +  + + R  SG Y L             +++++DRPGPP
Sbjct: 15127 GKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPP 15186

Query: 918   Q-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE 976
             +  + + +V  E   L+W PP DDG A I  Y +QK +   + W  V      T   +T+
Sbjct: 15187 EGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTK 15246

Query: 977   LVIGNEYYFRVFSENMCGLSE 997
             L+ GNEY FRV + N  G+ E
Sbjct: 15247 LLKGNEYIFRVMAVNKYGVGE 15267



 Score =  240 bits (613), Expect = 5e-63
 Identities = 159/591 (26%), Positives = 282/591 (47%), Gaps = 40/591 (6%)

Query: 429   DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
             D+KP       +  +V +G+++ ++  IS        WTK+GLP++++ R+ V     + 
Sbjct: 16859 DVKPA-----FSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT 16913

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPK--IILDGLDADNTVTVIA 539
              L I     +D G Y            A + ++     DPPK  +  D + A++      
Sbjct: 16914 TLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES------ 16967

Query: 540   GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT-----ESYPDSSTLVIDIAERDDS 594
                    I +S  PP      +    I++      T      +    +TL +   +    
Sbjct: 16968 -------ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTE 17020

Query: 595   GVYHINLKNEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
               + I  +N  G++ A     +V       P PP  P  T +  D  ++ W  P  +GGS
Sbjct: 17021 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 17080

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P++GY +ERK++ S  W ++N  +  +T F+ + + EG+ YE R++A N +G+ K S  S
Sbjct: 17081 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 17140

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANK 769
               +V      PP       V    +T++W  P + G + + GY++E        W+ A+ 
Sbjct: 17141 ECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASF 17200

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLK 828
               + +T+FT++GL  D +   RV A NAAGA S+P   + PI  K+ +E P+I +    +
Sbjct: 17201 TNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFR 17260

Query: 829   QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSH 887
              T +   GE   L     GKP P + W +   EI+++ +  I+N++   ++ ++ A R  
Sbjct: 17261 DTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRID 17320

Query: 888   SGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAIT 946
              G+Y L+       ++  ++++++DRPGPP+  V++  V  E  +LTW+PP  DG + I+
Sbjct: 17321 GGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDIS 17380

Query: 947   GYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
              Y ++K +   + W  V       S  +T+L+ GNEY FR+ + N  G+ E
Sbjct: 17381 HYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVGE 17431



 Score =  239 bits (611), Expect = 8e-63
 Identities = 148/495 (29%), Positives = 245/495 (49%), Gaps = 10/495 (2%)

Query: 506   DAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D+  VT   K V  +  P++ +D  +   T  V AG  +RL I   G P P A+WS+ D 
Sbjct: 21966 DSCEVTGTIKAVDRLTAPELDIDA-NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDS 22024

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
              +   +    T+S+   STL ++   R+D+G Y + ++N +G    +  VKV+D P PP 
Sbjct: 22025 NLSLRADIHTTDSF---STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPG 22081

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
               T  +V      + W+ P  DGG+ I  Y +E+++     W  ++ + C    F+   +
Sbjct: 22082 PITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDL 22140

Query: 685   IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
              EGV Y  R+ AVN  G+ +P     P V     +PP  L V   + ++  + W  PDH 
Sbjct: 22141 AEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHD 22200

Query: 745   GAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
             G + + GY+LE   +G++ W+ A      +  FT+  L    +   RVKA N AG SEP+
Sbjct: 22201 GGSRITGYLLEMRQKGSDFWVEAGH--TKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPR 22258

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-D 863
                  +++KE    P   +     Q    + G    + +P  G+P P++TWK +   + +
Sbjct: 22259 EAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE 22318

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP-PQIVKI 922
              ++++I  ++  T + ++ + R  SG+Y L ++    V+T S+ + +I RPGP    +++
Sbjct: 22319 TDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEV 22378

Query: 923   EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 982
               V  E+  L+W  PKD G   IT Y ++K +  +  W  V     RT   +T L    E
Sbjct: 22379 SSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTKYME 22438

Query: 983   YYFRVFSENMCGLSE 997
             Y FRV SEN  G+S+
Sbjct: 22439 YSFRVSSENRFGVSK 22453



 Score =  238 bits (608), Expect = 2e-62
 Identities = 155/491 (31%), Positives = 238/491 (48%), Gaps = 15/491 (3%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++PP++ILD   A     +  G+ LRL   I G P PK  W + D+   +   + R +  
Sbjct: 10841 LEPPELILDANMAREQ-HIKVGDTLRLSAIIKGVPFPKVTWKKEDR---DAPTKARIDVT 10896

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
             P  S L I  A  +D G+Y + ++N AG    S+KV V+D P PP    V+E+  D C +
Sbjct: 10897 PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYL 10956

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              W+ P  DGGS I  Y +ER+   S++W  L+    K++ F  K + EG  Y  R+ A N
Sbjct: 10957 TWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAEN 11015

Query: 699   AIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
               G     +   P +   PL    PP  L    V  T V++ W  PD  G + + GY++E
Sbjct: 11016 QYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVE 11075

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
             Y  EGT+DWI      +   +  +TGL        RVKA N  G   P   + PI  +E 
Sbjct: 11076 YQEEGTQDWI--KFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPD-TTIPIECQEK 11132

Query: 816   IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSET 874
             + PP + +   L +  + + G  V      +G P P   W  DG+EI  ++   +     
Sbjct: 11133 LVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNF 11192

Query: 875   DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALT 933
              +++ I+   R  +G+Y + V      +T ++ + ++D PGPP   + I DV  E++ ++
Sbjct: 11193 SSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTIS 11252

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMC 993
             W PPKDDG + +  Y ++K D +   W  V     +T   I  L  G EY FRV +EN  
Sbjct: 11253 WQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKI 11312

Query: 994   GLSE--DATMT 1002
             G+    D+T T
Sbjct: 11313 GVGPPLDSTPT 11323



 Score =  238 bits (607), Expect = 2e-62
 Identities = 169/593 (28%), Positives = 282/593 (47%), Gaps = 27/593 (4%)

Query: 241  LKRMRREEKKSAAFA-------KILDPAYQVDKGGR--VRFVVELADPKLEVKWYKNGQE 291
            L   R E  KSAA         +I++P   ++   +  V F  ++    + +KW KNG+E
Sbjct: 6341 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 6400

Query: 292  IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT 351
            +    +  +     + +L I +C   D+ EY VTAG +K   EL + E P    + LED 
Sbjct: 6401 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 6460

Query: 352  TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA 411
            T    +     C++S + ANVKW++NG EI  G K  Y+   +G  H LII+     D  
Sbjct: 6461 TVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK--YKFEKDGSIHRLIIKDCRLDDEC 6518

Query: 412  EYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLP 470
            EY+      +S A+L V+  P++I+ P  D     G ++    E++ + +  +W +N + 
Sbjct: 6519 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 6578

Query: 471  VQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD 530
            V + D+ +++ +G+IH+L I +    D+G+Y F   A +    AK+ +   PKI      
Sbjct: 6579 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI--AKDKEARAKLELAAAPKI----KT 6632

Query: 531  ADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAE 590
            AD  + V  G  L + +P    P  +A W + ++ +   +     ++  + ++  I  A+
Sbjct: 6633 ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEAK 6688

Query: 591  RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
            + D G Y I L+N+ G+A   I +KV+D P P     VTE  D    + WE P  DGGS 
Sbjct: 6689 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSK 6748

Query: 651  ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE-GVAYEVRIFAVNAIGISKPSMPS 709
            I+GY +ER+  +   W+ L  D  +   F    + + GV Y  R+ A N +G  +P    
Sbjct: 6749 IIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETD 6807

Query: 710  RPFVPLA---VTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV 766
             P    +   V  PP  +T+  V    V++ W PP++ G A +  YV+E   + +  W  
Sbjct: 6808 NPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDT 6867

Query: 767  ANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
            A     +    T+T +    +   RV+A N  G  +P   +  + V + IE P
Sbjct: 6868 AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERP 6920



 Score =  238 bits (607), Expect = 2e-62
 Identities = 172/634 (27%), Positives = 302/634 (47%), Gaps = 44/634 (6%)

Query: 386   KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
             K++Y+ R   +  + I   +  +D    +++         LSV +K L         TV 
Sbjct: 12887 KAQYQFRAIARTAVNISPPSEPSDPV--TILAENVPPRIDLSVAMKSLL--------TVK 12936

Query: 446   LGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              G  +CL   +  + +P   W K+G  ++ ++ +K+  +  +  L + +   +D GDY  
Sbjct: 12937 AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTI 12996

Query: 504   APDAYNVTLPA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR 561
               +  + +  A  K+ V+D P     G  A   +  +  ++  L    S EPP +   S 
Sbjct: 12997 TAENSSGSKSATIKLKVLDKP-----GPPASVKINKMYSDRAML----SWEPPLEDGGSE 13047

Query: 562   GDKAIMEGSGRIRTESYPDSSTLVI---DIAERDDSGVYHINL--KNEAGEA-----HAS 611
                 I++     R      S+T+ I    + +  +   Y   +  +N+ G         +
Sbjct: 13048 ITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPA 13107

Query: 612   IKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
             I     D P   DPPV   +T+   D   ++W+PPA DGGSPI GY +E+++ Q+  W +
Sbjct: 13108 IAKNPYDPPGRCDPPVISNITK---DHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK 13164

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLT 725
             +N     E T +   + EG  YE R+ A+N  G  KPS  S+      P     PP    
Sbjct: 13165 VNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPK 13224

Query: 726   VDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVAN-KDLIDKTKFTITGLPT 784
             V   T ++V++ W  P + G + + GY++E     +++W+  N    + KT+F +TGL  
Sbjct: 13225 VYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTRFEVTGLME 13284

Query: 785   DAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP 844
             D +   RV AVN  G S+P         K+I+ PP+  +   L++T I R G  + L +P
Sbjct: 13285 DTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVP 13344

Query: 845   FQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 903
              +G+P P++TW K    + D+  ++I++++ DT +      +  +GKY L ++     + 
Sbjct: 13345 VKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKE 13404

Query: 904   ASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 963
              +I ++++D PGPP  V ++++  ++  +TW PP  DG + I  Y +QK D +   W TV
Sbjct: 13405 YTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTV 13464

Query: 964   IEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
                  +TS  +  L  G  Y+FRVF+EN  G+ +
Sbjct: 13465 TTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD 13498



 Score =  238 bits (606), Expect = 3e-62
 Identities = 182/680 (26%), Positives = 309/680 (45%), Gaps = 62/680 (9%)

Query: 364   EVSEDDANVKWFK----NGEEII-------PGPKSRYRIRVEGKKHILIIEGATKADAAE 412
             +VS+  A++ W K     G  ++       P    ++ I  E K    ++ G +     +
Sbjct: 17851 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 17910

Query: 413   YSVMTTG--GQSSAKL--------SVDLKPLKILTPLTDQTVNLGKEICLKCEI----SE 458
             + V      G+S  ++         + ++P  +  P    ++  G+++ ++  +      
Sbjct: 17911 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQP-SLKLPFNTYSIQAGEDLKIEIPVIGRPRP 17969

Query: 459   NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKV 516
             NI   W K+G P++++ R+ V        L I     +D G Y       A   T    V
Sbjct: 17970 NI--SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSV 18027

Query: 517   HVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              V++ P      +  D + AD  V             IS EPP      +    I+E   
Sbjct: 18028 IVLEKPGPPVGPVRFDEVSADFVV-------------ISWEPPAYTGGCQISNYIVEKRD 18074

Query: 572   RIRTESYPDSSTLV---IDIAERDDSGVYHINL--KNEAGE-AHASIKVKVVDFP----D 621
                T  +  S+T+    I I +      Y   +  +N  G+ A    K  +V +P     
Sbjct: 18075 TTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPG 18134

Query: 622   PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
             PP  P VT +  D  ++ W  P  DGG+ I+GY +E+K+K S  W++LN    ++T F+ 
Sbjct: 18135 PPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKT 18194

Query: 682   KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
               + EG+ YE ++ A N +GI KPS  S  FV      PP       +T   VT++W+ P
Sbjct: 18195 TGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKP 18254

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG-A 800
              + G + + GY++E        W+ A+   + +T+FT++GL  D +   RV A NAAG  
Sbjct: 18255 AYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNF 18314

Query: 801   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
             SEP   S  I  ++ I+ P   +    K   +   GE   L    +GKP P++ W KDG 
Sbjct: 18315 SEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGK 18374

Query: 861   EIDKN--QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 918
             E+++   ++ I+++   T + ++   R+  G+Y L++      ++  I ++++DRPGPP+
Sbjct: 18375 ELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPE 18434

Query: 919   -IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               +K+  V  E   L W PP  DG A I+ Y I+K +   + W  V       +  +T+L
Sbjct: 18435 GPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKL 18494

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + GNEY FRV + N  G+ E
Sbjct: 18495 LPGNEYIFRVMAVNKYGIGE 18514



 Score =  234 bits (598), Expect = 3e-61
 Identities = 141/476 (29%), Positives = 240/476 (50%), Gaps = 11/476 (2%)

Query: 529   LDAD--NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
             LDA+   T+ V AG  +R+ +PI G P P+  W++ +  +   +    TES+   + L+I
Sbjct: 14406 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESF---TLLII 14462

Query: 587   DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
                 R D+G + + ++N AG+    + V+V+D P P +    T++  D   ++W+ P  D
Sbjct: 14463 PECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLID 14522

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I  Y +E+++     +       C + T++   + EG  Y  R+ A N  GI +P+
Sbjct: 14523 GGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPT 14581

Query: 707   MPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV 766
               + P       SPP  L +  +T +TV++ W  P H G + + GYV+E   +G++ W  
Sbjct: 14582 ETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-- 14639

Query: 767   ANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRH 826
              +   +   +  +  L    +   +V AVN+AG S P+  S+P++VKE    P++ +   
Sbjct: 14640 THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESRPVIVKEQTMLPELDLRGI 14698

Query: 827   LKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAER 885
              ++  I + G+ + + IP  G+P+P +TWKK    + + Q +N   + T TI+ I +  R
Sbjct: 14699 YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVR 14758

Query: 886   SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAA 944
             S SG Y L  +         I IQ+ D PGPP   +K ++V  + V  +W PP++DG   
Sbjct: 14759 SDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVP 14818

Query: 945   ITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1000
             I+ Y ++     S  W  +     RT+   T L  G EY FRV ++N  G+    T
Sbjct: 14819 ISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGIT 14874



 Score =  233 bits (595), Expect = 6e-61
 Identities = 168/591 (28%), Positives = 280/591 (47%), Gaps = 38/591 (6%)

Query: 428   VDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             +DLK   +LT     T+ L  E  ++ +    +     K+   +  S R+K+  +    K
Sbjct: 11831 LDLKLSGVLTVKAGDTIRL--EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11888

Query: 488   LVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
               +  A   D G YV      A +    A V+V+D P     G   +  +  ++ ++   
Sbjct: 11889 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP-----GPVRNLKIVDVSSDRCT- 11942

Query: 546   EIPISGEPPPKAMWSRGDKAIMEG--SGRIRTESYPDS----STLVIDIAERDDSGVYHI 599
                +  +PP           I+E   + R+   +Y  +     T V  + E ++  ++ +
Sbjct: 11943 ---VCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEY-IFRV 11998

Query: 600   NLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
               +N+ G     E+   I     D P  P  P VT+V  +   + W PP YDGG  I GY
Sbjct: 11999 RAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGY 12058

Query: 655   FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV- 713
             F+E+K+K S+RW+ +N     E   + + ++    Y+ R+ A N IGI +PS+PSRP V 
Sbjct: 12059 FLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVA 12118

Query: 714   --PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC-----FEGTEDWIV 766
               P+    PPT   V   T  ++T+ W  P + G A + GYV+E           E W  
Sbjct: 12119 KDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGWKR 12178

Query: 767   ANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 825
              N    + + +FT+T L  + +   RV A N  G   P    + I  KEI+EPP+I +  
Sbjct: 12179 CNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDA 12238

Query: 826   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE--IDKNQINIRNSETDTIIFIRKA 883
              +++  I R G  + L    +G+P P++TW+K G +  + K Q+++   +T   + I  +
Sbjct: 12239 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDL--VDTMAFLVIPNS 12296

Query: 884   ERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA 943
              R  SGKY L +      +   ++++++D PGP   +K+ DV   +  ++W PP++DG +
Sbjct: 12297 TRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSCHVSWAPPENDGGS 12356

Query: 944   AITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
              +T Y ++K +     W TV     +TS  +T LV GNEYYFRV + N  G
Sbjct: 12357 QVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYG 12407



 Score =  233 bits (594), Expect = 8e-61
 Identities = 159/513 (30%), Positives = 252/513 (49%), Gaps = 34/513 (6%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS---RGDKAIMEGSGRI--- 573
            + P++ +D + A + +   AG+++R+   I G P PK+ W    +  KA+ +G   I   
Sbjct: 9434 EEPEVFID-IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 9492

Query: 574  -RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVG 632
             + E+  +SS ++I   +R  +G Y I  KN+AG+  A+ +VKV+D P PP    V+++ 
Sbjct: 9493 AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDIT 9552

Query: 633  DDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEV 692
               C ++W+ P  DGG  I GY IE++      W ++N D C  TTF    ++    Y  
Sbjct: 9553 RGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFF 9611

Query: 693  RIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGL 749
            R+ A N  GI  P    +      P+    PP  L +  +T  TV + W+PP + G + +
Sbjct: 9612 RVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPV 9671

Query: 750  DGYVLEYCF----EGT--EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 803
              Y++E C      GT  E W   NK  +++ +FT+  L    +   RVKAVNAAG S+P
Sbjct: 9672 THYIVE-CLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKP 9730

Query: 804  KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW------KK 857
                 P   +    PP I     LK+      G  VN+V   +G P P LTW      K 
Sbjct: 9731 SATVGPCDCQRPDMPPSI----DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKP 9786

Query: 858  DGAE---IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP 914
            D  E    D +   +   +T T++ I ++ RS +G Y +    +    +  + + ++ RP
Sbjct: 9787 DNKEPVLYDTHVNKLVVDDTCTLV-IPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRP 9845

Query: 915  GPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
            GPP   +K E V  + + L+W PPKDDG + IT Y I+K +     W  V       + T
Sbjct: 9846 GPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYT 9905

Query: 974  ITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1006
            I +L+ G+EY FR+ ++N  G+ E      E+A
Sbjct: 9906 IPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETA 9938



 Score =  230 bits (587), Expect = 5e-60
 Identities = 156/568 (27%), Positives = 267/568 (47%), Gaps = 24/568 (4%)

Query: 465   TKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKI 524
             +++G+P++ + R           + +  ++T D G Y       + T  A ++++     
Sbjct: 20139 SRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV----- 20193

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM---EGSGRIRTESYPDS 581
             +LD      T  V+  +     + +  EPP     S+    I+   E S  + TE     
Sbjct: 20194 VLDR-PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATV 20252

Query: 582   STLVIDIAERDDSGVYHINLKNE--------AGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             +  ++ + +      Y   +K E           A  ++K+     P PP  P VT V  
Sbjct: 20253 ARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTT-PGPPSTPWVTNVTR 20311

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             +   + W  P  +GGS ++GY +E K + S  W + N  + + T F+   +  G+ YE R
Sbjct: 20312 ESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFR 20371

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYV 753
             ++A NA G+ KPS PS P + +    PP  + +  ++  +V++ W+ P   G + + GY+
Sbjct: 20372 VYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYI 20431

Query: 754   LEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPILV 812
             +E        W  A+   + +T+F I+GL  +++   RV A NA G+ S P     PI  
Sbjct: 20432 VERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITC 20491

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
              +    P I +P    +    R G +V L     GKP P + W KD  E+  N +    +
Sbjct: 20492 IDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVEN 20551

Query: 873   ETD-TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-QIVKIEDVWGENV 930
              TD   I I+ A+R +SG Y+L+++      +A+I +QI+D+PGPP   ++ + V  E +
Sbjct: 20552 TTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKI 20611

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 990
              L W PP DDG A IT Y ++K +   + W  V EH      T T+++ GNEY FRV + 
Sbjct: 20612 TLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAV 20671

Query: 991   NMCGLSEDATMTKESAVIARDGKIYKNP 1018
             N  G+ E     +  +V+A++  +   P
Sbjct: 20672 NKYGIGEP---LESDSVVAKNAFVTPGP 20696



 Score =  230 bits (586), Expect = 6e-60
 Identities = 161/526 (30%), Positives = 248/526 (47%), Gaps = 48/526 (9%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            + P+I LD +     +TV AG K+ L   ++G+P PK  W++ D  I++   RI  E+ P
Sbjct: 7314 EAPEIFLD-VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM-ILKQDKRITIENVP 7371

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              ST+ I  ++R D+G Y I   N  G A A ++V V+D P PP A  +T+V ++ C++ 
Sbjct: 7372 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLT 7431

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W PP  DGGS I  Y +ER+   S  W +L+    K+T F+  K+I    Y  R+ A N 
Sbjct: 7432 WNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENM 7490

Query: 700  IGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+ +P  + P           PPT L    +T   VT+ W  PD  G + + GY +E  
Sbjct: 7491 YGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVERL 7550

Query: 758  FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
               T+ W+  NK  +  T + + GL    K   RV A N AG  +P   ++PIL+K+ I+
Sbjct: 7551 DPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAGPGKPSKSTEPILIKDPID 7610

Query: 818  PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK----DGAEIDKNQINIRNSE 873
            PP       +K                  GK    L W K     GA+I+   I +  + 
Sbjct: 7611 PPWPPGKPTVKDV----------------GKTSVRLNWTKPEHDGGAKIESYVIEMLKTG 7654

Query: 874  TDTIIFIRKAE-----------RSHSGKYDLQVK-VDKFVETASID-------IQIIDRP 914
            TD   ++R AE                +Y  +V+ V+K  E+   +        + +  P
Sbjct: 7655 TDE--WVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPP 7712

Query: 915  GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI 974
             PP+ +++ ++      L WT P+ DG + IT Y ++K D +   W TV      T  T+
Sbjct: 7713 SPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKCTV 7772

Query: 975  TELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1020
            T L  G+ Y FRV +EN  G S+   +  E +V+A+D      P Y
Sbjct: 7773 TPLTEGSLYVFRVAAENAIGQSDYTEI--EDSVLAKDTFTTPGPPY 7816



 Score =  230 bits (586), Expect = 6e-60
 Identities = 154/553 (27%), Positives = 257/553 (46%), Gaps = 32/553 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF--APDAYNVTLPAKVHVIDP 521
             W K+G  ++E+ R+ V     +  L I  A  ED G Y    +  A ++T+P  + V+D 
Sbjct: 19056 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19115

Query: 522   P----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             P     I +D +  D+             I IS  PP      +    I+E      T  
Sbjct: 19116 PGPPGPIRIDEVSCDS-------------ITISWNPPEYDGGCQISNYIVEKKETTSTTW 19162

Query: 578   YPDSSTLV---IDIAERDDSGVYHINL-------KNEAGEAHASIKVKVVDFPDPPVAPT 627
             +  S  +    I I        Y   +       K+   E+ A +       P PP  P 
Sbjct: 19163 HIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPK 19222

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             V        ++ W+ P  DGGS ++GY +E K++ S  W + N  L  +T  +   + EG
Sbjct: 19223 VVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEG 19282

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
             + YE R++A N  GI K S    P        PP    V ++T  +V+++W  P + G A
Sbjct: 19283 LMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGA 19342

Query: 748   GLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA-GASEPKYY 806
              + GY++E        W+  N   I +T F +T L  D +   RV A NAA   SEP   
Sbjct: 19343 KITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSES 19402

Query: 807   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN- 865
             + PI+VK+ +EPP++ +    +   + + GE + +     G+P P ++W KDG EI++  
Sbjct: 19403 TGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERA 19462

Query: 866   QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIED 924
             +  I +++  T++ ++   R  +G+Y L +K      + +++ +++D+PGPP   ++I  
Sbjct: 19463 RTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEING 19522

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY 984
             +  E  +L+W  P++DG A I  Y ++K +   + W         TS  +T+L+ GNEY 
Sbjct: 19523 LTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYI 19582

Query: 985   FRVFSENMCGLSE 997
             FRV   N  G+ E
Sbjct: 19583 FRVTGVNKYGVGE 19595



 Score =  229 bits (583), Expect = 1e-59
 Identities = 169/620 (27%), Positives = 271/620 (43%), Gaps = 26/620 (4%)

Query: 394   EGKKHILIIEGATKADAAEYSVMTTGGQSSAKL-SVDLKPLKILTPLTDQTVNLGKEICL 452
             EGK++   +    +      S +T   +       +DLK L  L  L  +  N   +I +
Sbjct: 13575 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 13634

Query: 453   KCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTL 512
             K + + ++   W K   P+    R+ V        L++ +    D G Y         T 
Sbjct: 13635 KGKPAPSV--SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 13692

Query: 513   PA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                  + V+  P I    +  D  VT  A       + +   PP     S     I+E  
Sbjct: 13693 EGTISIKVVGKPGIPTGPIKFDE-VTAEA-------MTLKWAPPKDDGGSEITNYILEKR 13744

Query: 571   GRIRTE-----SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV-----DFP 620
               +  +     S    +T  +          + ++ +N+ G         +V     D P
Sbjct: 13745 DSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 13804

Query: 621   DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE 680
             D P  P + +V  D   + W  P   GGSPI GY +E K++ S  W R N    +   F+
Sbjct: 13805 DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFK 13864

Query: 681   PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRP 740
                + EG+ YE R+ A+N  G+ KPS+PS P V L    PP    V ++T  +VT+ W  
Sbjct: 13865 VTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTE 13924

Query: 741   PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
             P + G   L GY++E     ++ W+ AN   + +  FT+T L    K   R++A N AGA
Sbjct: 13925 PKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGA 13984

Query: 801   -SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL-VIPFQGKPRPELTWKKD 858
              S P   ++ I+ K+  E P I +   +K     + G+ + L  I   GKP P+ +W K 
Sbjct: 13985 ISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKA 14044

Query: 859   GAEIDKNQI-NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
             G +I  + I  I ++ T +++ I+ A R  +G+Y +        +   + + ++D PGPP
Sbjct: 14045 GKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDVPGPP 14104

Query: 918   QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               V+I +V  E   LTWTPP +DG + I  Y ++K +   + W  V E         T+L
Sbjct: 14105 GPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSEDIQSCRHVATKL 14164

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + GNEY FRV + N  G  E
Sbjct: 14165 IQGNEYIFRVSAVNHYGKGE 14184



 Score =  228 bits (580), Expect = 3e-59
 Identities = 170/617 (27%), Positives = 288/617 (46%), Gaps = 47/617 (7%)

Query: 428   VDLKPLKILTPLTDQTV-NLGKEICLKCEISENIPG--KWTKNGLPVQESDRLKVVHKGR 484
             V+   +K+     D  +   G+   L+ ++S   P   +W+K+G  ++ + +L++     
Sbjct: 15084 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15143

Query: 485   IHKLVIANALTEDEGDYV--------FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                LV  ++   D G Y         FA   +NV       V+D P       +    VT
Sbjct: 15144 STNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVK------VLDRP----GPPEGPLAVT 15193

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAER 591
              +   K  L    S  PP     ++ D  I++     R       S    + L +    +
Sbjct: 15194 EVTSEKCVL----SWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLK 15249

Query: 592   DDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
              +  ++ +   N+ G     E+   + V     PDPP  P VT +  D  ++ W  P  D
Sbjct: 15250 GNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSD 15309

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I+ Y +ER+ K   RW++ N     +  ++   + EG  YE RI A NA GIS PS
Sbjct: 15310 GGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 15369

Query: 707   MPSRPFVPLAVT----SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTE 762
              P+ PF     T     PP    V   + +++++ W  P + G + + GY++E      +
Sbjct: 15370 -PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEED 15428

Query: 763   DW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 821
             +W IV     +  T +TITGL  + +  +R+ A+N+ G  EP         ++ + PP+I
Sbjct: 15429 EWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEI 15488

Query: 822   RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD-GAEIDKNQINIRNSETDTIIFI 880
              +   L++    R    + L +P +G+P PE+ W +D G  +DK   +I ++ + T++ +
Sbjct: 15489 ELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDK--ASIESTSSYTLLIV 15546

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 940
                 R  SGKY L V+     ++A ++++++D PGPPQ +K+++V   +V LTW PP  D
Sbjct: 15547 GNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLD 15606

Query: 941   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL---SE 997
             G + I  Y ++K +     + TV  + H+TS  + +L  G  YYFRV +EN  G+   +E
Sbjct: 15607 GGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAE 15666

Query: 998   DATMTKESAVIARDGKI 1014
              A   K S      GKI
Sbjct: 15667 TAESVKASERPLPPGKI 15683



 Score =  228 bits (580), Expect = 3e-59
 Identities = 151/547 (27%), Positives = 256/547 (46%), Gaps = 24/547 (4%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+GLP++ES+ ++         L I NA  E  G Y    D     + +P  V  + P
Sbjct: 21225 WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 21284

Query: 522   PK-----IILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      I  D + AD+ +       L  ++P          +S   +   + + ++   
Sbjct: 21285 PSKPKGPIRFDEIKADSVI-------LSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCS 21337

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD-----FPDPPVAPTVTEV 631
             S   ++  V ++  +D    + +  +N  G +   +   +V       P PP  P +  V
Sbjct: 21338 SVARTTFKVPNLV-KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNV 21396

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               D   + W+ P YDGGS + G+ +E+K++ S  W ++N        +    ++EG+ Y+
Sbjct: 21397 TSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQ 21456

Query: 692   VRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDG 751
              R++A N+ G+S PS PS+  + ++   PP       VT  T+T++W PP   G + + G
Sbjct: 21457 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 21516

Query: 752   YVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPI 810
             Y +E   +G E W+  N   + + ++T+TGL    +   R+ A NA G  S P   S  I
Sbjct: 21517 YSIEK-RQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGII 21575

Query: 811   LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINI 869
             + ++   PP +          I + GE++ +    QG+P P +TW KDG EI+K   + I
Sbjct: 21576 MTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEI 21635

Query: 870   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP-PQIVKIEDVWGE 928
              +    T +F+R A R H G Y ++ K       A I +++ D PG     ++  ++ GE
Sbjct: 21636 TDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGE 21695

Query: 929   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 988
              + L W  P +DG A IT Y I+K +   + W  + +     S T  +L+ GNEY FRV 
Sbjct: 21696 KMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVS 21755

Query: 989   SENMCGL 995
             + N  G+
Sbjct: 21756 AVNKFGV 21762



 Score =  227 bits (578), Expect = 5e-59
 Identities = 154/500 (30%), Positives = 249/500 (49%), Gaps = 18/500 (3%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   N  + AK  +++ P+I LD +    +V   AG  +++ IP  G PPP   W R D+
Sbjct: 20881 PIEMNEPVQAK-DILEAPEIDLD-VALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDE 20937

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS-IKVKVVDFPDPP 623
               +    R   E+   SS L I    R+D+G Y + ++N  GE  +S + VKV+D P   
Sbjct: 20938 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 20997

Query: 624   VAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
                 V  V      + W+PP  DGGSPI+ Y IE++      W  ++   C  T+F+   
Sbjct: 20998 QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHK-CSSTSFKLID 21056

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             + E   +  R+ A N IGI +P   + P     V +P   L++   T T+V + W  PD 
Sbjct: 21057 LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDF 21116

Query: 744   IGAAGLDGYVLEYCFEGTEDWIVANKDLIDKT-KFTITGLPTDAKIFVRVKAVNAAGASE 802
              G + +  YV+E   +G + W  A    I KT +  ++ L   + +  RV A N  G S+
Sbjct: 21117 DGGSVITEYVVERKGKGEQTWSHAG---ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSD 21173

Query: 803   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 862
             P     PI VKE+I  P++ +          R+G  V+L +P++GKP+P ++W KDG  +
Sbjct: 21174 PVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPL 21232

Query: 863   DKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI-- 919
              +++ +    +E    + I+ A++ H GKY   V +D  V   ++ I +I   GPP    
Sbjct: 21233 KESEFVRFSKTENKITLSIKNAKKEHGGKYT--VILDNAVCRIAVPITVITL-GPPSKPK 21289

Query: 920   --VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               ++ +++  ++V L+W  P+D+G   IT Y+I+K +     W  V     RT+  +  L
Sbjct: 21290 GPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCSSVARTTFKVPNL 21349

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             V   EY FRV +EN  G+S+
Sbjct: 21350 VKDAEYQFRVRAENRYGVSQ 21369



 Score =  226 bits (576), Expect = 9e-59
 Identities = 163/554 (29%), Positives = 261/554 (47%), Gaps = 33/554 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDP 521
             W K+ +P++++ R+          L I +A  ED G YV      A        V V+D 
Sbjct: 15809 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDK 15868

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + +D + AD+             I +S  PP     S  +  I+E      T 
Sbjct: 15869 PGPPTGPVKMDEVTADS-------------ITLSWGPPKYDGGSSINNYIVEKRDTSTTT 15915

Query: 577   SYPDSSTLVIDI--AERDDSGV---YHINLKNEAGEA-HASIKVKVVDF----PDPPVAP 626
                 S+T+      A R  +G    + I  +N  G++ + + +  V  +    P PP  P
Sbjct: 15916 WQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTP 15975

Query: 627   TVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              VT    D   + W  P  DGGS ++GY +ERK++ S  W++LN     +T F+   + E
Sbjct: 15976 VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEE 16035

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGA 746
             GV YE R+ A N +GI KPS  S  +V      PP       VT  +VT++W+ P + G 
Sbjct: 16036 GVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGG 16095

Query: 747   AGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKY 805
             + + GY++E        W+ A+   I  T F +TGL  D +   RV A NAAG  SEP  
Sbjct: 16096 SKITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSE 16155

Query: 806   YSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
              +  I  ++ ++PP+I +    K T +   GE+  +     GKP P + W K   E+   
Sbjct: 16156 STGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNT 16215

Query: 866   -QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIE 923
              ++ I++++  T + ++ A R  SG Y L+ K      + +++++++DRPGPP+  V I 
Sbjct: 16216 ARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVIS 16275

Query: 924   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
              V  E   L W PP  DG + I  Y +++ +   + W  V  +    S  +T+L+ GNEY
Sbjct: 16276 GVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEY 16335

Query: 984   YFRVFSENMCGLSE 997
              FR+ + N  G+ E
Sbjct: 16336 TFRIMAVNKYGVGE 16349



 Score =  225 bits (574), Expect = 2e-58
 Identities = 142/476 (29%), Positives = 224/476 (47%), Gaps = 18/476 (3%)

Query: 573   IRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPT 627
             +   S P   T  I         V+ I  +N+ G     ++       +   P  P  PT
Sbjct: 9893  VHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPT 9952

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT----FEPKK 683
             V+ V  +   +NWE P YDGGSP+ GY++E K   S RW R+N D  K  T    ++   
Sbjct: 9953  VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTG 10012

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRP 740
             +IEG  Y+ R++A+NA G+   S+PS P     P+A   PP     D  T ++  + W P
Sbjct: 10013 LIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPPFPKVTDW-TKSSADLEWSP 10071

Query: 741   PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
             P   G + + GY++EY  EG E+W       +  TK  +TGL   A    RV+AVN AG 
Sbjct: 10072 PLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGI 10131

Query: 801   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
              EP   +  I +K+ +  P +++   ++   +   G  + ++    GKP P +TW  +  
Sbjct: 10132 GEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNER 10191

Query: 861   EIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV 920
              + + +  I  +   + + I+  +RSH G Y L  K +      +I + ++D PGP    
Sbjct: 10192 TLPQ-EATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTP 10250

Query: 921   KI-EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVI 979
              +  ++  E+  LTW  P+DDG + IT Y I+K +     W  V     R +AT+  L+ 
Sbjct: 10251 FLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQ 10310

Query: 980   GNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPL 1035
             G  Y+FR+ +EN  G+      T E+ VI     + + P  ED +  E    T  L
Sbjct: 10311 GKAYFFRIAAENSIGMG-PFVETSEALVIREPITVPERP--EDLEVKEVTKNTVTL 10363



 Score =  223 bits (569), Expect = 6e-58
 Identities = 160/574 (27%), Positives = 265/574 (46%), Gaps = 34/574 (5%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHV 518
             +W K    +  + RL++        L + +A+  D G+Y+    A NV    ++   V V
Sbjct: 16204 QWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK--AKNVAGERSVTVNVKV 16261

Query: 519   IDPP-----KIILDGLDADNTVTVIA-----GNKLRLEIPISGEPPPKAMWSRGDKAIME 568
             +D P      +++ G+ A+            G    +   +      + +W+  D  +  
Sbjct: 16262 LDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQT 16321

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              S ++      +  T  I    +   G        E  E+   +       PD P AP V
Sbjct: 16322 LSCKVTKLLEGNEYTFRIMAVNKYGVG--------EPLESEPVVAKNPFVVPDAPKAPEV 16373

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV 688
             T V  D  I+ WE PA DGGS ILGY +E++ K+  RW R +  L  E       +IE  
Sbjct: 16374 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 16433

Query: 689   AYEVRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIG 745
              YE R+ A NA G+S+PS PS   +   P+    PP    V  +T ++V + W  P + G
Sbjct: 16434 DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDG 16493

Query: 746   AAGLDGYVLEYCFEGTEDWIVANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
                + GY++E C     +W +      I+KT   +  L    +   R+ A+N AG  E  
Sbjct: 16494 GCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAGVGEHA 16553

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW-KKDGAEID 863
                 PI+V+E +E P I +   L++    R G ++ L +P +G+P PE+ W K DG   D
Sbjct: 16554 DVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRD 16613

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 923
                I++ +S T  +  +    R  SGKY L ++     ++A + ++++D P PP  +K+ 
Sbjct: 16614 AAIIDVTSSFTSLV--LDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTPSPPVNLKVT 16671

Query: 924   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
             ++  ++V++TW PP  DG + I  Y ++K +     +  V+ + H+ S  I +L  G  Y
Sbjct: 16672 EITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSY 16731

Query: 984   YFRVFSENMCGL---SEDATMTKESAVIARDGKI 1014
             YFRV +EN  G+   ++ A   K + V    GKI
Sbjct: 16732 YFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 16765



 Score =  222 bits (566), Expect = 1e-57
 Identities = 161/583 (27%), Positives = 256/583 (43%), Gaps = 22/583 (3%)

Query: 430   LKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             L P KIL P    T+  GK++ ++  +    +   KW K    V  S  L V        
Sbjct: 12525 LLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI 12583

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPKIILDGLDADNTVTVIAGNK 542
             L+I +   +D G Y    +  + T   K+ V+      PP+   D  D D          
Sbjct: 12584 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC-----S 12638

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
             L   IP+         +      +  G       S   +S  V  +    +  ++ +  +
Sbjct: 12639 LSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEY-IFRVRAE 12697

Query: 603   NEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N  G +      K+V       P  P    VT+V  D   + W+ P  DGGSPI+GY IE
Sbjct: 12698 NRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIE 12757

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK++ S  W++ N  L + T +    ++EG+ Y  RI+A+N  G S PS P+        
Sbjct: 12758 RKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP 12817

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVAN--KDLIDKT 775
               PP    V  VT +TV++ W  P H G + + GY +E C    + W+  N     I + 
Sbjct: 12818 VDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQE 12877

Query: 776   KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 835
             ++T TGL   A+   R  A  A   S P   S P+ +     PP+I +   +K     + 
Sbjct: 12878 EYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKA 12937

Query: 836   GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQ 894
             G  V L     GKP P ++WKKDG  +   + I +        + +    R  SG Y + 
Sbjct: 12938 GTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTIT 12997

Query: 895   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954
              +     ++A+I ++++D+PGPP  VKI  ++ +   L+W PP +DG + IT Y + K +
Sbjct: 12998 AENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRE 13057

Query: 955   KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
                  W  V      TS ++ +L+ G+EY FR+ +EN  G+ +
Sbjct: 13058 TSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGD 13100



 Score =  222 bits (565), Expect = 2e-57
 Identities = 160/535 (29%), Positives = 257/535 (48%), Gaps = 52/535 (9%)

Query: 502  VFAPDAYNVTLPAKV--HVI--DP---PKIILDGLDADNTVTVIAGNKLRLEIPISGEPP 554
            V A +A  V+ P+++  +V+  DP   P I L+  D    + VI G KL + +P    P 
Sbjct: 7988 VRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD----IIVIEGEKLSIPVPFRAVPV 8043

Query: 555  PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
            P   W +  K + + S R+  ++   S+ L +  + R D+G+Y I L+N+ G A ASI V
Sbjct: 8044 PTVSWHKDGKEV-KASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINV 8102

Query: 615  KVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC 674
            KV+  P P      +++    C + WEPP +DGG+PIL Y +ER++     ++ +     
Sbjct: 8103 KVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGEN 8162

Query: 675  KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTD 731
            K  ++  K +I    Y  R+ AVN +G  +      P +   P     PP  + V + T 
Sbjct: 8163 K-LSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTA 8221

Query: 732  TTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVR 791
              +T+ W+PP + G + + GY++E   +G E W   N+ L+    +T  GL    +   R
Sbjct: 8222 EAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFR 8281

Query: 792  VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 851
            V+A NAAG SEP   + P    + I+ PK+ +   L+   ++R G+ + L     G P P
Sbjct: 8282 VRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLE---VKR-GDEIALDASISGSPYP 8337

Query: 852  ELTWKKD-----GAEIDK------------------------NQINIRNSET-DTIIFIR 881
             +TW KD       EI K                         +++I NS+  ++ + +R
Sbjct: 8338 TITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVR 8397

Query: 882  KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
             + R   G Y ++V+ D  +  A   + ++D PGPP     ED+   +V   W PP DDG
Sbjct: 8398 DSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFEDIRKTSVLCKWEPPLDDG 8457

Query: 942  NAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 994
             + I  YT++K D  K   EW  V         ++T+L+ G EY FRV +EN  G
Sbjct: 8458 GSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFG 8512



 Score =  220 bits (561), Expect = 5e-57
 Identities = 176/654 (26%), Positives = 292/654 (44%), Gaps = 63/654 (9%)

Query: 380   EIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPL 439
             +++ G K  +RIR +         GA  A +     +    +  A       P  +L P 
Sbjct: 13965 DLVEGGKYEFRIRAKNTA------GAISAPSESTETIICKDEYEA-------PTIVLDPT 14011

Query: 440   TDQ--TVNLGKEICLKCE--ISENIP-GKWTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                  T+  G  I L     + + +P   W+K G  ++ SD  ++        L I  A 
Sbjct: 14012 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 14071

Query: 495   TEDEGDY-VFAPDAYNVTLP-AKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              +D G+Y + A + +   +   KV V+D P     G      ++ ++  K  L    +  
Sbjct: 14072 RKDAGEYTITATNPFGTKVEHVKVTVLDVP-----GPPGPVEISNVSAEKATL----TWT 14122

Query: 553   PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK----NE---- 604
             PP +   S     I+E           ++S L+  +   D     H+  K    NE    
Sbjct: 14123 PPLEDGGSPIKSYILEKR---------ETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFR 14173

Query: 605   --------AGEAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILG 653
                      GE   S  VK+VD    P PP  P V+ V  +   ++W+ P  DGGS I G
Sbjct: 14174 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 14233

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV 713
             Y +ER++K+S RW+R       +   +   + EG  YE R+ A N  GI  PS  S   +
Sbjct: 14234 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 14293

Query: 714   PLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIV-ANK 769
                   PP   +   VTDTT    ++ W  P + G   + GYV+E+   G E WI     
Sbjct: 14294 MKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTG 14353

Query: 770   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 829
               +  T+F +  L T  K   R+ A+N AG  EP       +V+  + P    +   L++
Sbjct: 14354 TALRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPD-FELDAELRR 14412

Query: 830   TYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG 889
             T + R G ++ + +P +G+P PE+TW KD   + KN+ NI N+E+ T++ I +  R  +G
Sbjct: 14413 TLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIENTESFTLLIIPECNRYDTG 14471

Query: 890   KYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYT 949
             K+ + ++     ++  ++++++D PGP   ++  D+  ++V L W  P  DG + IT Y 
Sbjct: 14472 KFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITNYI 14531

Query: 950   IQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             ++K +     + T     H+ +  +T L  G EY+FRV +EN  G+ E    T+
Sbjct: 14532 VEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTE 14585



 Score =  218 bits (554), Expect = 3e-56
 Identities = 159/598 (26%), Positives = 266/598 (44%), Gaps = 55/598 (9%)

Query: 434   KILTPLTDQTVNLGKEICLKCEISENIPG----------KWTKNGLPVQESDRLKVVHKG 483
             K++ P  +  V L + + +K   +   P           KWT +G  ++  +   V    
Sbjct: 11132 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11191

Query: 484   RIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVID---PPKIILDGLDADNTVTVI 538
                 L I N L  D G+Y       A + T+   + V+D   PP   ++ LD        
Sbjct: 11192 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPE---- 11247

Query: 539   AGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAERDD 593
                     + IS +PP     S     I+E     +       S    + L I   ++  
Sbjct: 11248 -------HMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 11300

Query: 594   SGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
               V+ +  +N+ G     ++  ++       P PP  P VT++ ++   ++W  P  DGG
Sbjct: 11301 EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGG 11360

Query: 649   SPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             SPI GY++ER++  + +W+R+N     +  F    + EG  YE R+FA N  G+SKPS  
Sbjct: 11361 SPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 11419

Query: 709   SRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
             S P     P+    PP    +   +  T  + W  P   G + + GYV+E    GT  W 
Sbjct: 11420 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWN 11479

Query: 766   VANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIP 824
               NKD LI +  F + GL    +   R+KA N  G  EP+  ++ ++ K+I+ PP++ + 
Sbjct: 11480 RINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELD 11539

Query: 825   RHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI------- 877
                +     RVG+ + ++   +G+P P++TW K+G      ++ +R    D I       
Sbjct: 11540 VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG------KVLVREKRVDLIQDLPRVE 11593

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 937
             + I++A R+  GKY +  K        S  + ++DRPGP Q +K+ +V  EN  ++W  P
Sbjct: 11594 LQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENP 11653

Query: 938   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
              D+G + IT + ++        W  V     +       L+  NEYYFRV +EN  G+
Sbjct: 11654 LDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIK-ANLLANNEYYFRVCAENKVGV 11710



 Score =  214 bits (544), Expect = 5e-55
 Identities = 128/407 (31%), Positives = 204/407 (50%), Gaps = 22/407 (5%)

Query: 611  SIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
            S KV + D    P PP  P V        +++W PP  +GGSPI GY++E++++ S  W 
Sbjct: 9215 SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWS 9274

Query: 668  RLNFDLC-----KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
            R++         K   F   +++EGV Y+ R  A+NA GI  PS PS P V   P+    
Sbjct: 9275 RVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPG 9334

Query: 720  PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKD--LIDKTKF 777
            PP+   V   T +++++ W+PP   G + + GY++E   EGT DW   N+   LI   + 
Sbjct: 9335 PPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTCEC 9394

Query: 778  TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 837
             +  L    K   RVKAVN AG SEP   +  I   +I E P++ I    +   + + G 
Sbjct: 9395 VVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGS 9454

Query: 838  AVNLVIPFQGKPRPELTWK---------KDGAEIDKNQINIRNSETDTIIFIRKAERSHS 888
             + +    +G+P P+ +W+         KDG         +  +E  ++I I + +RSH+
Sbjct: 9455 QIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHT 9514

Query: 889  GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 948
            GKY +  K     +TA+  ++++D PGPP+ +K+ D+   +  L+W  P DDG   I GY
Sbjct: 9515 GKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRLSWKMPDDDGGDRIKGY 9574

Query: 949  TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             I+K       W  V      T+  + +L+   +Y+FRV +EN  G+
Sbjct: 9575 VIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGI 9621



 Score =  214 bits (544), Expect = 5e-55
 Identities = 163/595 (27%), Positives = 269/595 (45%), Gaps = 44/595 (7%)

Query: 443   TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T+  G ++ L   +      K  WTK    +   +++ + + G+    VI      D G 
Sbjct: 22686 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGK 22745

Query: 501   YVFAPDAYNVT--LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP---- 554
             Y       + T  +   V V+D P     G     TV+ +   K  L   +  E      
Sbjct: 22746 YTLTVKNASGTKAVSVMVKVLDSP-----GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 22800

Query: 555   -----PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                   +   SR +  I+EG     T SY      V+    +++  ++ +   N+ G   
Sbjct: 22801 THYIVERRETSRLNWVIVEGE--CPTLSY------VVTRLIKNNEYIFRVRAVNKYGPGV 22852

Query: 607   --EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
               E+   +       P PP  P     G +  I+ W  P  DGG+ I  Y +++++K+S 
Sbjct: 22853 PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSL 22912

Query: 665   RWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTS 719
             RW R+N D +  +T  +   ++EG  Y+ R+ AVNA G S+PS  S  F+    P     
Sbjct: 22913 RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASN-FISCREPSYTPG 22971

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI-VANKDLIDKTKFT 778
             PP+   V   T  ++++ W  P + G   + GYVLE   + T+ W  V     I  T+FT
Sbjct: 22972 PPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFT 23031

Query: 779   ITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEA 838
             +  L    K   RV AVN  G SE       I   E IE P + +   LK+T   R G +
Sbjct: 23032 VPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGAS 23091

Query: 839   VNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVD 898
             + L++   G+P P +TW K G ++    I I  +E+ +++ + K  R  +GKY ++ +  
Sbjct: 23092 LRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSLLIVDKVNRYDAGKYTIEAENQ 23150

Query: 899   KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 958
                ++A++ +++ D PGP   VK+++V  ++V +TW  P  DG A +  Y ++K +    
Sbjct: 23151 SGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMR 23210

Query: 959   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKESAVI 1008
              + TV     +T   I+ LV G  YYFRV  EN+ G+ E     DA +  E  ++
Sbjct: 23211 AFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLV 23265



 Score =  213 bits (543), Expect = 6e-55
 Identities = 156/581 (26%), Positives = 275/581 (47%), Gaps = 32/581 (5%)

Query: 444   VNLGKEICLKCEI-SENIPGK-WTKNGLPVQESD-RLKVVHKGRIHKLVIANALTEDEGD 500
             V+ G+   L+ +I  + IP   W+K+G  ++E+  R+++    +   LV+ + +  D G 
Sbjct: 18347 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18406

Query: 501   YVFAPDAYNVT--LPAKVHVIDPP-----KIILDGLDAD------NTVTVIAGNKLRLEI 547
             Y+        T  +P  V V+D P      + + G+ A+      N      G  +   I
Sbjct: 18407 YILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYI 18466

Query: 548   PISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE 607
              I      +  W++    +   + ++ T+  P +  +   +A       Y I    E+G 
Sbjct: 18467 -IEKRETSRLSWTQVSTEVQALNYKV-TKLLPGNEYIFRVMAVNK----YGIGEPLESGP 18520

Query: 608   AHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
               A    K    P PP  P V+ +  D  ++ W  P  DGG+ I GY +E++ K+  RW 
Sbjct: 18521 VTACNPYKP---PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18577

Query: 668   RLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVD 727
             + N     +       + EG +YE R+ A NA G+ +PS PS  +       PP   +  
Sbjct: 18578 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP 18637

Query: 728   SVTDT---TVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDL-IDKTKFTITGLP 783
              VTDT   +V++ W  P + G A + GYV+E      ++W        +   +FT+T L 
Sbjct: 18638 KVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLK 18697

Query: 784   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVI 843
              + +   R+ A+N+ G  EP      ++ +E IEPP+I +   L++  + R    + L +
Sbjct: 18698 ENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFV 18757

Query: 844   PFQGKPRPELTWKK-DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
               +G+P PE+ W+K +G   D+ QI + +S   T++ I    R  SG+Y+L ++ +   +
Sbjct: 18758 TIKGRPEPEVKWEKAEGILTDRAQIEVTSS--FTMLVIDNVTRFDSGRYNLTLENNSGSK 18815

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
             TA ++++++D P  P  + I +V  ++V L+W PP  DG A IT Y ++K +     + T
Sbjct: 18816 TAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYAT 18875

Query: 963   VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             +  +  +T+  I  L  G  YYFRV + N  G+   A  T+
Sbjct: 18876 ITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTE 18916



 Score =  213 bits (542), Expect = 8e-55
 Identities = 117/390 (30%), Positives = 208/390 (53%), Gaps = 6/390 (1%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT++  +   + W  P  DGGS I GYF+E++ K+S  W ++  +  ++T  
Sbjct: 20694 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQ 20753

Query: 680   EPKKMIEGVAYEVRIFAVNAIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             +   + E   Y+ R+ AVNA G    S+PS   +   P+    PP  + +   T +++T+
Sbjct: 20754 KVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITL 20813

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGTEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAV 795
              W  P + G + + GYV+E      E+W  V+ K  +  T++ ++ L      + RV AV
Sbjct: 20814 GWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAV 20873

Query: 796   NAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW 855
             N AG  EP   ++P+  K+I+E P+I +   L+ + I + GE V ++IPF+G+P P +TW
Sbjct: 20874 NCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTW 20933

Query: 856   KKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVD-KFVETASIDIQIIDR 913
             +KD   +  + + +I N+++ +++ I +  R+ +GKY L ++      +++++ ++++D 
Sbjct: 20934 RKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDT 20993

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             P   Q ++++ V    V L W PP  DG + I  Y I+K D     W  V      TS  
Sbjct: 20994 PAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHKCSSTSFK 21053

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTK 1003
             + +L     ++FRV +EN  G+ E    T+
Sbjct: 21054 LIDLSEKTPFFFRVLAENEIGIGEPCETTE 21083



 Score =  210 bits (535), Expect = 5e-54
 Identities = 144/504 (28%), Positives = 232/504 (46%), Gaps = 21/504 (4%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            +PP + LD +     + ++AG  LR+   ++G P P  +W++ +  +     R+  ++  
Sbjct: 8728 EPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL--DKDRVVIDNVG 8784

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              S L+I  A R D G Y I   N  G   A+ +V+V D P P +           C++N
Sbjct: 8785 TKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLN 8844

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W  P  DGGS I G+ IERK  +   W R   +  + +  +   ++EG  Y+ R+ A N 
Sbjct: 8845 WSDPEDDGGSEITGFIIERKDAKMHTW-RQPIE-TERSKCDITGLLEGQEYKFRVIAKNK 8902

Query: 700  IGISKPSM--PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P    P     PL   + P  LT    T +T+T+ W+ P   G + + GY++E  
Sbjct: 8903 FGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKR 8962

Query: 758  FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                 D+   NK L   T F +  L        RVKAVN  G SEP      +++++   
Sbjct: 8963 RHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGESEPS-LPLNVVIQDDEV 9021

Query: 818  PPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-------NQINI 869
            PP I++   ++   I+ + GE V++     G P P++ W K+   I+K        +  +
Sbjct: 9022 PPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEV 9081

Query: 870  RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 929
              SE  T + I KA R   G Y +           ++ +++ DRP PP+ + + D+  E+
Sbjct: 9082 SRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLAVTDIKAES 9141

Query: 930  VALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 987
              LTW  P D+G + IT Y I K D  +K  EW  V          I +L+   +Y FRV
Sbjct: 9142 CYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRV 9201

Query: 988  FSENMCGLSEDATMTKESAVIARD 1011
             + N  G+S++    K   V+ +D
Sbjct: 9202 RAVNKYGISDEC---KSDKVVIQD 9222



 Score =  209 bits (533), Expect = 9e-54
 Identities = 155/595 (26%), Positives = 276/595 (46%), Gaps = 28/595 (4%)

Query: 420   GQSSAKLSVDLKPLKILTPLTDQ-TVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDR 476
             G  +AK  V+L  + +     D   VN G+   L+ ++  + +P  +W +    ++ES R
Sbjct: 17240 GPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESAR 17299

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNT 534
              ++ +      L++ +A+  D G Y+      A + + P  V V+D P       +    
Sbjct: 17300 CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQ 17355

Query: 535   VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIA 589
             VT +   K  L    +  PP +   S     ++E     R       S   +++L +   
Sbjct: 17356 VTGVTSEKCSL----TWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKL 17411

Query: 590   ERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPA 644
                +  V+ I   N+   GE   S  V + +    P PP +  VT +  D   + W  P 
Sbjct: 17412 LEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPD 17471

Query: 645   YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
              DGGS I+GY +E++ +   RW++ N     +       + E   YE R+ A NA G+ +
Sbjct: 17472 SDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGE 17531

Query: 705   PSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
             PS  +   +   P+    PPT   +   T  ++T+ W  P + G + + GYV+E C    
Sbjct: 17532 PSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEICKADE 17591

Query: 762   EDW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             E+W IV  +  +  T+F I+ L    +  +RV A+N  G  E       +  ++ +E P+
Sbjct: 17592 EEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPE 17651

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFI 880
             + +   L++  + R G +  + IPF+G+P PE+TW ++  E   +++ I      T + I
Sbjct: 17652 LDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFT-DKVQIEKGVNYTQLSI 17710

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 940
                +R+ +GKY L+++     ++A + ++++D PGPPQ + +++V  ++  L W PP  D
Sbjct: 17711 DNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIID 17770

Query: 941   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             G A +  Y I K +     +  V     +TS  +  L  G  YYFRV +EN  G+
Sbjct: 17771 GGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGV 17825



 Score =  207 bits (528), Expect = 3e-53
 Identities = 124/404 (30%), Positives = 206/404 (50%), Gaps = 10/404 (2%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP A  V +V      + WEPP  DGG PI  Y IE+K++  +RW++       +  F
Sbjct: 7812 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7871

Query: 680  EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTM 736
                +IEG   + ++ A N  G+  PS P+       P +  SPP  L V       + +
Sbjct: 7872 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 7931

Query: 737  RWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT-GLPTDAKIFVRVKAV 795
             W+PP+  G + + GY +E C  GTE W+  N   I   KF +  G+  D +  +RV+AV
Sbjct: 7932 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 7991

Query: 796  NAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW 855
            NA G SEP   S+ ++ K+    P I +  H     I   GE +++ +PF+  P P ++W
Sbjct: 7992 NAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSW 8048

Query: 856  KKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP 914
             KDG E+   +++ ++N      + + K+ R+ +G Y + ++      TASI++++I  P
Sbjct: 8049 HKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP 8108

Query: 915  GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI 974
            GP + +K  D+   +  LTW PP+ DG   I  Y +++ +     +  V+   ++ S T+
Sbjct: 8109 GPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTV 8168

Query: 975  TELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1018
             +L+   EY+FRV + N  G  E   +  ++ VIA+D K   +P
Sbjct: 8169 KDLIPNGEYFFRVKAVNKVGGGEYIEL--KNPVIAQDPKQPPDP 8210



 Score =  205 bits (522), Expect = 2e-52
 Identities = 140/501 (27%), Positives = 228/501 (45%), Gaps = 20/501 (3%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP++ LD +   + +TV  G  +R+   + G P P   W++  K ++      R + 
Sbjct: 11530 ILHPPEVELD-VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK---RVDL 11585

Query: 578   YPDSSTLVIDIAE--RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
               D   + + I E  R D G Y I+ KN +G A  S  V V+D P P     VT V  + 
Sbjct: 11586 IQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKEN 11645

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++WE P  +GGS I  + +E +K     W  +  D+ K        ++    Y  R+ 
Sbjct: 11646 CTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYFRVC 11703

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             A N +G+        P +   P+     P  L +     T V ++WR PD+ G +    Y
Sbjct: 11704 AENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSY 11763

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
              +E   +G++DW   +K  I +T + +     +     RV+  N  G S+    ++ ++V
Sbjct: 11764 HVERRLKGSDDWERVHKGSIKETHYMVDRCVENQIYEFRVQTKNEGGESD-WVKTEEVVV 11822

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ---INI 869
             KE ++ P + +   L      + G+ + L    +GKP PE+ W KD    D  +   + I
Sbjct: 11823 KEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKI 11880

Query: 870   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 929
                   +   + KA+RS  GKY +          A   + ++D+PGP + +KI DV  + 
Sbjct: 11881 DTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDR 11940

Query: 930   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 989
               + W PP+DDG   I  Y ++K + K M W T          T+T L+ GNEY FRV +
Sbjct: 11941 CTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRA 12000

Query: 990   ENMCGLSEDATMTKESAVIAR 1010
             EN  G       T+   VIA+
Sbjct: 12001 ENKIGTGPP---TESKPVIAK 12018



 Score =  204 bits (520), Expect = 3e-52
 Identities = 148/557 (26%), Positives = 258/557 (46%), Gaps = 31/557 (5%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVI 519
             W K+G+ +++   +++        L + +A  +  G  V+  +A N +  AK    V V 
Sbjct: 21620 WFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG--VYTVEAKNASGSAKAEIKVKVQ 21677

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRL--EIPISGEPPP-------KAMWSRGDKAIMEGS 570
             D P  ++  +   N    I G K+ L  + P++    P       K   SR   A++E  
Sbjct: 21678 DTPGKVVGPIRFTN----ITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIED- 21732

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGV--YHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              +   +SY     +  +  +   S V  + +    ++    A I+  V   PD P  P  
Sbjct: 21733 -KCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTV---PDAPGIPEP 21788

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR-LNFDLCKETTFEPKKMIEG 687
             + +  +   + W  P  DGGS I  Y +ER++K+S+RW++ ++     ET F+   + EG
Sbjct: 21789 SNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEG 21848

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               YE  + A NA G+   S  SR      P+    PPT++ V   + TTV++ W  P   
Sbjct: 21849 NEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFD 21908

Query: 745   GAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 804
             G   + GY++E C     DW   N +   KT++T+T L    +   RV A+N AG  +  
Sbjct: 21909 GGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSC 21968

Query: 805   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK 864
               +  I   + +  P++ I  + KQT++ R G ++ L I +QG+P P   W K  + +  
Sbjct: 21969 EVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSL 22028

Query: 865   NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIED 924
              + +I  +++ + + +    R+ +GKY L V+ +   ++ +  ++++D PGPP  +  +D
Sbjct: 22029 -RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPGPITFKD 22087

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY 984
             V   +  L W  P  DG A I  Y ++K +     W  + E   R    + +L  G  YY
Sbjct: 22088 VTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYY 22147

Query: 985   FRVFSENMCGLSEDATM 1001
             FRV + N  G+ E   M
Sbjct: 22148 FRVSAVNEYGVGEPYEM 22164



 Score =  203 bits (517), Expect = 6e-52
 Identities = 137/482 (28%), Positives = 227/482 (47%), Gaps = 20/482 (4%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P  P  P V  V  +   + WE P +DGGS I+GY++E+K++ +  W++ N   C E  +
Sbjct: 22469 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 22528

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   ++EG+ Y+ R +A+NA G+SK S  SRP +       P    V  VT +TV++ W 
Sbjct: 22529 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 22588

Query: 740   PPDHIGAAGLDGYVLE---YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN 796
              P + G + + GY++E       G   W+  N  ++    FT+T L        RV A N
Sbjct: 22589 APAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKN 22648

Query: 797   AAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELT 854
             AAG  S+    + P+  ++   PPK  +   L    +  R G  + L     GKP P++ 
Sbjct: 22649 AAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKII 22708

Query: 855   WKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 913
             W K   E+D   +++++ +       I+  +RS SGKY L VK     +  S+ ++++D 
Sbjct: 22709 WTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDS 22768

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 973
             PGP   + +  V  E   L W+ P++DG A IT Y +++ +   + W  V       S  
Sbjct: 22769 PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYV 22828

Query: 974   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP--VYEDFDFSEAPM- 1030
             +T L+  NEY FRV + N  G        +   ++AR+     +P  + E+    +  + 
Sbjct: 22829 VTRLIKNNEYIFRVRAVNKYG---PGVPVESEPIVARNSFTIPSPPGIPEEVGTGKEHII 22885

Query: 1031  --FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFSNQGVCTLE 1087
               +T+P  +     G N   N  V    K  + W + NK  +V D R ++ S    C  +
Sbjct: 22886 IQWTKPESD-----GGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQ 22940

Query: 1088  IR 1089
              R
Sbjct: 22941 FR 22942



 Score =  200 bits (509), Expect = 5e-51
 Identities = 218/906 (24%), Positives = 364/906 (40%), Gaps = 113/906 (12%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +   V F  E+     + KW++N + I  S+KYI   K     L I +  + D + Y
Sbjct: 6278 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6337

Query: 323  YVTAGDE-----KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKN 377
             V+  +      K +  L V E  + + + L+D      + V   C+V+  +  +KW KN
Sbjct: 6338 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 6397

Query: 378  GEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILT 437
            GEE+    +  YR  V+  KH+L I+     D  EY V     +S A+L +   P + + 
Sbjct: 6398 GEEVPFDNRVSYR--VDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 6455

Query: 438  PLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTE 496
             L DQTV    +    C++S E    KW +NG  ++E  + K    G IH+L+I +   +
Sbjct: 6456 HLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLD 6515

Query: 497  DEGDYVFAPD-----AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISG 551
            DE +Y    +     A        V +I PP+ IL+   AD  V +   NK ++E+    
Sbjct: 6516 DECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD-VVFLAELNKDKVEV---- 6570

Query: 552  EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                   W R +  +++G               + DI  RD  G Y    K++  EA A 
Sbjct: 6571 ------QWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQ-GEYRFIAKDK--EARAK 6621

Query: 612  IKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF-IERKKKQSSRWMRLN 670
            +++          AP +     D  +        D G P+      +   K  + W + N
Sbjct: 6622 LELAA--------APKIKTADQDLVV--------DVGKPLTMVVPYDAYPKAEAEWFKEN 6665

Query: 671  FDL--------CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPT 722
              L         ++T+F   +  +G     +I   N  G ++  +  +    + V  P  
Sbjct: 6666 EPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV---IDVPGPVR 6722

Query: 723  LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGL 782
             L V    D  V++ W  P   G + + GYV+E      + W++A  D  +  +FT+TGL
Sbjct: 6723 NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDIKRKTWVLAT-DRAESCEFTVTGL 6781

Query: 783  PTDAKIFV-RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 841
                  ++ RV A N  G  EP     P+  +   + P                G  +N+
Sbjct: 6782 QKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP----------------GPPLNV 6825

Query: 842  VIPFQGKPRPELTWKKD----GAEIDKNQINIRNSET---DTIIFIRKAERS-------H 887
             I    +    LTW+      GAEI    I +R+  +   DT + +R  + S        
Sbjct: 6826 TITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVE 6885

Query: 888  SGKYDLQVKVDKFV-----ETASIDIQI---IDRPGPPQIVKIEDVWGENVALTWTPPKD 939
              +Y  +V+    +       A+  +++   I+RP PP  +   D    +V L W PP  
Sbjct: 6886 GQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLK 6945

Query: 940  DGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSED 998
            DG + I GY I++ ++    W    ++     +  +T L  GN+Y +RV +EN  G+S+ 
Sbjct: 6946 DGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDP 7005

Query: 999  ATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNA-TLNCSVRGNPK 1057
            + +                P+  D  F E  M      +   +   N  T+     G P+
Sbjct: 7006 SEIL--------------GPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPR 7051

Query: 1058 PKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLE 1117
            P  TW      +    R +M +      L I      D G Y  K  N + T+  E  ++
Sbjct: 7052 PTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGE--ID 7109

Query: 1118 VKVIAQ 1123
            V VIA+
Sbjct: 7110 VNVIAR 7115



 Score =  198 bits (503), Expect = 3e-50
 Identities = 173/674 (25%), Positives = 288/674 (42%), Gaps = 74/674 (10%)

Query: 373  KWFKNGEEIIP-----------GPKSRYRIRVEGKKHILIIEGATKA-------DAAEYS 414
            +W +  E ++P           G + ++R+R E    I     AT         DA +  
Sbjct: 8253 RWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI 8312

Query: 415  VMTT-----GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC---------EISENI 460
            + T+     G + +   S+   P   +T + D+ V + +EI  +          E+ E  
Sbjct: 8313 LRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEE 8372

Query: 461  PGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN--VTLPAKVHV 518
            P       LP+ +   +    KG   +L + ++L  D G Y+   +  +     P  V V
Sbjct: 8373 PFV-----LPLTQRLSIDNSKKGE-SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8426

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
            +D P   ++ +  D   T +             EPP       G   I+  +   + ++ 
Sbjct: 8427 LDTPGPPINFVFEDIRKTSVL---------CKWEPP----LDDGGSEIINYTLEKKDKTK 8473

Query: 579  PDSSTLVIDIAERD-----------DSGVYHINLKNEAGEAHASIKVKVVDF-----PDP 622
            PDS  +V+    R               ++ +  +N  G     +   +V       PD 
Sbjct: 8474 PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDA 8533

Query: 623  PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPK 682
            P  P V +V  +  ++ W  P  D GSPILGY++E+++  S+ W R+N  L         
Sbjct: 8534 PDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVD 8592

Query: 683  KMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP--PTLLTVDSVTDTTVTMRWRP 740
             ++EG+ Y  R+ A NA G  K S PS P       SP  P +  V   + TT+ + W P
Sbjct: 8593 GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEP 8652

Query: 741  PDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 800
            P   G   + GY ++    GT +W    + +I   ++T+  +   A   +RV AVNAAG 
Sbjct: 8653 PAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQYTVKEIREGADYKLRVSAVNAAGE 8712

Query: 801  SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
              P   +QP+ V E  EPP + +   +K       G+ + +     G+P P   W K+  
Sbjct: 8713 GPPG-ETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEG 8771

Query: 861  EIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV 920
            E+DK+++ I N  T + + I+ A R   G+Y +        + A+  +++ D PGP   +
Sbjct: 8772 ELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDL 8831

Query: 921  KIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIG 980
            K      +   L W+ P+DDG + ITG+ I++ D K   W   IE   R+   IT L+ G
Sbjct: 8832 KPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIE-TERSKCDITGLLEG 8890

Query: 981  NEYYFRVFSENMCG 994
             EY FRV ++N  G
Sbjct: 8891 QEYKFRVIAKNKFG 8904



 Score =  192 bits (487), Expect = 2e-48
 Identities = 179/703 (25%), Positives = 312/703 (44%), Gaps = 63/703 (8%)

Query: 344   VTKQLEDTTAYCGERVELECE-VSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
             + K+++D T   GE  +L C+ V     ++KW++ G+E+I   K  Y++  +G+ H L +
Sbjct: 24163 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRK--YKMSSDGRTHTLTV 24220

Query: 403   EGATKADAAEYSVMTTGG----QSSAKLSVDLKP-LKILTPLTDQTVN-LGKEICLKCE- 455
                 + D   Y+ + T      ++S+KL +   P      PL ++    +G  + L    
Sbjct: 24221 MTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMY 24280

Query: 456   ISENIPGK-WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
             I   +P   W      +Q S+ + + +      LV+ N   +           Y V L  
Sbjct: 24281 IGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAG------KYKVQLSN 24334

Query: 515   KVHVIDPPKIILDGLDADN----TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME-- 568
                 +D    ILD    D     T  ++    L+    IS +PP     S     ++E  
Sbjct: 24335 VFGTVDA---ILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKC 24391

Query: 569   -----GSGRIRTESYPDSSTLVIDIAERDDSGVY-HINLKNEAG-----EAHASIKVKV- 616
                     ++ + +   ++  ++++ E  ++G Y  ++ +N  G     E  + + +K  
Sbjct: 24392 EAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 24449

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
              + P  P  PT+T V  D C++ W+PPA DGG+ I  Y++E+++K+ ++W+ +  +  +E
Sbjct: 24450 FEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 24509

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             T F  K +IEG+ YE R+   N  G S+ S  S P  P +          + + +  V  
Sbjct: 24510 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRY 24569

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTK-----FTITGLPTDAKIFVR 791
             +          G    ++++  +G E      K  I + K       I  +  D     +
Sbjct: 24570 QSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQ 24629

Query: 792   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV--GEAVNLVIPFQGKP 849
             V+A N  G+             E+  P KI +P+ L+         GE V++ IPF GKP
Sbjct: 24630 VRATNQGGSVSGT------ASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKP 24683

Query: 850   RPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 906
              P +TW+K    ID N   Q+ +  S T +++F    ER  +G Y +  K    ++  ++
Sbjct: 24684 DPVITWQKGQDLIDNNGHYQVIVTRSFT-SLVFPNGVERKDAGFYVVCAKNRFGIDQKTV 24742

Query: 907   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 966
             ++ + D P PP+ VK+ DV  ++V LTWT P  DG + IT Y ++K    +  W  V   
Sbjct: 24743 ELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRV-GQ 24801

Query: 967   YHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKE 1004
                T  T+  L     Y FRV +EN  GLS+     + T+TKE
Sbjct: 24802 ARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 24844



 Score =  181 bits (460), Expect = 3e-45
 Identities = 166/686 (24%), Positives = 284/686 (41%), Gaps = 75/686 (10%)

Query: 350  DTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
            D    CGE V E + EV+  +   KW+             YR++   +      +GA+K 
Sbjct: 7260 DKWVACGEPVAETKMEVTGLEEG-KWYA------------YRVKALNR------QGASKP 7300

Query: 409  DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTK 466
                  +     Q + ++ +D+K L  LT      V  G +I L   ++     K  WTK
Sbjct: 7301 SRPTEEIQAVDTQEAPEIFLDVKLLAGLT------VKAGTKIELPATVTGKPEPKITWTK 7354

Query: 467  NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHVIDP- 521
              + +++  R+ + +  +   + I ++   D G Y+   +A NV    T   +V+V+D  
Sbjct: 7355 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII--EAVNVCGRATAVVEVNVLDKP 7412

Query: 522  -PKIILDGLDADNTVTVIAGNKLR-------LEIPISGEPPPKAMWSRGDKAIMEGSGRI 573
             P    D  D  N   ++  N  R           +        +W +    + + + + 
Sbjct: 7413 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFK- 7471

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             T+  P+   +    AE     +Y +    +A    A  +    D P PP     +++  
Sbjct: 7472 ATKLIPNKEYIFRVAAE----NMYGVGEPVQASPITAKYQ---FDPPGPPTRLEPSDITK 7524

Query: 634  DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
            D   + W  P  DGGSPI GY++ER    + +W+R N    K+TT+  K +     Y  R
Sbjct: 7525 DAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFR 7584

Query: 694  IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
            + A N  G  KPS  + P +   P+    PP   TV  V  T+V + W  P+H G A ++
Sbjct: 7585 VLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE 7644

Query: 751  GYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPI 810
             YV+E    GT++W+   +  +  T+  + GL    +   RV+AVN AG SEP   S P+
Sbjct: 7645 SYVIEMLKTGTDEWVRVAEG-VPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPV 7703

Query: 811  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP------------ELTWKKD 858
            L +E + PP    PR L+   I +    +   +P +    P               W+  
Sbjct: 7704 LCREKLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTV 7761

Query: 859  GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 918
               +   +  +      ++   R A  +  G+ D        +E + +       PGPP 
Sbjct: 7762 DTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTE-----IEDSVLAKDTFTTPGPPY 7816

Query: 919  IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY-HRTSATITEL 977
             + + DV   +V L W PPK+DG   I  Y I+K ++    W    +      +  +T++
Sbjct: 7817 ALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDV 7876

Query: 978  VIGNEYYFRVFSENMCGLSEDATMTK 1003
            + G E  F+V +EN  G+   +  T+
Sbjct: 7877 IEGTEVQFQVRAENEAGVGHPSEPTE 7902



 Score =  162 bits (411), Expect = 1e-39
 Identities = 110/364 (30%), Positives = 175/364 (48%), Gaps = 16/364 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V  G    F  EL+   + V+WY  G+++ PS K +   +G    L + + ++ D  E  
Sbjct: 5835 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 5894

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
            +TA D K    LFV+EPP+  TK LED T   G    LECEVS ++A VKWFKNG EI+ 
Sbjct: 5895 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 5954

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
              K  Y I  +G+   L+I   T  D   Y+      ++S  L+V    ++ L PLTD  
Sbjct: 5955 SKK--YEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ 6012

Query: 444  VNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V   +    +CE+S EN   KW K+G  +++  +  ++ KG +  LVI   L +DE +Y 
Sbjct: 6013 VREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY- 6071

Query: 503  FAPDAYNVTLPAKVHVIDPPKII---LDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
             + +         + V++   +    L  ++   T T+    KL  E+    +P  + +W
Sbjct: 6072 -SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTI----KLVCEV---SKPGAEVIW 6123

Query: 560  SRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
             +GD+ I+E +GR    +      LVI  A  +D+G Y+  L +   +    +     +F
Sbjct: 6124 YKGDEEIIE-TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEF 6182

Query: 620  PDPP 623
               P
Sbjct: 6183 ISKP 6186



 Score =  157 bits (398), Expect = 4e-38
 Identities = 105/308 (34%), Positives = 159/308 (51%), Gaps = 19/308 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +DPP+I +D    D T+ V AG   +++  I G+P P   W +GD+ +   + R+  +S 
Sbjct: 16166 VDPPRISMDPKYKD-TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKST 16223

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV-TEVGDDWCI 637
               +++L +  A R DSG Y +  KN AGE   ++ VKV+D P PP  P V + V  + C 
Sbjct: 16224 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCT 16283

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL----CKETTFEPKKMIEGVAYEVR 693
             + W+PP  DGGS I+ Y +ER++     W  ++ ++    CK T     K++EG  Y  R
Sbjct: 16284 LAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVT-----KLLEGNEYTFR 16338

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             I AVN  G+ +P + S P V   P  V   P    V +VT  ++ + W  P   G + + 
Sbjct: 16339 IMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEIL 16397

Query: 751   GYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPI 810
             GYVLE   +    W   +K LI + +  +TGL  +     RV A NAAG SEP   S P 
Sbjct: 16398 GYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENHDYEFRVSAENAAGLSEP---SPPS 16454

Query: 811   LVKEIIEP 818
               ++  +P
Sbjct: 16455 AYQKACDP 16462



 Score =  157 bits (398), Expect = 4e-38
 Identities = 101/319 (31%), Positives = 164/319 (51%), Gaps = 7/319 (2%)

Query: 506   DAYNVTLPAKV-HVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D   + LP  +   ++PP+I +    + +TV V AG+ L+++IPISG+P PK   SR D 
Sbjct: 20085 DPRELLLPVLIKEQLEPPEIDMKNFPS-HTVYVRAGSNLKVDIPISGKPLPKVTLSR-DG 20142

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R  TE   ++ T+ +  +   D+G Y I   N +G   A I + V+D P PP 
Sbjct: 20143 VPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPT 20202

Query: 625   APTV-TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P V +++ ++   + WEPP YDGGS +  Y + +++  ++ W  ++  + + T  +  K
Sbjct: 20203 GPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVAR-TMMKVMK 20261

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  GIS    S      +P     PP+   V +VT  ++T+ W  P
Sbjct: 20262 LTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 20321

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 801
                G + + GY LE     +  W  ANK +I  T F +T +        RV A NAAG  
Sbjct: 20322 VSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFRVYAENAAGVG 20381

Query: 802   EPKYYSQPILVKEIIEPPK 820
             +P + S+P+L  +  EPP+
Sbjct: 20382 KPSHPSEPVLAIDACEPPR 20400



 Score =  157 bits (397), Expect = 5e-38
 Identities = 212/890 (23%), Positives = 342/890 (38%), Gaps = 93/890 (10%)

Query: 267  GGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA 326
            G  V F+ EL   K+EV+W +N   +    K+    +G    L I + +  D  EY   A
Sbjct: 6554 GADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIA 6613

Query: 327  GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGP 385
             D++   +L +   P + T   +D     G+ + +         A  +WFK  E     P
Sbjct: 6614 KDKEARAKLELAAAPKIKTAD-QDLVVDVGKPLTMVVPYDAYPKAEAEWFKENE-----P 6667

Query: 386  KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLT--DQT 443
             S   I    ++    I  A K D   Y ++       A+  ++LK + +  P+   + T
Sbjct: 6668 LSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVT 6727

Query: 444  VNLGKEICLKCEISENIPGKWTKN-GLPVQESD---RLKVVHKGRIHKLVIA-NALTEDE 498
                 E+ L  E  E +    +K  G  V+  D   +  V+   R          L +  
Sbjct: 6728 ETFDGEVSLAWE--EPLTDGGSKIIGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGG 6785

Query: 499  GDYVFAPDAYNVTLPAKVHVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEP 553
             +Y+F   A N     +    D P     K  + G   + T+T +     R  + ++ EP
Sbjct: 6786 VEYLFRVSARNRVGTGEPVETDNPVEARSKYDVPGPPLNVTITDVN----RFGVSLTWEP 6841

Query: 554  PPKAMWSRGDKAIMEGSGRIR-------TESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            P     +     ++E   +         T    D S  V D+ E  +   + +  +N  G
Sbjct: 6842 PEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYS-FRVRAQNRIG 6900

Query: 607  EAHASIK---VKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660
                S     VKV D    P PPV  T ++       + WEPP  DGGSPILGY IER +
Sbjct: 6901 VGKPSAATPFVKVADPIERPSPPVNLTSSDQTQSSVQLKWEPPLKDGGSPILGYIIERCE 6960

Query: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS----------------K 704
            +    W+R N  L  E T++   + +G  Y  R+ A N  G+S                +
Sbjct: 6961 EGKDNWIRCNMKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVE 7020

Query: 705  PSMPSRPF---VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
            P+M    F   + + V +P T+L V S      T  W   D +   G    V        
Sbjct: 7021 PTMDLSAFKDGLEVIVPNPITIL-VPSTGYPRPTATWCFGDKVLETG--DRVKMKTLSAY 7077

Query: 762  EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 821
             + +++  +  DK  +T+       K+  RVK ++  G  +    ++P   KE+      
Sbjct: 7078 AELVISPSERSDKGIYTL-------KLENRVKTIS--GEIDVNVIARPSAPKELKFGDIT 7128

Query: 822  RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR 881
            +   HL        G +       + +     TW K    +   +  + +         +
Sbjct: 7129 KDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFK 7188

Query: 882  KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
               R+  G  +    VD+ V  ++        P PP+ VK  D    ++ LTW PPK+DG
Sbjct: 7189 VCARNKCGPGE-PAYVDEPVNMSTPATV----PDPPENVKWRDRTANSIFLTWDPPKNDG 7243

Query: 942  NAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATM 1001
             + I GY +++  + S +W    E    T   +T L  G  Y +RV + N  G S+ +  
Sbjct: 7244 GSRIKGYIVERCPRGSDKWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRP 7303

Query: 1002 TKESAVIARDGKIYKNPVYEDFDFSEAP---MFTQPLVNTYAIAGYNATLNCSVRGNPKP 1058
            T+E   +               D  EAP   +  + L      AG    L  +V G P+P
Sbjct: 7304 TEEIQAV---------------DTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEP 7348

Query: 1059 KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
            KITW K  + +  D R  + +     T+ I      D GTY  +AVN  G
Sbjct: 7349 KITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG 7398



 Score =  157 bits (397), Expect = 5e-38
 Identities = 146/550 (26%), Positives = 232/550 (42%), Gaps = 42/550 (7%)

Query: 360   ELEC-EVSEDDANVKWFK----NGEEII-----------PGPKSRYRIRVEGKKHILIIE 403
             ELE   +S+D   ++W K     G+EI+              K   + R++ K+    I 
Sbjct: 24064 ELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ--FTIG 24121

Query: 404   GATKADAAEYSVMT---TGGQSSAKLSVDLKPLK-------ILTPLTDQTVNLGKEICLK 453
             G  +A   E+ V     TG     + ++ +K          I   + D T  LG+   L 
Sbjct: 24122 GLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLS 24181

Query: 454   CEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYN 509
             C+I    +P  KW + G  + +S + K+   GR H L +     EDEG Y  +   +   
Sbjct: 24182 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 24241

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             V   +K+ +   P+    G           G+ LRL +   G P P   W  G K +++ 
Sbjct: 24242 VETSSKLLLQATPQFH-PGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK-LLQN 24299

Query: 570   SGRIRTESYPDSSTLVI-DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
             S  I  E+    + LV+ ++  +  +G Y + L N  G   A + V++ D PD P  P V
Sbjct: 24300 SENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV 24359

Query: 629   TE-VGDDWCIMNWEPPAYDGGSPILGYFIER-KKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              E +  +  +++W+PPA DGGS I  Y +E+ + K+ + W  ++  +   TT     + E
Sbjct: 24360 IEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAI-SVTTCRIVNLTE 24418

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
                Y  R+ A N  GIS P   S   +   P      P   T+ +VT  +  + W+PP  
Sbjct: 24419 NAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPAS 24478

Query: 744   IGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 803
              G A +  Y LE   +    WI    + I +T F++  L    +   RVK  N  G SE 
Sbjct: 24479 DGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEW 24538

Query: 804   KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEID 863
                S+PI  K  +          L+   +R    A  LV    G P+P + W + G EI 
Sbjct: 24539 SEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNA-TLVCKVTGHPKPIVKWYRQGKEII 24597

Query: 864   KNQINIRNSE 873
              + +  R  E
Sbjct: 24598 ADGLKYRIQE 24607



 Score =  156 bits (395), Expect = 9e-38
 Identities = 103/340 (30%), Positives = 163/340 (47%), Gaps = 15/340 (4%)

Query: 491   ANALTEDEGDYVFAPDAYNVT---LPAKVHVIDPPKIILDGLDA----DNTVTVIAGNKL 543
             A  LTE + +Y F   A N      P+++ V+    ++   LD     D        +  
Sbjct: 13570 AKDLTEGK-EYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF 13628

Query: 544   RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN 603
             RL+IPI G+P P   W +G+  +   + R+  ES   ++TL++   ++ D+G Y I LKN
Sbjct: 13629 RLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKN 13687

Query: 604   EAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
              AG    +I +KVV  P  P  P    EV  +   + W PP  DGGS I  Y +E++   
Sbjct: 13688 VAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSV 13747

Query: 663   SSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             +++W+       ++TTF   ++ EG+ Y  R+ A N  G+ +  + S P V   P  V  
Sbjct: 13748 NNKWVTCA-SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPD 13805

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTI 779
              P    +  V   +V++ W  P   G + + GY LE+    +  W  ANK  I    F +
Sbjct: 13806 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFKV 13865

Query: 780   TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
             TGL    +   RV A+N AG  +P   S+P++  + I+PP
Sbjct: 13866 TGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 13905



 Score =  155 bits (391), Expect = 3e-37
 Identities = 98/310 (31%), Positives = 156/310 (50%), Gaps = 8/310 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P++ L G+     V   AG+ +++EIP+ G P P   W +GD+ I++ + R+  E+   S
Sbjct: 14691 PELDLRGI-YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQ-ILKQTQRVNFETTATS 14748

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             + L I+   R DSG Y +  +N  GE    I ++V D P PP  P    EV  D+   +W
Sbjct: 14749 TILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSW 14808

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGG PI  Y +E ++  S+ W+ L   + + TT++  ++  G+ Y+ R+ A N  
Sbjct: 14809 DPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRY 14867

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+  P + S   V   P  V  PP    V +VT  ++T+ W  P   G + + GY +E  
Sbjct: 14868 GVG-PGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERK 14926

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                   W   +K L+    F  +GL        RV A N AG S+P   S+P+L  + I+
Sbjct: 14927 ERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPID 14986

Query: 818   PPKIRIPRHL 827
             PP   +P ++
Sbjct: 14987 PPGKPVPLNI 14996



 Score =  154 bits (389), Expect = 5e-37
 Identities = 103/318 (32%), Positives = 157/318 (49%), Gaps = 10/318 (3%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   +V + AK  VI P   +L      NT TV+AG  L++++P  G P P   W + D 
Sbjct: 15760 PRQLSVPVIAKDLVIPPAFKLLF-----NTFTVLAGEDLKVDVPFIGRPTPAVTWHK-DN 15813

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R+  ES  ++S L I  A R+D G Y + L N AGEA  ++ V V+D P PP 
Sbjct: 15814 VPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPT 15873

Query: 625   APT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P  + EV  D   ++W PP YDGGS I  Y +E++   ++ W  ++  + + TT +  +
Sbjct: 15874 GPVKMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVAR-TTIKACR 15932

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  G S    S P+    P  V  PP    V   +  ++ ++W  P
Sbjct: 15933 LKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEP 15992

Query: 742   DHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 801
                G + + GY LE     +  W+  NK  I +TKF  TGL    +   RV A N  G  
Sbjct: 15993 ISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIG 16052

Query: 802   EPKYYSQPILVKEIIEPP 819
             +P   S+  + ++  +PP
Sbjct: 16053 KPSKVSECYVARDPCDPP 16070



 Score =  149 bits (375), Expect = 2e-35
 Identities = 97/304 (31%), Positives = 142/304 (46%), Gaps = 5/304 (1%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ID P   LD    D  + V AG    LE  I G+P P  +WS+  K + E + R+  +S 
Sbjct: 18330 IDAPNASLDPKYKD-VIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 18388

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCI 637
                +TLV+    R D G Y + L N  G     I VKV+D P PP  P  VT V  + C 
Sbjct: 18389 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 18448

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + W PP  DGG+ I  Y IE+++     W +++ ++ +   ++  K++ G  Y  R+ AV
Sbjct: 18449 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAV 18507

Query: 698   NAIGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             N  GI +P  S P     P     PP+   V ++T  ++ + W  P   G   ++GY+LE
Sbjct: 18508 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILE 18567

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
                +    W   NK  +   +  +TGL        RV A NAAG  EP   S      + 
Sbjct: 18568 KRDKEGVRWTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDA 18627

Query: 816   IEPP 819
             + PP
Sbjct: 18628 LYPP 18631



 Score =  146 bits (369), Expect = 9e-35
 Identities = 189/864 (21%), Positives = 334/864 (38%), Gaps = 120/864 (13%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F VEL+   + VKW+KN Q +  +     + +G    +   +  + D S+  V A     
Sbjct: 5576 FTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSS 5635

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +L V E     T +L+D T    + V L+CE+S+ DA VKWFK+G+EI P   +   I
Sbjct: 5636 EAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNA--VI 5693

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
            + +GKK +LI++ A K+D  +Y+      ++S KL ++ + +K++ PL    V   +   
Sbjct: 5694 KADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETAR 5753

Query: 452  LKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
             + EISE +I   W   G  + ++   ++  +G+IH LV+ N   +  G   F   A NV
Sbjct: 5754 FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANV 5811

Query: 511  TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
               A + V   P++I   L     VTV AG     +  +S E  P   + +G K  +E S
Sbjct: 5812 KSSAHLRV--KPRVI-GLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKK--LEPS 5866

Query: 571  GRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             ++   S     TL +   + +D+G   +  K+    A+  +K   V+F  P    TV E
Sbjct: 5867 DKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEE 5926

Query: 631  VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE------PKKM 684
                            G + +L   + R+  +  +W +   ++ K   +E       +K+
Sbjct: 5927 ----------------GATAVLECEVSRENAK-VKWFKNGTEILKSKKYEIVADGRVRKL 5969

Query: 685  I--EGVAYEVRIFAVNA--------IGISKPSMP-SRPFVPLAVTSPPTLLTVDSVTDTT 733
            +  +    +++ +  +A        + +  P +   RP   L V           ++   
Sbjct: 5970 VIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSREN 6029

Query: 734  VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 793
              ++W      GA    G   +   +G    +V NK L+D           +A+    V+
Sbjct: 6030 AKVKWFKD---GAEIKKGKKYDIISKGAVRILVINKCLLD----------DEAEYSCEVR 6076

Query: 794  AVNAAG----ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 849
                +G      E   +++ +   E+ E   I++   +                    KP
Sbjct: 6077 TARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEV-------------------SKP 6117

Query: 850  RPELTWKKDGAE-IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV---KVDKFVETAS 905
              E+ W K   E I+  +  I       I+ I+ A    +G Y+ ++   + D  V+   
Sbjct: 6118 GAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHE 6177

Query: 906  IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ-KADKKSMEWFTVI 964
            +  + I +P   +I++     GE      +  K+        + +Q K D K++E     
Sbjct: 6178 LAAEFISKPQNLEILE-----GEKAEFVCSISKE-------SFPVQWKRDDKTLE----- 6220

Query: 965  EHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFD 1024
                           G++Y      +    + +DAT+      +   G            
Sbjct: 6221 --------------SGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAA---RAAAHLT 6263

Query: 1025 FSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVC 1084
              E      PL +T          NC V      K  W +N+ AI D  +Y +     V 
Sbjct: 6264 VIEKLRIVVPLKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIFDSSKYIILQKDLVY 6322

Query: 1085 TLEIRKPSPYDGGTYCCKAVNDLG 1108
            TL IR     D   Y     N  G
Sbjct: 6323 TLRIRDAHLDDQANYNVSLTNHRG 6346



 Score =  146 bits (369), Expect = 9e-35
 Identities = 96/339 (28%), Positives = 169/339 (49%), Gaps = 21/339 (6%)

Query: 496   EDEGDYVF---APDAYNVTLPAK----VHVID---PPKIILDGLDADNTVTVIAGNKLRL 545
             E++  Y F   A  A N++ P++    V ++    PP+I L  +   + +TV AG  + L
Sbjct: 12885 EEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS-VAMKSLLTVKAGTNVCL 12943

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
             +  + G+P P   W + D  +++ +  I+     +  TL +    R DSG Y I  +N +
Sbjct: 12944 DATVFGKPMPTVSWKK-DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSS 13002

Query: 606   GEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSR 665
             G   A+IK+KV+D P PP +  + ++  D  +++WEPP  DGGS I  Y +++++     
Sbjct: 13003 GSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPN 13062

Query: 666   WMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGI-----SKPSMPSRPFVPLAVTSP 720
             W +++  +   T+   +K+IEG  Y+ RI A N  G+     ++P++   P+ P     P
Sbjct: 13063 WAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 13121

Query: 721   PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTIT 780
             P    + ++T   +T+ W+PP   G + + GY+LE       +W   N+  I +     T
Sbjct: 13122 P---VISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKAT 13178

Query: 781   GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 819
             GL    +   RV A+N AG  +P   S+    ++   PP
Sbjct: 13179 GLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP 13217



 Score =  145 bits (365), Expect = 3e-34
 Identities = 110/374 (29%), Positives = 173/374 (46%), Gaps = 19/374 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            QV +    RF  EL+    +VKW+K+G EI+   KY    KG  RIL IN C + D++EY
Sbjct: 6012 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6071

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII 382
                   + S  L V E   + TK L +      + ++L CEVS+  A V W+K  EEII
Sbjct: 6072 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 6131

Query: 383  PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 442
                 RY I  EG+K IL+I+ A   DA  Y+      ++  K+ V     + ++   + 
Sbjct: 6132 --ETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL 6189

Query: 443  TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             +  G++    C IS E+ P +W ++   ++  D+  V+  G+   LV+ +A  +D G Y
Sbjct: 6190 EILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTY 6249

Query: 502  VF----APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKA 557
            V     A  A ++T+  K+ ++ P K        D  V          E+   G    KA
Sbjct: 6250 VVMVGAARAAAHLTVIEKLRIVVPLK--------DTRVKEQQEVVFNCEVNTEG---AKA 6298

Query: 558  MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV 617
             W R ++AI + S  I  +      TL I  A  DD   Y+++L N  GE   S    +V
Sbjct: 6299 KWFRNEEAIFDSSKYIILQK-DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV 6357

Query: 618  DFPDPPVAPTVTEV 631
            +  D  +   + ++
Sbjct: 6358 EEEDLRIVEPLKDI 6371



 Score =  144 bits (362), Expect = 6e-34
 Identities = 89/302 (29%), Positives = 150/302 (49%), Gaps = 8/302 (2%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P   L G+  +  +T  AG+   +++PISG P PK  W   +  + E + R+   +  D 
Sbjct: 22273 PTADLTGI-TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE-TDRVSITTTKDR 22330

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             +TL +  + R DSG Y + L+N AG    S+ V V+  P P   P  V+ V  + C+++W
Sbjct: 22331 TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSW 22390

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P   GG+ I  Y +E+++  ++ W  +N  + K T  +   + + + Y  R+ + N  
Sbjct: 22391 GEPKDGGGTEITNYIVEKRESGTTAWQLVNSSV-KRTQIKVTHLTKYMEYSFRVSSENRF 22449

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+SKP + S P +   P    S PT   V  V+   +++RW  P H G + + GY +E  
Sbjct: 22450 GVSKP-LESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKK 22508

Query: 758   FEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
                T  W+  NK    +  + +TGL    +   R  A+NAAG S+    S+PI+ +  ++
Sbjct: 22509 ERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVD 22568

Query: 818   PP 819
              P
Sbjct: 22569 AP 22570



 Score =  142 bits (359), Expect = 1e-33
 Identities = 133/536 (24%), Positives = 207/536 (38%), Gaps = 70/536 (13%)

Query: 617  VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
            +D P PP  PTV +VG     +NW  P +DGG+ I  Y IE  K  +  W+R+   +   
Sbjct: 7609 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTT 7668

Query: 677  TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTT 733
                P  M EG  Y  R+ AVN  G S+PS PS P +    L   SPP  L V ++T  T
Sbjct: 7669 QHLLPGLM-EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 7727

Query: 734  VTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 793
              ++W  P+  G + +  Y++E      + W   +  + D TK T+T L   +    RV 
Sbjct: 7728 ADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKD-TKCTVTPLTEGSLYVFRVA 7786

Query: 794  AVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 853
            A NA G S+       +L K+    P                G    L +    K   +L
Sbjct: 7787 AENAIGQSDYTEIEDSVLAKDTFTTP----------------GPPYALAVVDVTKRHVDL 7830

Query: 854  TW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI 910
             W   K DG    +  +  +     T    R  +   +   D   +V   +E   +  Q+
Sbjct: 7831 KWEPPKNDGGRPIQRYVIEKKERLGT----RWVKAGKTAGPDCNFRVTDVIEGTEVQFQV 7886

Query: 911  -----------------------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITG 947
                                      P PP  + + D   +++A+ W PP+ +G + I G
Sbjct: 7887 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 7946

Query: 948  YTIQKADKKSMEWFTVIEHYHRTSATITE--LVIGNEYYFRVFSENMCGLSEDATMTKES 1005
            Y ++     + +W  V     +      E  +V   EY  RV + N  G+SE + +++  
Sbjct: 7947 YHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISEN- 8005

Query: 1006 AVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKN 1065
             V+A+D         E  D                I G   ++    R  P P ++W K+
Sbjct: 8006 -VVAKDPDCKPTIDLETHDI-------------IVIEGEKLSIPVPFRAVPVPTVSWHKD 8051

Query: 1066 KVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
               +    R  M ++     LE+ K    D G Y     N LG+      + VKVI
Sbjct: 8052 GKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSA--TASINVKVI 8105



 Score =  140 bits (352), Expect = 9e-33
 Identities = 91/298 (30%), Positives = 146/298 (48%), Gaps = 7/298 (2%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PPK  LD     + VT+ AG+ L L+  + G+P PK +W++GDK  ++   ++  +    
Sbjct: 22671 PPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKE-LDLCEKVSLQYTGK 22729

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              +T VI   +R DSG Y + +KN +G    S+ VKV+D P P    TV+ V  + C + W
Sbjct: 22730 RATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAW 22789

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGG+ I  Y +ER++     W+ +  + C   ++   ++I+   Y  R+ AVN  
Sbjct: 22790 SLPQEDGGAEITHYIVERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKY 22848

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P + S P V      + SPP +          + ++W  P+  G   +  Y+++  
Sbjct: 22849 GPGVP-VESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKR 22907

Query: 758   FEGTEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKE 814
              + +  W   NKD ++  T+  +T L        RV AVNAAG SEP   S  I  +E
Sbjct: 22908 EKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCRE 22965



 Score =  139 bits (350), Expect = 2e-32
 Identities = 112/414 (27%), Positives = 188/414 (45%), Gaps = 21/414 (5%)

Query: 270  VRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDE 329
            + F V +    +  KW KNG EI+ + K     K     L I N    D ++Y   AG  
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 330  KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRY 389
              +  L+V    I   K ++D      +R   ECEVSE D  V+W K+ +E+      R 
Sbjct: 3000 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRI 3057

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
            +I+ E   H L+I     +DA +Y+V+  G  S+AKL V+ + ++I +   +  V   + 
Sbjct: 3058 KIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3117

Query: 450  ICLKCEISE-NIPGKWTKNGLPV--QESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD 506
              ++ E++E ++   W K+G+ +  Q  +R K V + RIH++ I+     D G+Y F   
Sbjct: 3118 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3177

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                ++   V+  +PP++    L     VTV +G   R    ISG P PK  W + ++ +
Sbjct: 3178 RNRSSVTLYVNAPEPPQV----LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL 3233

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG----EAHASIKVKVVDFPD- 621
              G  + +        TL++  A  +D+ VY    KN+ G     A  S++V  V  PD 
Sbjct: 3234 STGF-KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3292

Query: 622  --PPVAPTVTEVGDDWCIMNWEPPAY----DGGSPILGYFIERKKKQSSRWMRL 669
              P   P +     D      +P  +     G    + ++ + KK + SR+ R+
Sbjct: 3293 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3346



 Score =  139 bits (350), Expect = 2e-32
 Identities = 158/612 (25%), Positives = 260/612 (42%), Gaps = 77/612 (12%)

Query: 267   GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
             GG +R  V +   P  EVKW K   EIR +   I +       L ++N    D  +Y +T
Sbjct: 16585 GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFTSLVLDNVNRYDSGKYTLT 16642

Query: 326   AGDEKCSTELFVR-------EPPI--MVTKQLEDTTAYCGERVELECE-------VSEDD 369
               +   +   FV         PP+   VT+  +D+ +   E   L+         V + +
Sbjct: 16643 LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKRE 16702

Query: 370   ANVKWF--------KNG---EEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
             A  K +        KN    +++  G    +R+  E +  I        A  A+   +  
Sbjct: 16703 ATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI-----GLPAQTADPIKVAE 16757

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESD 475
               Q   K++VD         +T  +V+L     E     +I + I     K+     E  
Sbjct: 16758 VPQPPGKITVD--------DVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA 16809

Query: 476   RLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN-----------VTLPAKVHVIDPPKI 524
             R+K +      + VI N LT+ E +Y+F   A N           V + AK  VI+P   
Sbjct: 16810 RVKSL------QAVITN-LTQGE-EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP--- 16858

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTL 584
               D   A ++ +V  G  L++E+PISG P P   W++ D   ++ + RI      D +TL
Sbjct: 16859 --DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTK-DGLPLKQTTRINVTDSLDLTTL 16915

Query: 585   VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPP 643
              I    +DD G Y I + N  G+  ASI++  +D PDPP  P    +V  +   ++W PP
Sbjct: 16916 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPP 16975

Query: 644   AYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
              Y GG  I  Y ++++   ++ W  ++  + + TT +  K+  G  Y+ RIFA N  G S
Sbjct: 16976 LYTGGCQITNYIVQKRDTTTTVWDVVSATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQS 17034

Query: 704   KPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
               ++ S P V   P     PP      +++  ++ ++W  P + G + + GY LE     
Sbjct: 17035 F-ALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERN 17093

Query: 761   TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 820
             +  W   NK +I  T+F    L    +   RV A N  G  +    S+  + ++  +PP 
Sbjct: 17094 SILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPG 17153

Query: 821   IRIPRHLKQTYI 832
                P  +K+  I
Sbjct: 17154 TPEPIMVKRNEI 17165



 Score =  138 bits (347), Expect = 3e-32
 Identities = 89/302 (29%), Positives = 146/302 (48%), Gaps = 6/302 (1%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P I+  G +  + + + +G  LR++  + G P P+  W + D   +E    +       S
Sbjct: 21583 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGS 21641

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             ++L +  A RD  GVY +  KN +G A A IKVKV D P   V P   T +  +   + W
Sbjct: 21642 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWW 21701

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             + P  DG +PI  Y IE+++     W  +  D C+  ++   K+I G  Y+ R+ AVN  
Sbjct: 21702 DAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNEYQFRVSAVNKF 21760

Query: 701   GISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
             G+ +P  S P    +   V   P +    ++T  ++T+ W  P+  G + +  Y+LE   
Sbjct: 21761 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERRE 21820

Query: 759   EGTEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 817
             + +  W+ V +K  I +T+F +TGL    +    V A NAAG       S+ I  +E + 
Sbjct: 21821 KKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVN 21880

Query: 818   PP 819
             PP
Sbjct: 21881 PP 21882



 Score =  136 bits (343), Expect = 1e-31
 Identities = 105/376 (27%), Positives = 169/376 (44%), Gaps = 13/376 (3%)

Query: 247  EEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQ 306
            + K+   F + L      +K     F  E ++P ++VKWYK+G E+    KY        
Sbjct: 2123 QAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKV 2182

Query: 307  RILFINNCQMTDDSEY-YVTAGDE--KCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
              L I     +D  +Y  V   DE  K + +L V    +   K+L+D         ELEC
Sbjct: 2183 HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC 2242

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS 423
             VS ++   KW+ N  E+      +Y I     +  L ++  TK D  EYS +  G +++
Sbjct: 2243 IVSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT 2300

Query: 424  AKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHK 482
             KL +  +P+ IL  L+DQ V  G  + L+ ++S E++ G W K+G  VQ SDR+ +V  
Sbjct: 2301 CKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID 2360

Query: 483  GRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNK 542
             + H L+I +   ED G+Y F   A  ++   +V V       +D +     V VI G K
Sbjct: 2361 KQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-----VDVITPLKDVNVIEGTK 2415

Query: 543  LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
              LE  +S        W   D+ I +   R++         LVI+     D G Y + + 
Sbjct: 2416 AVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2474

Query: 603  NEAGEAHASI-KVKVV 617
                  + S+ K+K++
Sbjct: 2475 RVETNCNLSVEKIKII 2490



 Score =  134 bits (338), Expect = 4e-31
 Identities = 201/832 (24%), Positives = 325/832 (39%), Gaps = 120/832 (14%)

Query: 337   VREPPIMVTKQLEDTTAY-CGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
             V  P I V  + +DT     GE   LE +VS      ++W K+G+E+     ++  I++ 
Sbjct: 15084 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL--EGTAKLEIKIA 15141

Query: 395   GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC 454
                  L+ + +T+ D+  Y++  T     AK   ++K L    P  +  + + +    KC
Sbjct: 15142 DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP-PEGPLAVTEVTSEKC 15200

Query: 455   EISENIP-----GKWTKNGLPVQESDRL---KVVHKGRIHKLVIANALTEDEGDY-VFAP 505
              +S   P      K     +  +E+ RL    V  + ++ KL +   L  +E  + V A 
Sbjct: 15201 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV 15260

Query: 506   DAYNVTLPAKVHVI---------DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             + Y V  P +   +         DPPK        +  VT I  + +   +   G P   
Sbjct: 15261 NKYGVGEPLESEPVLAVNPYGPPDPPK--------NPEVTTITKDSM---VVCWGHPDSD 15309

Query: 557   A-------MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                     +  R DKA      +   ++  D    V  + E  +   + I  +N AG   
Sbjct: 15310 GGSEIINYIVERRDKAGQRWI-KCNKKTLTDLRYKVSGLTEGHEYE-FRIMAENAAGISA 15367

Query: 607   EAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQS 663
              +  S   K  D    P PP  P V +       + W  P YDGGS I GY +E    + 
Sbjct: 15368 PSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEE 15427

Query: 664   SRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM-PSRPFVPLAVTSPP 721
               W  +      K T++    + E   Y++RI+A+N+ G+ +P++ P  P     +  P 
Sbjct: 15428 DEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPE 15487

Query: 722   TLLTVDSVTDTT----------VTMRWRPPDHIGAAGLDGYVLEYC-FEGTEDW---IVA 767
               L  D     T          V ++ RP   +  A   G  L+    E T  +   IV 
Sbjct: 15488 IELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTLLIVG 15547

Query: 768   NKDLIDKTKF--TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII--------E 817
             N +  D  K+  T+         FV V+ ++  G        Q + VKE+         +
Sbjct: 15548 NVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPP------QDLKVKEVTKTSVTLTWD 15601

Query: 818   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI 877
             PP +     +K  YI    E+             + +WK D  +           E  + 
Sbjct: 15602 PPLLDGGSKIKN-YIVEKRESTRKAYSTVATNCHKTSWKVDQLQ-----------EGCSY 15649

Query: 878   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 937
              F   AE  +         +    ETA   ++  +RP PP  + + DV   +V+L+W  P
Sbjct: 15650 YFRVLAENEYG--------IGLPAETAE-SVKASERPLPPGKITLMDVTRNSVSLSWEKP 15700

Query: 938   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 997
             + DG + I GY ++   K S +W T       T ATIT L+ G EY FRV ++N  G+S+
Sbjct: 15701 EHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFRVSAQNEKGISD 15759

Query: 998   DATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNP 1056
                ++    VIA+D  I              P   + L NT+ + AG +  ++    G P
Sbjct: 15760 PRQLSVP--VIAKDLVI--------------PPAFKLLFNTFTVLAGEDLKVDVPFIGRP 15803

Query: 1057  KPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              P +TW K+ V +    R    S +    L I+     D G Y  K  N  G
Sbjct: 15804 TPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG 15855



 Score =  131 bits (329), Expect = 4e-30
 Identities = 135/530 (25%), Positives = 203/530 (38%), Gaps = 77/530 (14%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETT 678
             P PP  P V +       ++W  PAYDGGSPI+GY +E K+  S  W+R N     ++T 
Sbjct: 13217 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13276

Query: 679   FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPP----------TLLTVDS 728
             FE   ++E   Y+ R++AVN IG S PS       P  +  PP          TL+    
Sbjct: 13277 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13336

Query: 729   VT-DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAK 787
             VT    V ++ RPP  I                   W   N +L D+    I    TD  
Sbjct: 13337 VTMRLYVPVKGRPPPKI------------------TWSKPNVNLRDRIGLDIKS--TDFD 13376

Query: 788   IFVRVKAVNAAGASE----------PKYYSQPILVKEIIEPP-KIRIPRHLKQT------ 830
              F+R + VN   A +           K Y+  + V +   PP  + +    K +      
Sbjct: 13377 TFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWE 13436

Query: 831   --YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHS 888
                I      +N V+  Q +     +W     E  K    + N E     F R    +  
Sbjct: 13437 PPIIDGGSPIINYVV--QKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEY 13494

Query: 889   GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 948
             G  D     D         ++    PGP   +K+  V   + ++ W  P  DG + I GY
Sbjct: 13495 GIGDPGETRDA--------VKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGY 13546

Query: 949   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1008
              +    +++ +W  V++       +  +L  G EY FRV +EN  G    + +T    V+
Sbjct: 13547 VVDFLTEEN-KWQRVMKSL-SLQYSAKDLTEGKEYTFRVSAENENGEGTPSEIT----VV 13600

Query: 1009  ARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVA 1068
             ARD     + V  D D    P          A    N  L   ++G P P ++W K +  
Sbjct: 13601 ARD-----DVVAPDLDLKGLPDLCY-----LAKENSNFRLKIPIKGKPAPSVSWKKGEDP 13650

Query: 1069  IVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             +  D R  + S+    TL +      D G Y     N  GT E    ++V
Sbjct: 13651 LATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKV 13700



 Score =  130 bits (328), Expect = 5e-30
 Identities = 80/234 (34%), Positives = 120/234 (51%), Gaps = 8/234 (3%)

Query: 272  FVVELADPKLE-VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            F VEL  P ++ V+W KNG  +  + KY    KG    L I NC + D+S Y    G   
Sbjct: 2680 FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2739

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S  L V    + + K+ +D TA     V  E  VS D   VKWF    EI P  K  +R
Sbjct: 2740 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK--HR 2795

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            +  E K H L+++  + +DA EY+ +   GQ   K  + ++ L I   + +  V   K  
Sbjct: 2796 LVSERKVHKLMLQNISPSDAGEYTAVV--GQLECKAKLFVETLHITKTMKNIEVPETKTA 2853

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              +CE+S  N+P  W KNG+ ++ S++ K+V +G++H+L+I N  TED  +Y F
Sbjct: 2854 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF 2907



 Score =  129 bits (324), Expect = 2e-29
 Identities = 123/461 (26%), Positives = 196/461 (42%), Gaps = 58/461 (12%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVID 520
             KWTK G  +  S R  +       +LVI  A   D G Y  V         +  KV VI 
Sbjct: 23797 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIG 23854

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP------------------PKAMWSRG 562
              P      L+ D+             + +S  PP                  PKA W   
Sbjct: 23855 SPNSPEGPLEYDDIQV--------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTI 23906

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKV- 616
             D        R+R       ++LV+   + +    + ++ +N+ G     ++   +  K  
Sbjct: 23907 DS-------RVR------GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP 23953

Query: 617   VDFPDPPV-APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
             ++ P+PP   P V +V      ++W  P  DGGS + GY+IERK+  + +W+R N     
Sbjct: 23954 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 24013

Query: 676   ETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDT 732
              T +    ++    Y+ RI A N +G+S+ S  S P V   P    S P  L + S++  
Sbjct: 24014 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 24073

Query: 733   TVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 792
             +VT++W  P+  G   + GY +EY   G   W  +NK+ I   +FTI GL    +   RV
Sbjct: 24074 SVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRV 24133

Query: 793   KAVNAAGASEPKYYSQPILVKEII-EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 851
              A N  G S P+  +  I  K    E P IR  + +K     ++GEA  L     G+P P
Sbjct: 24134 FAENETGLSRPRRTAMSIKTKLTSGEAPGIR--KEMKDV-TTKLGEAAQLSCQIVGRPLP 24190

Query: 852   ELTWKKDGAEIDKNQINIRNSETDT-IIFIRKAERSHSGKY 891
             ++ W + G E+ +++    +S+  T  + +   E+   G Y
Sbjct: 24191 DIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 24231



 Score =  128 bits (322), Expect = 3e-29
 Identities = 101/352 (28%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V +G    FV EL+  K+ V W+KN  ++  S   +   +G    L +    + D S+  
Sbjct: 5213 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 5272

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
                +   + +L V E     T +L D TA   + + L+CEVS+ D  VKWFK+GEEI+P
Sbjct: 5273 AQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWFKDGEEIVP 5331

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
             PK  Y I+ +G + IL I+ A   D  EY       ++ A ++V+ + +K+  PL    
Sbjct: 5332 SPK--YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVE 5389

Query: 444  VNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V +G+    + E+SE ++ G+W   G P+  S   +++  G+ H L++ N      G+  
Sbjct: 5390 VFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVS 5449

Query: 503  FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
            F   A N    A + V + P I +  L   + V V   ++ + E  +S E P    W +G
Sbjct: 5450 F--QAANAKSAANLKVKELPLIFITPL---SDVKVFEKDEAKFECEVSRE-PKTFRWLKG 5503

Query: 563  DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
             + I  G  R          ++VI  A  +D   Y      EA + H S K+
Sbjct: 5504 TQEI-TGDDRFELIKDGTKHSMVIKSAAFEDEAKYMF----EAEDKHTSGKL 5550



 Score =  127 bits (320), Expect = 5e-29
 Identities = 123/540 (22%), Positives = 217/540 (40%), Gaps = 60/540 (11%)

Query: 597   YHINLKNEAG---EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             Y +  +N AG    +  S  ++  D    P PP  P + + G     + W  P +DGG+P
Sbjct: 19683 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19742

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
             I GY +E KK   + W + +    + T +    +  G  Y  R+ +VN +G S PS  S 
Sbjct: 19743 ITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 19801

Query: 711   PFVPLAVTSPP----------TLLTVDSVTDT-TVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             P +       P          TL+     + T TV  R RP  ++  +  D  +    + 
Sbjct: 19802 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYV 19861

Query: 760   GTED----WIVANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK 813
              T D      + N +  D  K+T+T   + + A + + VK ++  G          I V+
Sbjct: 19862 DTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTN------ITVQ 19915

Query: 814   EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSE 873
             ++ +   +     L        G A       + +   +  W       ++    + N +
Sbjct: 19916 DVTKESAV-----LSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQ 19970

Query: 874   TDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALT 933
                I + R      SG+ +  V +    ET    ++I ++P PP+ + +  +  ++V+LT
Sbjct: 19971 EGAIYYFRV-----SGENEFGVGIP--AETKE-GVKITEKPSPPEKLGVTSISKDSVSLT 20022

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWF--TVIEHYHRTSATITELVIGNEYYFRVFSEN 991
             W  P+ DG + I  Y ++  +K    W    V +  H   + + E    +EY+FRVF+EN
Sbjct: 20023 WLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRE---NSEYFFRVFAEN 20079

Query: 992   MCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCS 1051
               GLS+   +            +    + E  +  E  M   P    Y  AG N  ++  
Sbjct: 20080 QAGLSDPREL------------LLPVLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIP 20127

Query: 1052  VRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVE 1111
             + G P PK+T  ++ V +    R+         T+ +++    D G Y   A N  GT +
Sbjct: 20128 ISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTK 20187



 Score =  125 bits (315), Expect = 2e-28
 Identities = 87/266 (32%), Positives = 123/266 (46%), Gaps = 11/266 (4%)

Query: 247  EEKKSAAFAKIL--DPAYQV---DKGGRVRFVVEL---ADPKLEVKWYKNGQEIRPSTKY 298
            +E  S A  K+L  DP + V   DK    +  + L       + VKW+K+G+EI PS KY
Sbjct: 5276 KELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKY 5335

Query: 299  IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGER 358
              +  G +RIL I    + D  EY    G +K    + V    I V K L     + GE 
Sbjct: 5336 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGET 5395

Query: 359  VELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
               E E+SE D + +W   G+ +   P     I  +GKKHILI+         E S    
Sbjct: 5396 AHFEIELSEPDVHGQWKLKGQPLTASPDC--EIIEDGKKHILILHNCQLGMTGEVSFQAA 5453

Query: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
              +S+A L V   PL  +TPL+D  V    E   +CE+S E    +W K    +   DR 
Sbjct: 5454 NAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRF 5513

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVF 503
            +++  G  H +VI +A  EDE  Y+F
Sbjct: 5514 ELIKDGTKHSMVIKSAAFEDEAKYMF 5539



 Score =  122 bits (306), Expect = 2e-27
 Identities = 197/849 (23%), Positives = 321/849 (37%), Gaps = 123/849 (14%)

Query: 319   DSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAY-CGERVELECEV-SEDDANVKWFK 376
             DS   +TA DE       V  P I +  +  DT     GE   LE +V  +    ++W +
Sbjct: 17237 DSTGPITAKDE-------VELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 17289

Query: 377   NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL 436
               +EI     +R  I+    K +LI++ A + D  +Y +  +    S    V++K L   
Sbjct: 17290 GDKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 17347

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKL-------- 488
              P  +  V +      KC ++ + P +    G  +       VV K    +L        
Sbjct: 17348 GP-PEGPVQVTGVTSEKCSLTWSPPLQ--DGGSDISHY----VVEKRETSRLAWTVVASE 17400

Query: 489   VIANALTEDE----GDYVF---APDAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAG 540
             V+ N+L   +     +YVF   A + Y V  P +   V+     +L G      VT IA 
Sbjct: 17401 VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAK 17460

Query: 541   NKLRLEIPISGEPPPKAMWSRGDKA--------IMEGSGRIRTESYPDSSTLVIDIAER- 591
             + + +             W+R D          I+E   R        +   + D+  R 
Sbjct: 17461 DSMTV------------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 17508

Query: 592   -----DDSGVYHINLKNEAGEAH---ASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNW 640
                  D    + ++ +N AG      A++  K  D    P PP    + +   +   + W
Sbjct: 17509 TGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 17568

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNA 699
               P YDGGS ILGY +E  K     W  +      + T FE  K+ E   Y++R+ A+N 
Sbjct: 17569 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 17628

Query: 700   IGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMR------------WRPPDHIGAA 747
             +G+ + +       P      P L  +DS     + +R             RP   I  +
Sbjct: 17629 VGLGEATSVPGTVKPEDKLEAPEL-DLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWS 17687

Query: 748   GLDG-YVLEYCFEGTEDWI---VANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGAS 801
               +G +  +   E   ++    + N D  D  K+ +           FV VK ++  G  
Sbjct: 17688 REEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPP 17747

Query: 802   EPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE 861
                   Q + VKE+ +     +    +   I    +  N VI  +   R    +    ++
Sbjct: 17748 ------QNLAVKEVRKDSAFLV---WEPPIIDGGAKVKNYVIDKRESTRK--AYANVSSK 17796

Query: 862   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 921
               K    + N     I + R    +  G       V   VET    ++  + P PP  V 
Sbjct: 17797 CSKTSFKVENLTEGAIYYFRVMAENEFG-------VGVPVETVDA-VKAAEPPSPPGKVT 17848

Query: 922   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 981
             + DV   + +L W  P+ DG + + GY ++   K + +W  V E     +A +T L  G 
Sbjct: 17849 LTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAVVTGLSSGQ 17907

Query: 982   EYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1041
             EY FRV + N  G S+   +     VIA+D  I              P    P  NTY+I
Sbjct: 17908 EYQFRVKAYNEKGKSDPRVLGVP--VIAKDLTIQ-------------PSLKLPF-NTYSI 17951

Query: 1042  -AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
              AG +  +   V G P+P I+W+K+   +    R  +        L I++ +  D G Y 
Sbjct: 17952 QAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYT 18011

Query: 1101  CKAVNDLGT 1109
               A N  GT
Sbjct: 18012 VTATNSAGT 18020



 Score =  121 bits (304), Expect = 3e-27
 Identities = 185/870 (21%), Positives = 323/870 (37%), Gaps = 146/870 (16%)

Query: 313   NCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDA 370
             N     DS   +TA DE       +  P   +  + +D    + GE   LE ++  +   
Sbjct: 18313 NFSEPSDSSGAITARDE-------IDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIP 18365

Query: 371   NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSV 428
             +V W K+G+E+     +R  I+   +K  L+++   + D  +Y   +   GG  S  ++V
Sbjct: 18366 DVVWSKDGKEL-EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITV 18424

Query: 429   DLK--------PLKIL------------TPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
              +         PLK+              PL D   N+   I  K E S      WT+  
Sbjct: 18425 KVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL---SWTQVS 18481

Query: 469   LPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVHVID----- 520
               VQ  +        ++ KL+  N       +Y+F   A + Y +  P +   +      
Sbjct: 18482 TEVQALNY-------KVTKLLPGN-------EYIFRVMAVNKYGIGEPLESGPVTACNPY 18527

Query: 521   -----PPKIILDGLDADNTVTVIA------GNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
                  P    +  +  D+ V   A      G ++   I +         W++ +K  +  
Sbjct: 18528 KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI-LEKRDKEGVRWTKCNKKTLTD 18586

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE-AHASIKVKVVDF---PDPPVA 625
               R+R     +  +    +A  + +GV         GE +  S+  +  D    P PP  
Sbjct: 18587 L-RLRVTGLTEGHSYEFRVAAENAAGV---------GEPSEPSVFYRACDALYPPGPPSN 18636

Query: 626   PTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT------F 679
             P VT+       + W  P YDGG+P+ GY +E K+  +  W       C   T      F
Sbjct: 18637 PKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-----CTPPTGLQGKQF 18691

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTL-----------LTVDS 728
                K+ E   Y  RI A+N+ G+ +P+      V      PP +           L   +
Sbjct: 18692 TVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASA 18751

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYC-FEGTEDW---IVANKDLIDKTKFTIT--GL 782
                  VT++ RP   +     +G + +    E T  +   ++ N    D  ++ +T    
Sbjct: 18752 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENN 18811

Query: 783   PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 842
                   FV V+ +++  A        P+ +  I E  K  +    +   I    +  N +
Sbjct: 18812 SGSKTAFVNVRVLDSPSA--------PVNLT-IREVKKDSVTLSWEPPLIDGGAKITNYI 18862

Query: 843   IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
             +  +   R       +     K    I N +     + R      S +Y + +  +    
Sbjct: 18863 VEKRETTRKAYATITNNCT--KTTFRIENLQEGCSYYFRVLA---SNEYGIGLPAE---- 18913

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
               +  +++ + P PP  V + DV      + W  P+ DG + ITGY ++   K S +W T
Sbjct: 18914 -TTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWST 18972

Query: 963   VIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYED 1022
               +      ATI+ L  G EY FRV + N  G S+   +     VIARD +I        
Sbjct: 18973 CTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP--VIARDIEI-------- 19021

Query: 1023  FDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1082
                   P    P       A     ++   +G P+  + W K+   + +  R  + S++ 
Sbjct: 19022 -----KPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKT 19076

Query: 1083  VCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1112
             V +L I++ S  D GTY     N  G++ +
Sbjct: 19077 VTSLSIKEASKEDVGTYELCVSNSAGSITV 19106



 Score =  120 bits (302), Expect = 6e-27
 Identities = 142/561 (25%), Positives = 214/561 (38%), Gaps = 83/561 (14%)

Query: 597   YHINLKNEAGEAHASIKVKVVDF------PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + ++ +NE G    S   K V        P PPV P   +   +   + W+PP +DGGS 
Sbjct: 10712 FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSK 10771

Query: 651   ILGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             ILGY +E +K     W R N   + C ET ++   + +G  Y+ R+ AVNA G S P+  
Sbjct: 10772 ILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHV 10831

Query: 709   SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTE----DW 764
               P +      PP L     + D  +        HI     D   L    +G       W
Sbjct: 10832 PEPVLVKDRLEPPEL-----ILDANMARE----QHIKVG--DTLRLSAIIKGVPFPKVTW 10880

Query: 765   IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG----ASEPKYYSQPILVKEIIEPPK 820
                ++D   K +  +T  P  +K+ +R  A    G      E    S+ + VK ++   K
Sbjct: 10881 KKEDRDAPTKARIDVT--PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLD-K 10937

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK---DGAEIDKNQINIRNSETD-- 875
                PR L+ + IR              K    LTWK+   DG  +  N +  R       
Sbjct: 10938 PGPPRDLEVSEIR--------------KDSCYLTWKEPLDDGGSVITNYVVERRDVASAQ 10983

Query: 876   -TIIFIRKAERSHSGKY-------------DLQVKVDKFVETASIDIQIIDR---PGPPQ 918
              + +     ++SH  K+             + Q     FVET    I+ +D    PGPP+
Sbjct: 10984 WSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPK-PIKALDPLHPPGPPK 11042

Query: 919   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 978
              +   DV    V+L W  P  DG + ITGY ++  ++ + +W    +        +T L 
Sbjct: 11043 DLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-FKTVTNLECVVTGLQ 11101

Query: 979   IGNEYYFRVFSENMCGLS-EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1037
              G  Y FRV +EN+ GL   D T+  E        K+    V  D    E  +       
Sbjct: 11102 QGKTYRFRVKAENIVGLGLPDTTIPIEC-----QEKLVPPSVELDVKLIEGLVVK----- 11151

Query: 1038  TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1097
                 AG        +RG P P   W  +   I  D  Y + ++     L I+     D G
Sbjct: 11152 ----AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTG 11207

Query: 1098  TYCCKAVNDLGTVEIECKLEV 1118
              Y     N  G+  +   L V
Sbjct: 11208 EYQITVSNAAGSKTVAVHLTV 11228



 Score =  120 bits (301), Expect = 7e-27
 Identities = 130/513 (25%), Positives = 208/513 (40%), Gaps = 41/513 (7%)

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KG+W+    + GKHL L       S  +   + I   K +  G Y    TYK      S 
Sbjct: 2603 KGEWL----RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSA 2654

Query: 156  DLEVH--ESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWEL 213
             L+V   +   T  N+ +          +     +     +K   V +  E+  + V   
Sbjct: 2655 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV--- 2711

Query: 214  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVD--KGGRVR 271
                K + Y        I D      RL R+    +      KI+     V   +   V 
Sbjct: 2712 ----KGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVA 2767

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F V ++   + VKW+    EI+PS K+    +     L + N   +D  EY    G  +C
Sbjct: 2768 FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLEC 2827

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +LFV    + +TK +++      +    ECEVS  +    W KNG EI    K  ++I
Sbjct: 2828 KAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK--FKI 2883

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             V+GK H LII   +  D+AEY+ +    Q SA L+V   P+ I + L D  +N  ++  
Sbjct: 2884 VVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMITSMLKD--INAEEKDT 2939

Query: 452  LKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD-- 506
            +  E++ N  G   KW KNG+ ++ +D+ ++  K   H L I N    D  DY F     
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                TL  +   I+  K I D       + V+   +   E  +S EP     W + D+  
Sbjct: 3000 TSTATLYVEARHIEFRKHIKD-------IKVLEKKRAMFECEVS-EPDITVQWMKDDQE- 3050

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            ++ + RI+ +       L+I      D+G Y +
Sbjct: 3051 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3083



 Score =  120 bits (301), Expect = 7e-27
 Identities = 89/317 (28%), Positives = 143/317 (45%), Gaps = 11/317 (3%)

Query: 256  KILDPAYQVD--KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINN 313
            K++ P + V+  +    RF  E+++  +   W   G+ +  +     + +G    L ++N
Sbjct: 5736 KLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHN 5795

Query: 314  CQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVK 373
            C++         A + K S  L V+   I + + L+D T   GE    +CE+S +D  V+
Sbjct: 5796 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 5855

Query: 374  WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL 433
            W+  G+++ P  K     R EGK H L +      DA E  +     ++ A L V   P+
Sbjct: 5856 WYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPV 5913

Query: 434  KILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
            +   PL DQTV  G    L+CE+S EN   KW KNG  + +S + ++V  GR+ KLVI +
Sbjct: 5914 EFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 5973

Query: 493  ALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
               ED   Y    DA +      ++V+ P    L  L     + V      R E  +S E
Sbjct: 5974 CTPEDIKTYTC--DAKDFKTSCNLNVVPPHVEFLRPL---TDLQVREKEMARFECELSRE 6028

Query: 553  PPPKAMWSRGDKAIMEG 569
               K  W +    I +G
Sbjct: 6029 -NAKVKWFKDGAEIKKG 6044



 Score =  119 bits (298), Expect = 2e-26
 Identities = 113/439 (25%), Positives = 181/439 (41%), Gaps = 46/439 (10%)

Query: 596   VYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF 655
             V  INL      +  S  V  +D  DPP  P V  +  +   + W  P YDGG  + GY 
Sbjct: 13878 VMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYI 13937

Query: 656   IERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVP 714
             +E++   S  WM+ N     E  F    ++EG  YE RI A N  G IS PS  +   + 
Sbjct: 13938 VEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIIC 13997

Query: 715   LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDK 774
                   PT++   ++ D  +T++      + A  + G  L         W  A KD+   
Sbjct: 13998 KDEYEAPTIVLDPTIKD-GLTIKAGDTIVLNAISILGKPLP-----KSSWSKAGKDIRPS 14051

Query: 775   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 834
                 IT  PT + + ++      AG       + P   K            H+K T +  
Sbjct: 14052 DITQITSTPTSSMLTIKYATRKDAG-EYTITATNPFGTK----------VEHVKVTVLDV 14100

Query: 835   VGEAVNLVIPFQGKPRPELTWK---KDGAEIDKNQINIRNSETDTIIFIRKAERSHS--- 888
              G    + I      +  LTW    +DG    K+ I +   ET  +++   +E   S   
Sbjct: 14101 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYI-LEKRETSRLLWTVVSEDIQSCRH 14159

Query: 889   --------GKYDLQVKV----DKFVETASIDIQIIDR---PGPPQIVKIEDVWGENVALT 933
                      +Y  +V       K     S  ++++DR   PGPP+  ++ +V      ++
Sbjct: 14160 VATKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVS 14219

Query: 934   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIE-HYHRTSATITELVIGNEYYFRVFSENM 992
             W  P DDG + ITGY +++ +KKS+ W   I+         +T L  G+ Y FRV +EN 
Sbjct: 14220 WKRPVDDGGSEITGYHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENR 14279

Query: 993   CGL-----SEDATMTKESA 1006
              G+     + D+ + K++A
Sbjct: 14280 AGIGPPSEASDSVLMKDAA 14298



 Score =  116 bits (291), Expect = 1e-25
 Identities = 187/859 (21%), Positives = 324/859 (37%), Gaps = 143/859 (16%)

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDANVKWFKNGEEI 381
             +TA DE       V  P I +  + +DT   + GE  +++ ++  +    ++W K  +E+
Sbjct: 16160 ITARDE-------VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 16212

Query: 382   IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
                  +R  I+       L ++ A + D+  Y +          ++V++K L    P   
Sbjct: 16213 --SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 16270

Query: 442   QTVNLGKEICLKCEISENIPGKWTKNGLPVQE--SDRLKVVHKGR-----IHKLVIANAL 494
               V  G     KC ++      W     P+Q+  SD +  + + R     +  +V AN  
Sbjct: 16271 PVVISGVT-AEKCTLA------WKP---PLQDGGSDIINYIVERRETSRLVWTVVDANVQ 16320

Query: 495   TED-------EG-DYVF---APDAYNVTLPAKVH--VIDPPKIILDGLDADNTVTVIAGN 541
             T         EG +Y F   A + Y V  P +    V   P ++ D   A    TV   +
Sbjct: 16321 TLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDS 16380

Query: 542   KLRL-EIPISG------------EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDI 588
              + + E P S                    W+R  K ++ G  R+R          V  +
Sbjct: 16381 MIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLI-GELRLR----------VTGL 16429

Query: 589   AERDDSGVYHINLKNEAGEAHAS---IKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEP 642
              E  D   + ++ +N AG +  S      K  D    P PP  P V ++      ++W  
Sbjct: 16430 IENHDYE-FRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSK 16488

Query: 643   PAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIG 701
             P YDGG  I GY +E+       W          +T  E +K++E   Y  RI A+N  G
Sbjct: 16489 PIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAG 16548

Query: 702   ISKPSMPSRPFVPLAVTSPPTL-----------LTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + + +    P +       P +           +         V ++ RP   +    +D
Sbjct: 16549 VGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVD 16608

Query: 751   GYVLEYCF----EGTEDWIVANKDLIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPK 804
             G + +             ++ N +  D  K+T+T          FV V+ ++    S P 
Sbjct: 16609 GEIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRVLDTP--SPPV 16666

Query: 805   YYSQPILVKEII----EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 860
                   + K+ +    EPP +     +K   + +                 E T K   A
Sbjct: 16667 NLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK----------------REATRKSYAA 16710

Query: 861   EID---KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 917
              +    KN   I   +     + R    +  G       +    +TA   I++ + P PP
Sbjct: 16711 VVTNCHKNSWKIDQLQEGCSYYFRVTAENEYG-------IGLPAQTAD-PIKVAEVPQPP 16762

Query: 918   QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 977
               + ++DV   +V+L+WT P+ DG + I  Y ++   K S +W +         A IT L
Sbjct: 16763 GKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW-SECARVKSLQAVITNL 16821

Query: 978   VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1037
               G EY FRV + N  G S+  ++     ++A+D  I  +               +P  +
Sbjct: 16822 TQGEEYLFRVVAVNEKGRSDPRSLAVP--IVAKDLVIEPD--------------VKPAFS 16865

Query: 1038  TYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG 1096
             +Y++  G +  +   + G PKP ITW K+ + +    R  +  +  + TL I++    DG
Sbjct: 16866 SYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDG 16925

Query: 1097  GTYCCKAVNDLG--TVEIE 1113
             G Y     N +G  T  IE
Sbjct: 16926 GQYGITVANVVGQKTASIE 16944



 Score =  115 bits (287), Expect = 3e-25
 Identities = 101/370 (27%), Positives = 158/370 (42%), Gaps = 34/370 (9%)

Query: 266  KGGRVRFVVELAD-----------------PKLEVKWYKNGQEIRPSTKYIFEHKGCQRI 308
            +G  V FV EL D                   +E KWY N  E++ + KY    +  ++ 
Sbjct: 2217 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2276

Query: 309  LFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            L + +    D  EY      +K + +L ++  PI + + L D     G+ V+LE +VS +
Sbjct: 2277 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE 2336

Query: 369  DANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
                 W K+G+E+   P  R  I ++ + H+L+IE  TK DA  YS        S    V
Sbjct: 2337 SVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV 2394

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIH 486
             +  + ++TPL D  V  G +  L+C++S  +    KW  N   ++  DR++ + KG   
Sbjct: 2395 SVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ 2454

Query: 487  KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLE 546
            +LVI      DEG Y              V  I     I+ GL  D T T        +E
Sbjct: 2455 RLVINRTHASDEGPYKLIVGRVETNCNLSVEKIK----IIRGL-RDLTCTETQNVVFEVE 2509

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            +  SG      +W+  DK I + S + + E++     L +    +DD G Y       AG
Sbjct: 2510 LSHSG---IDVLWNFKDKEI-KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAG 2561

Query: 607  EAHASIKVKV 616
            E   S K+ V
Sbjct: 2562 ENMTSGKLTV 2571



 Score =  115 bits (287), Expect = 3e-25
 Identities = 182/792 (22%), Positives = 302/792 (38%), Gaps = 105/792 (13%)

Query: 373   KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKP 432
             KW  +G EI       Y +  +    +L I+   + D  EY +  +    S  ++V L  
Sbjct: 11171 KWTTDGSEI--KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11228

Query: 433   LKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESDRLK----VVHKGRI 485
             L +  P T     L    + + +  +  ++  G    N + V++ D  K    VV  G  
Sbjct: 11229 LDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYI-VEKQDTRKDTWGVVSSGSS 11287

Query: 486   H-KLVIANALTEDEGDYVFAPDAYNV---------TLPAKVHVIDPPKIILDGLDADNTV 535
               KL I +   +   +YVF   A N          T     H   PP            V
Sbjct: 11288 KTKLKIPHL--QKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP-----PGKPVV 11340

Query: 536   TVIAGNKLRLE--IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERD- 592
             T I  N   +   +P S    P   +    + +     R+      D    V  + E + 
Sbjct: 11341 TDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNT 11400

Query: 593   -DSGVYHINLKNEAGEAHASIKVKV---VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
              +  V+  NL   +  + +S  +K    +  P PP+ P + +   +   + W  P  DGG
Sbjct: 11401 YEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGG 11460

Query: 649   SPILGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM 707
             SPILGY +E +K  +++W R+N D L ++  F    +IEG  Y  RI A N +G  +P  
Sbjct: 11461 SPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRE 11520

Query: 708   PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVA 767
              +   +   +  PP +  +D      +T+R      I  A + G       E    W   
Sbjct: 11521 LAESVIAKDILHPPEV-ELDVTCRDVITVRVGQTIRI-LARVKGRP-----EPDITWTKE 11573

Query: 768   NKDLI-DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKY---------YSQPILVKEIIE 817
              K L+ +K    I  LP      V ++   A  A   KY         ++Q   +  +++
Sbjct: 11574 GKVLVREKRVDLIQDLPR-----VELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLD 11628

Query: 818   PPKIRIPRHLKQTYIRRVG--------------EAVNLVIPFQGKPRPELTWKKDGAEID 863
              P     ++LK T + +                E  N ++ ++ KP  +  W    +++ 
Sbjct: 11629 RPGPC--QNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR-KPNQK-GWSIVASDVT 11684

Query: 864   KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--IDIQIIDRPGPPQIVK 921
             K  I       +   F   AE         +V V   +ET +  + I  IDRPG P+ + 
Sbjct: 11685 KRLIKANLLANNEYYFRVCAEN--------KVGVGPTIETKTPILAINPIDRPGEPENLH 11736

Query: 922   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 981
             I D     V L W  P  DG +    Y +++  K S +W  V +   + +  + +  + N
Sbjct: 11737 IADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVEN 11796

Query: 982   EYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYA 1040
             + Y FRV ++N  G S+   +  E  V+  D               + P+    L     
Sbjct: 11797 QIYEFRVQTKNEGGESD--WVKTEEVVVKED--------------LQKPVLDLKLSGVLT 11840

Query: 1041  I-AGYNATLNCSVRGNPKPKITWMKNKVA--IVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1097
             + AG    L   VRG P P++ W K+K A  +   PR ++ +        + K    DGG
Sbjct: 11841 VKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGG 11900

Query: 1098  TYCCKAVNDLGT 1109
              Y   A N  G+
Sbjct: 11901 KYVVTATNTAGS 11912



 Score =  112 bits (280), Expect = 2e-24
 Identities = 102/419 (24%), Positives = 166/419 (39%), Gaps = 35/419 (8%)

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFT 778
             SP   L  D +   +V + WRPP   G A + GY+LE        W   +   +  T   
Sbjct: 23858 SPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSR-VRGTSLV 23916

Query: 779   ITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEA 838
             + GL  + +   RV A N  G S+P    +P+  K  + PP+   P       +     +
Sbjct: 23917 VKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPE---PPSNPPEVLDVTKSS 23973

Query: 839   VNLVIPFQGKPRPELTWKKDGAEIDKNQIN----IRNSETD-TIIFIRKAERSHSGKYDL 893
             V+L      +P+ +   +  G  I++ + +    +R+++T  T             +Y  
Sbjct: 23974 VSLS---WSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQF 24030

Query: 894   QVKVDKFV---ETASIDIQII-----DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 945
             ++     V   ET+     ++     D+P  P  ++I  +  ++V L W  P+ DG   I
Sbjct: 24031 RIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEI 24090

Query: 946   TGYTIQKADKKSMEWF-TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKE 1004
              GY ++        W  +  E       TI  L+   EY FRVF+EN  GLS        
Sbjct: 24091 LGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMS 24150

Query: 1005  SAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK 1064
                    G              EAP   + + +     G  A L+C + G P P I W +
Sbjct: 24151 IKTKLTSG--------------EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYR 24196

Query: 1065  NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
                 ++   +Y+M S+    TL +      D G Y C A N++G VE   KL ++   Q
Sbjct: 24197 FGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQ 24255



 Score =  111 bits (277), Expect = 4e-24
 Identities = 171/794 (21%), Positives = 305/794 (38%), Gaps = 96/794 (12%)

Query: 356   GERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHI--LIIEGATKADAAE 412
             G  V+L   +S   A  ++W+K+ +E+    ++   + VE    +  ++I+ A + ++  
Sbjct: 20515 GTSVKLRAGISGKPAPTIEWYKDDKEL----QTNALVCVENTTDLASILIKDADRLNSGC 20570

Query: 413   YSVMTTGGQSSAKLSVDL----KPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
             Y +       SA  ++ +    KP     P+  +TV   K   L    +++   K T   
Sbjct: 20571 YELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYI 20630

Query: 469   LPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH-VIDPPK 523
             +  +E+ R+   +    + + +I         +Y+F   A + Y +  P +   V+    
Sbjct: 20631 VEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNA 20690

Query: 524   IILDGLDADNTVTVIAGNKLRL----EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
              +  G      VT I  N + +     I   G         + DK  + G  ++  E+  
Sbjct: 20691 FVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSL-GWFKVLKETIR 20749

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGE---AHASIKVKVVDFPDPPVAPTVTEVGDDW- 635
             D+   V  + E  D   Y +   N AG+   +  S   K  D  DPP  P    + D   
Sbjct: 20750 DTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 20808

Query: 636   --CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETTFEPKKMIEGVAYEV 692
                 + W  P YDGGS + GY +E ++ +   W  ++     + T +    +  GV Y  
Sbjct: 20809 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 20868

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R+ AVN  G  +P   + P     +   P +       D  V +R      I  AG D  
Sbjct: 20869 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEI-------DLDVALR---TSVIAKAGEDVQ 20918

Query: 753   VLEYCFEG----TEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN-----------A 797
             VL   F+G    T  W    K+L    +++I    TD+   + +  V             
Sbjct: 20919 VL-IPFKGRPPPTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQVTRNDTGKYILTIE 20975

Query: 798   AGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTYIRRVGE---------AVNLVIPF 845
              G  EPK  S  + VK +  P    K+++ +H+ +  +  + +          +N VI  
Sbjct: 20976 NGVGEPK--SSTVSVKVLDTPAACQKLQV-KHVSRGTVTLLWDPPLIDGGSPIINYVI-- 21030

Query: 846   QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 905
             + +   + TW     +       + +    T  F R    +  G       + +  ET  
Sbjct: 21031 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIG-------IGEPCETTE 21083

Query: 906   IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 965
               ++  + P P + + ++D    +V L+WT P  DG + IT Y +++  K    W +   
Sbjct: 21084 -PVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTW-SHAG 21141

Query: 966   HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDF 1025
                     +++L   +   FRVF++N  GLS+  T+          G I    V E    
Sbjct: 21142 ISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI----------GPI---TVKELIIT 21188

Query: 1026  SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCT 1085
              E  +   P        G+N  L    +G PKP I+W+K+ + + +    R    +   T
Sbjct: 21189 PEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKIT 21248

Query: 1086  LEIRKPSPYDGGTY 1099
             L I+      GG Y
Sbjct: 21249 LSIKNAKKEHGGKY 21262



 Score =  110 bits (276), Expect = 6e-24
 Identities = 178/826 (21%), Positives = 314/826 (38%), Gaps = 118/826 (14%)

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
             T   G  + L+  V  + +  + W K  +E+    K    ++  GK+   +I+   ++D+
Sbjct: 22686 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK--VSLQYTGKRATAVIKFCDRSDS 22743

Query: 411   AEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIP-----GKWT 465
              +Y++       +  +SV +K L    P    TV+   +   KC ++ ++P      + T
Sbjct: 22744 GKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQE--KCTLAWSLPQEDGGAEIT 22801

Query: 466   KNGLPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH---- 517
                +  +E+ RL  V+ +G    L           +Y+F   A + Y   +P +      
Sbjct: 22802 HYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA 22861

Query: 518   ----VIDPPKIILDGLDADNTVTVI--------AGNKLRLEIPISGEPPPKAMWSRGDKA 565
                  I  P  I + +       +I         GN++   + +         W+R +K 
Sbjct: 22862 RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYL-VDKREKKSLRWTRVNKD 22920

Query: 566   IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF-PDPPV 624
              +    R++  S  +       +   + +G       +E  EA   I  +   + P PP 
Sbjct: 22921 YVVYDTRLKVTSLMEGCDYQFRVTAVNAAG------NSEPSEASNFISCREPSYTPGPPS 22974

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC-KETTFEPKK 683
             AP V +       + W  P YDGG+ I+GY +E ++K + +W R++ +   + T F    
Sbjct: 22975 APRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPD 23034

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTT---------- 733
             +  G  Y  R+ AVN  G+S+ S       P+     P L   D +  T           
Sbjct: 23035 LKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRL 23094

Query: 734   -VTMRWRPPDHI--GAAGLDGYVLEYCFEGTEDW---IVANKDLIDKTKFTITGLPTDAK 787
              V++  RPP  I     G+D        + TE +   IV   +  D  K+TI        
Sbjct: 23095 MVSVSGRPPPVITWSKQGID-LASRAIIDTTESYSLLIVDKVNRYDAGKYTI-------- 23145

Query: 788   IFVRVKAVNAAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTY-----IRRV--GE 837
                  +A N +G       S  +LVK    P   P +++    + +      I  +  G 
Sbjct: 23146 -----EAENQSGKK-----SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23195

Query: 838   AVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKV 897
              VN  I  + +      +K    +  K    I      T+ + R    +  G       +
Sbjct: 23196 PVNNYI-VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYG-------I 23247

Query: 898   DKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKS 957
              +  ET+   + + + P  P  +++ DV    V L W  P  DG + +TGY ++     +
Sbjct: 23248 GEPCETSDA-VLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGT 23306

Query: 958   MEWF-------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIAR 1010
               W        TV+EH      T+T L  G +Y FR+ ++N  G+SE       +AV  +
Sbjct: 23307 ERWMKVVTLKPTVLEH------TVTSLNEGEQYLFRIRAQNEKGVSEPRETV--TAVTVQ 23358

Query: 1011  DGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
             D ++         D S     T P    +  AG    L   + G P P  +W      + 
Sbjct: 23359 DLRVLPT-----IDLS-----TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR 23408

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
             +  R  + ++  V  L IR+ +  D G Y  +  N  GT     K+
Sbjct: 23409 ESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKV 23454



 Score =  110 bits (275), Expect = 7e-24
 Identities = 93/366 (25%), Positives = 162/366 (44%), Gaps = 18/366 (4%)

Query: 269  RVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGD 328
            R  F  E+++P + V+W K+ QE++ + +   + +     L I + +M+D  +Y V AG 
Sbjct: 3028 RAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG 3087

Query: 329  EKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               + +LFV    + +    ++      +R  +E EV+EDD +  W+K+G EI    + R
Sbjct: 3088 NVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER 3147

Query: 389  YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL-KPLKILTPLTDQTVNLG 447
            ++  VE + H + I    ++DA EY+ +    +SS  L V+  +P ++L  L   TV  G
Sbjct: 3148 HKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSG 3207

Query: 448  KEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF-A 504
            K       IS     K  W K    +    + K +H G+ + L++  A  ED   Y   A
Sbjct: 3208 KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEA 3267

Query: 505  PDAYNVTLPAKVHVIDPPKIILDGLD-----------ADNTVTVIAGNKLRLEIPISGEP 553
             + Y V   +    ++ P+++    +             +TVT   G   R +  +SG  
Sbjct: 3268 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVT-SEGQPARFQCRVSG-T 3325

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
              K  W   DK I + S   R   + D+  L I  A  +D G Y     N  G+  ++  
Sbjct: 3326 DLKVSWYSKDKKI-KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3384

Query: 614  VKVVDF 619
            + +  F
Sbjct: 3385 LSLEGF 3390



 Score =  110 bits (275), Expect = 7e-24
 Identities = 108/438 (24%), Positives = 170/438 (38%), Gaps = 62/438 (14%)

Query: 702   ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT 761
             + KP +P+ P            +  D VT   +T++W PP   G + +  Y+LE      
Sbjct: 13701 VGKPGIPTGP------------IKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVN 13748

Query: 762   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-----SEPKYYSQPILVKEII 816
               W+      + KT F +T L    +   RV A N  G      SEP     P  V +  
Sbjct: 13749 NKWVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVPDAP 13807

Query: 817   EPPKIRIPRH----LKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
              PP I   RH    L  T  ++ G +       + K R  L WK+     +K  I +R+ 
Sbjct: 13808 PPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKR----ANKTPIRMRDF 13863

Query: 873   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------IDIQIIDRPGPPQIVKIED 924
             +   +        +   +Y+ +V                  + +  ID PG P+++ I  
Sbjct: 13864 KVTGL--------TEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITR 13915

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE-HYHRTSATITELVIGNEY 983
                 +V L WT PK DG   +TGY ++K D  S  W      +    + T+T+LV G +Y
Sbjct: 13916 ---NSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKY 13972

Query: 984   YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-- 1041
              FR+ ++N  G     + + E+ +I +D            ++    +   P +       
Sbjct: 13973 EFRIRAKNTAGAISAPSESTET-IICKD------------EYEAPTIVLDPTIKDGLTIK 14019

Query: 1042  AGYNATLNC-SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
             AG    LN  S+ G P PK +W K    I      ++ S      L I+  +  D G Y 
Sbjct: 14020 AGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYT 14079

Query: 1101  CKAVNDLGTVEIECKLEV 1118
               A N  GT     K+ V
Sbjct: 14080 ITATNPFGTKVEHVKVTV 14097



 Score =  109 bits (273), Expect = 1e-23
 Identities = 118/440 (26%), Positives = 185/440 (42%), Gaps = 69/440 (15%)

Query: 597   YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
             Y +N    +  + AS  +   +  D P  P VT+V      + W  PAYDGGS ++GY I
Sbjct: 22544 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYII 22603

Query: 657   ERK---KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPF 712
             ERK   +    RW++ N+ +  +  F    + EG  YE R+ A NA G ISK S  + P 
Sbjct: 22604 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 22663

Query: 713   VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTED----WIVAN 768
                   +PP       +    VT+R         AG D  VL+    G  +    W   +
Sbjct: 22664 TCRDEYAPPKAELDARLHGDLVTIR---------AGSD-LVLDAAVGGKPEPKIIWTKGD 22713

Query: 769   K--DLIDKTKFTITGLPTDAKIFVRVKA------VNAAGASEPKYYSQPILVKEIIEPPK 820
             K  DL +K     TG    A I    ++      +    AS  K  S  ++VK +  P  
Sbjct: 22714 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVS--VMVKVLDSP-- 22769

Query: 821   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW----KKDGAEI--------DKNQIN 868
                            G    L +    + +  L W    +  GAEI        + +++N
Sbjct: 22770 ---------------GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLN 22814

Query: 869   --IRNSETDTIIFIRKAERSHSGKYDLQVK-VDKFVETASIDIQ-IIDR-----PGPPQI 919
               I   E  T+ ++       + +Y  +V+ V+K+     ++ + I+ R     P PP I
Sbjct: 22815 WVIVEGECPTLSYV-VTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARNSFTIPSPPGI 22873

Query: 920   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY--HRTSATITEL 977
              +      E++ + WT P+ DG   I+ Y + K +KKS+ W  V + Y  + T   +T L
Sbjct: 22874 PEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSL 22933

Query: 978   VIGNEYYFRVFSENMCGLSE 997
             + G +Y FRV + N  G SE
Sbjct: 22934 MEGCDYQFRVTAVNAAGNSE 22953



 Score =  107 bits (268), Expect = 5e-23
 Identities = 123/468 (26%), Positives = 198/468 (42%), Gaps = 56/468 (11%)

Query: 196  RREVKQQEEE---PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA 252
            R + K++ EE     +   EL    K   YE++  +        +L   K +  EEKK+ 
Sbjct: 1952 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRK----TKDELLHWTKELTEEEKKAL 2007

Query: 253  AF-AKILDPAYQVDK-----------------------GGRVRFVVELAD-PKLEVKWYK 287
            A   KI  P ++ DK                       G    F V +   P  E +WYK
Sbjct: 2008 AEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYK 2067

Query: 288  NGQEIRPSTK---YIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTELFVREP 340
            NG +I  S +   Y  E   C+  L I +    D +   V     AG+      L V+  
Sbjct: 2068 NGVKIERSDRIYWYWPEDNVCE--LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2125

Query: 341  PIMV-TKQLEDTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             ++  T++L+D  A   + +   ECE SE    VKW+K+G E+  G K  YR+  + K H
Sbjct: 2126 QLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK--YRMHSDRKVH 2183

Query: 399  ILIIEGATKADAAEYS---VMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
             L I     +DA +YS   V     +++AKL V+   ++ +  L D  V       L+C 
Sbjct: 2184 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S ENI GKW  N + ++ + +  +  +     L + +   ED+G+Y F  D    T   
Sbjct: 2244 VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT--C 2301

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR 574
            K+ +   P  IL GL       V  G+ ++LE+ +S E   + +W + D   ++ S R+ 
Sbjct: 2302 KLKMKPRPIAILQGLSDQK---VCEGDIVQLEVKVSLE-SVEGVWMK-DGQEVQPSDRVH 2356

Query: 575  TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                  S  L+I+   ++D+G Y   +          + V  VD   P
Sbjct: 2357 IVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITP 2404



 Score =  106 bits (265), Expect = 1e-22
 Identities = 127/538 (23%), Positives = 203/538 (37%), Gaps = 68/538 (12%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP  P V +       + W+PPA DGGSPI GY +E +++ ++ W R+N      TT 
Sbjct: 9333 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 9392

Query: 680  E--PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTV--- 734
            E     + E   Y  R+ AVN  G S+PS  +       +   P +       D  V   
Sbjct: 9393 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKA 9452

Query: 735  --------TMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDA 786
                     ++ RP     +   DG   +   +G  D I  +  L      ++  +P   
Sbjct: 9453 GSQIRIPAVIKGRPTPK-SSWEFDGKAKKAMKDGVHD-IPEDAQLETAENSSVIIIPECK 9510

Query: 787  KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP-- 844
            +      ++ A   +  K  +  + V ++  PPK      LK + I R    ++  +P  
Sbjct: 9511 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRLSWKMPDD 9565

Query: 845  ----------FQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR-KAERSHSGKYDL 893
                       + +      W K   +       + +  ++   F R +AE     ++ +
Sbjct: 9566 DGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAEN----RFGI 9621

Query: 894  QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ-- 951
               V+    T + D   I  P PP  +KI  +    V L+W PPK+DG + +T Y ++  
Sbjct: 9622 GPPVETIQRTTARDP--IYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECL 9679

Query: 952  ---KADKKSMEWFTVIEH-YHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAV 1007
                   K   W    +        T+ +LV G EY FRV + N  G+S+ +        
Sbjct: 9680 AWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDC 9739

Query: 1008 IARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK--- 1064
               D      P  +  +F E               G N  +   ++G P P +TW K   
Sbjct: 9740 QRPD----MPPSIDLKEFMEVE------------EGTNVNIVAKIKGVPFPTLTWFKAPP 9783

Query: 1065 ----NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                NK  ++ D           CTL I +    D G Y   AVN+LGT   E +L V
Sbjct: 9784 KKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 9841



 Score =  105 bits (263), Expect = 2e-22
 Identities = 101/375 (26%), Positives = 158/375 (42%), Gaps = 21/375 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +G  V+  V+++   +E  W K+GQE++PS +          +L I +    D   Y
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDD-ANVKWFKNGEEI 381
              T      ST   V    + V   L+D     G +  LEC+VS  D  +VKW+ N E+I
Sbjct: 2380 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2439

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
               P  R +  V+G K  L+I     +D   Y ++    +++  LSV+   +KI+  L D
Sbjct: 2440 --KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRD 2495

Query: 442  QTVNLGKEICLKCEISEN-IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T    + +  + E+S + I   W      ++ S + K+   G+I+KL + N + +DEG 
Sbjct: 2496 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2555

Query: 501  YVF--APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAM 558
            Y F    +  +  L      I  P         D TV          E+     P  K  
Sbjct: 2556 YTFYAGENMTSGKLTVAGGAISKPL-------TDQTVAESQEAVFECEV---ANPDSKGE 2605

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            W R  K  +  +  IR+ES      L+I   + DD G Y    K    +  A +KV+ V 
Sbjct: 2606 WLRDGKH-LPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVK 2662

Query: 619  FPDPPVAPTVTEVGD 633
                    TVTE  D
Sbjct: 2663 IKKTLKNLTVTETQD 2677



 Score =  102 bits (255), Expect = 2e-21
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 15/389 (3%)

Query: 248  EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK-GCQ 306
            E+    F K L+    V KG  +    EL + + +V W K+G+ +      I     G  
Sbjct: 4836 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 4894

Query: 307  RILFINNCQMTDDSEYYVT---AGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELE 362
            R L IN+   TD   Y VT   A + +CS+ + V E     + K + D            
Sbjct: 4895 RALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFA 4954

Query: 363  CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQS 422
            C++++D  N+KWFK  +EI   P  +  I  +G    L I+ A   D AEY+V   G + 
Sbjct: 4955 CDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRY 5014

Query: 423  SAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVH 481
             AKL++  + +++L P+ D T+   +      EISE +IPG+W   G  ++ S   ++  
Sbjct: 5015 PAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKA 5074

Query: 482  KGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGN 541
            +G    L +     +  G+ ++   A N    A   ++   +I LD       VTV    
Sbjct: 5075 EGGKRFLTLHKVKLDQAGEVLY--QALNAITTA---ILTVKEIELDFAVPLKDVTVPERR 5129

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINL 601
            + R E  ++ E     +WS+G   I++ S +    +      LVI+ ++ DD GVY   +
Sbjct: 5130 QARFECVLTRE--ANVIWSKGPD-IIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEV 5186

Query: 602  KNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
            + +   A   +    + F  P    TV E
Sbjct: 5187 EGKKTSARLFVTGIRLKFMSPLEDQTVKE 5215



 Score =  102 bits (254), Expect = 2e-21
 Identities = 85/281 (30%), Positives = 121/281 (43%), Gaps = 16/281 (5%)

Query: 283  VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
            V W K    I+ S K+     G + IL IN+ Q  D+  Y      +K S  LFV    +
Sbjct: 5143 VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRL 5202

Query: 343  MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                 LED T   GE     CE+S +  +V WFKN  ++         I  EGK H L +
Sbjct: 5203 KFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL--HTSRTVLISSEGKTHKLEM 5260

Query: 403  EGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG 462
            +  T  D ++         S+A+L V          L D+T     EI LKCE+S+++P 
Sbjct: 5261 KEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPV 5320

Query: 463  KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV----FAPDAYNVTLPAKVHV 518
            KW K+G  +  S +  +   G    L I  A  +D+G+YV          NVT+ A++  
Sbjct: 5321 KWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIK 5380

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
            ++ P   L G      V V  G     EI +S EP     W
Sbjct: 5381 VEKP---LYG------VEVFVGETAHFEIELS-EPDVHGQW 5411



 Score =  102 bits (254), Expect = 2e-21
 Identities = 174/746 (23%), Positives = 285/746 (38%), Gaps = 121/746 (16%)

Query: 340   PPIMVTKQLEDTTAYCGERVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             P I++ +Q+   T   G+++ +E  V  +     KW K  +E++    S   +       
Sbjct: 12528 PKILMPEQI---TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTS--SHLAVHKADSSS 12582

Query: 399   ILIIEGATKADAAEYSVMT--TGGQSSAKLSV--------------------DLKPLKIL 436
             ILII+  T+ D+  YS+    + G  + K+ V                    D   L   
Sbjct: 12583 ILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWH 12642

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKW-TKNGLPVQESDRLKVVHKGRIH--------K 487
              PL D   N+   I  KC++S    G W T      + S R+  +  G+ +        +
Sbjct: 12643 IPLEDGGSNITNYIVEKCDVSR---GDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENR 12699

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL--DGLDADNTVTVIAGNKLRL 545
               I+  LT  +    F     +    A+V  ++   I +  D  D+D    +I       
Sbjct: 12700 FGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG------ 12753

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
                I  +     +W + +  +      +R+  YP +   +++  E      + I   N+A
Sbjct: 12754 -YLIERKERNSLLWVKANDTL------VRSTEYPCAG--LVEGLEYS----FRIYALNKA 12800

Query: 606   GEAHASIKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
             G +  S   + V      DPP  P V +V      + W  P +DGGS I+GYF+E  K  
Sbjct: 12801 GSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLP 12860

Query: 663   SSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
               +W+R N       +  +    + E   Y+ R  A  A+ IS PS PS P   LA   P
Sbjct: 12861 GDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVP 12920

Query: 721   P---------TLLTVDSVT----DTTV------TMRWRPPDHI--GAAGLDGYVLEYCFE 759
             P         +LLTV + T    D TV      T+ W+    +   A G+    ++    
Sbjct: 12921 PRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIK-MAMQRNLC 12979

Query: 760   GTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP----KYYSQPILVKEI 815
               E + V  KD  D T  T           +++K ++  G        K YS   ++   
Sbjct: 12980 TLELFSVNRKDSGDYT-ITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSW- 13037

Query: 816   IEPPKIRIPRHLKQTYIRRVG-EAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSET 874
              EPP            +   G E  N ++  +   RP   W +  A +     ++     
Sbjct: 13038 -EPP------------LEDGGSEITNYIVDKRETSRPN--WAQVSATVPITSCSVEKLIE 13082

Query: 875   DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTW 934
                   R    +  G  D       F E A I     D PG      I ++  +++ ++W
Sbjct: 13083 GHEYQFRICAENKYGVGD-----PVFTEPA-IAKNPYDPPGRCDPPVISNITKDHMTVSW 13136

Query: 935   TPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI--TELVIGNEYYFRVFSENM 992
              PP DDG + ITGY ++K + +++ W T +        T+  T L  G EY FRV + N 
Sbjct: 13137 KPPADDGGSPITGYLLEKRETQAVNW-TKVNRKPIIERTLKATGLQEGTEYEFRVTAINK 13195

Query: 993   CGLSEDATMTKESAVIARDGKIYKNP 1018
              G  + +  +K  A  ARD +    P
Sbjct: 13196 AGPGKPSDASK--AAYARDPQYPPGP 13219



 Score =  101 bits (251), Expect = 5e-21
 Identities = 123/553 (22%), Positives = 204/553 (36%), Gaps = 63/553 (11%)

Query: 597   YHINLKNEAGEAHASIKVKVV---DFPDPPVAPTVTEVGDDW---CIMNWEPPAYDGGSP 650
             + +  +NE G    S+  + V   D  +PP  PT   V D       + W  P YDGG+P
Sbjct: 12096 FRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 12155

Query: 651   ILGYFIERKKKQSSR-----WMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             I+GY +E + K +       W R N         F    + E   YE R+ A N +GI +
Sbjct: 12156 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 12215

Query: 705   PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVT-----------MRWRPPDHIG--AAGLDG 751
             P+       P  +  PP +    S+    +            +R RP   +     G+D 
Sbjct: 12216 PAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDN 12275

Query: 752   YVLEYCFEGTEDW---IVANKDLIDKTKFTITGL-PTDAK-IFVRVKAVNAAGASEPKYY 806
              V +   +  +     ++ N    D  K+++T + P   K +FV V+ ++  G       
Sbjct: 12276 VVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPG------- 12328

Query: 807   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ 866
               P+   ++ +  K     H+        G +       + +     TW     E+ K  
Sbjct: 12329 --PVSDLKVSDVTKTSC--HVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTS 12384

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
              ++ N       + R    +  G       V   V    +    +  P PP+ +++ ++ 
Sbjct: 12385 FHVTNLVPGNEYYFRVTAVNEYGP-----GVPTDVPKPVLASDPLSEPDPPRKLEVTEMT 12439

Query: 927   GENVALTWTPPKDDGNAAITGY-TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYF 985
               +  L W PP  DG A I GY T  + +++  + +T        S  +T L  G +Y F
Sbjct: 12440 KNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKF 12499

Query: 986   RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1045
             RV + N  G+S           + R+ +     VYE  +    P    P   T   AG  
Sbjct: 12500 RVAARNAVGVS-----------LPREAE----GVYEAKEQLLPPKILMPEQITIK-AGKK 12543

Query: 1046  ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVN 1105
               +   V G P P   W K +  +V      +        L I+  +  D G Y   A N
Sbjct: 12544 LRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAEN 12603

Query: 1106  DLGTVEIECKLEV 1118
               GT   + K+ V
Sbjct: 12604 SSGTDTQKIKVVV 12616



 Score =  100 bits (249), Expect = 8e-21
 Identities = 93/398 (23%), Positives = 157/398 (39%), Gaps = 40/398 (10%)

Query: 728   SVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAK 787
             +VT   +T+ WRPP   G A +  Y++E        W + ++ L ++   T T +    +
Sbjct: 20605 TVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHL-EECIITTTKIIKGNE 20663

Query: 788   IFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT-------YIRRVGEAVN 840
                RV+AVN  G  EP      +     + P    IP   K T       + R + +  +
Sbjct: 20664 YIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKITKNSMTVVWSRPIADGGS 20723

Query: 841   LVIPF--QGKPRPELTW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 895
              +  +  + + +  L W    K+     + ++      +D    +     +  G +    
Sbjct: 20724 DISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRVCAVNAAGQGPFS--- 20780

Query: 896   KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
             +  +F + A      ID PGPP  ++I D    ++ L W+ P  DG +A+TGY ++    
Sbjct: 20781 EPSEFYKAADP----IDPPGPPAKIRIADSTKSSITLGWSKPVYDGGSAVTGYVVEIRQG 20836

Query: 956   KSMEWFTVIE--HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1013
             +  EW TV        T   ++ L  G  YYFRV + N  G  E   M            
Sbjct: 20837 EEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEM------------ 20884

Query: 1014  IYKNPVYEDFDFSEAPMFTQPLV---NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
                N   +  D  EAP     +    +  A AG +  +    +G P P +TW K++  + 
Sbjct: 20885 ---NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLG 20941

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              D RY + +      L I + +  D G Y     N +G
Sbjct: 20942 SDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVG 20979



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 93/361 (25%), Positives = 149/361 (41%), Gaps = 12/361 (3%)

Query: 271  RFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            +F  E++      +W K  QEI    ++     G +  + I +    D+++Y   A D+ 
Sbjct: 5486 KFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH 5545

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S +L +    +     L+D TA   E      E+S D+  VKWFKN + +         
Sbjct: 5546 TSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL--HTTRSVS 5603

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            ++ EGK H +  +  +  D ++  V   G  S AKL+V          L D T     E+
Sbjct: 5604 MQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV 5663

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN 509
             L+CEIS+ + P KW K+G  ++ S    +   G+   L++  AL  D G Y    D   
Sbjct: 5664 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC--DCGT 5721

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS-RGDKAIME 568
                 K+ + D    ++  L   ++V V+     R E  IS E    A W  +G+  +  
Sbjct: 5722 DKTSGKLDIEDREIKLVRPL---HSVEVMETETARFETEIS-EDDIHANWKLKGEALLQT 5777

Query: 569  GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
                I+ E    S  LV+     D +G       N    AH  +K +V+    P    TV
Sbjct: 5778 PDCEIKEEGKIHS--LVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 5835

Query: 629  T 629
            T
Sbjct: 5836 T 5836



 Score = 95.5 bits (236), Expect = 2e-19
 Identities = 111/492 (22%), Positives = 196/492 (39%), Gaps = 52/492 (10%)

Query: 648   GSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             G P+    + R        MR N ++  E  T   K+ +   A    I A N+ G +K  
Sbjct: 20130 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 20189

Query: 707   MPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWI 765
             +     V L    PPT  + +  +T+ +VT++W PP + G + +  Y+L      T  W 
Sbjct: 20190 IN---IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWT 20246

Query: 766   VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK---EIIEPPKIR 822
               +   + +T   +  L T  +   R+KA N  G S+    S  + VK       PP   
Sbjct: 20247 EVSAT-VARTMMKVMKLTTGEEYQFRIKAENRFGISD-HIDSACVTVKLPYTTPGPPSTP 20304

Query: 823   IPRHLKQTYI-----RRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETD 875
                ++ +  I       V    + V+ +  + K R  + W+K       N++ IR +   
Sbjct: 20305 WVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK------ANKLVIRTTH-- 20356

Query: 876   TIIFIRKAERSHSGKYDLQVKVDKFVETA-----SIDIQIIDRPGPPQIVKIEDVWGENV 930
                  +    S    Y+ +V  +           S  +  ID   PP+ V+I D+   +V
Sbjct: 20357 ----FKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSV 20412

Query: 931   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFS 989
             +L+W  P  DG + ITGY +++ D     W      +   T   I+ L   ++Y FRVF+
Sbjct: 20413 SLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFA 20472

Query: 990   ENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI---AGYNA 1046
              N  G     +++  S V+         P+    D    P+   PL  T  +   AG + 
Sbjct: 20473 RNAVG-----SISNPSEVVG--------PI-TCIDSYGGPVIDLPLEYTEVVKYRAGTSV 20518

Query: 1047  TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1106
              L   + G P P I W K+   +  +    + +   + ++ I+     + G Y  K  N 
Sbjct: 20519 KLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNA 20578

Query: 1107  LGTVEIECKLEV 1118
             +G+     ++++
Sbjct: 20579 MGSASATIRVQI 20590



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 105/462 (22%), Positives = 179/462 (38%), Gaps = 52/462 (11%)

Query: 672   DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTD 731
             D C+E        +   A E  I  +N I + KP  P+ P            + +D VT 
Sbjct: 15837 DACREDVGHYVVKLTNSAGEA-IETLNVIVLDKPGPPTGP------------VKMDEVTA 15883

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVR 791
              ++T+ W PP + G + ++ Y++E     T  W + +   + +T      L T  +   R
Sbjct: 15884 DSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSAT-VARTTIKACRLKTGCEYQFR 15942

Query: 792   VKAVNAAGAS-----EPKYYSQPILVKEIIEPPKIRIPRH--LKQTYIRRVGEAVNLVIP 844
             + A N  G S     EP     P  V      P + +     ++  +   + +  + VI 
Sbjct: 15943 IAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIG 16002

Query: 845   F--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 902
             +  + K R  + W K    ++K  I     +T  +    + E   S +  + +     V 
Sbjct: 16003 YHLERKERNSILWVK----LNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVGIGKPSKVS 16058

Query: 903   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 962
                +     D PG P+ + +      +V L W  P  DG + ITGY ++K +     W  
Sbjct: 16059 ECYVARDPCDPPGRPEAIIVTR---NSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMK 16115

Query: 963   V-IEHYHRTSATITELVIGNEYYFRVFSENMCGL-SEDATMTKESAVIARDG----KIYK 1016
                 +   T   +T LV  + Y FRV + N  G+ SE +  T   A+ ARD     +I  
Sbjct: 16116 ASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSEST--GAITARDEVDPPRISM 16173

Query: 1017  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1076
             +P Y+D                   AG +  ++  + G P P I W+K    + +  R  
Sbjct: 16174 DPKYKD--------------TIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLE 16219

Query: 1077  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             + S     +L ++     D G Y  KA N  G   +   ++V
Sbjct: 16220 IKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 16261



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 147/655 (22%), Positives = 260/655 (39%), Gaps = 108/655 (16%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E+ SK  E   +  K      T   E +A +  +S+  I  +   Q  TV       F  
Sbjct: 26444 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVI--VTGLQDTTVSSDSVAKFAV 26501

Query: 80    KVKAEDLLRKPTIKWFK--------GKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
             K   E    +PT  W K        GK+     K G  L++ +T    S +YT  ++   
Sbjct: 26502 KATGEP---RPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVK--- 26555

Query: 132   AKDNFAGNYR--CEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELD 189
                N AG+    C++T K   D+ +  +   +++  TP        K++   +E + +  
Sbjct: 26556 ---NSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQ-------KKAVVQEEISQKAL 26605

Query: 190   FSGLLKRREVKQQE------EEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKR 243
              S  +K  E K QE      E  +V + E +K +  +  EK      IT           
Sbjct: 26606 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTS-------- 26657

Query: 244   MRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
                EE ++ A  K       +++G R+     +A    +VKW  NG E+  S +Y +   
Sbjct: 26658 QASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVS 26716

Query: 304   GCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYC---- 355
             G  + L I      D+      +    G  KC  +L        ++K+L D  A+     
Sbjct: 26717 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDL-------TLSKELSDAPAFISQPR 26769

Query: 356   ------GERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
                   G+ V   CE+S E    ++WFKN   I     S   I      + L I  A+ +
Sbjct: 26770 SQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI--SISSNVSISRSRNVYSLEIRNASVS 26827

Query: 409   DAAEYSVMTTG--GQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTK 466
             D+ +Y++      GQ SA  S+      ++ PL ++     +E+ L+     ++ G ++ 
Sbjct: 26828 DSGKYTIKAKNFRGQCSATASL------MVLPLVEEP---SREVVLRTSGDTSLQGSFSS 26878

Query: 467   NGLPVQESDR-----------LKVVHKGRIHKLVIANALTEDEGDYVFAPDAY----NVT 511
               + +  S +              + + +   +   +  +  E     +  ++    N+T
Sbjct: 26879 QSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT 26938

Query: 512   ---------LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
                      L A +  I PPKI  + L +D  +++  G  L +    +GEP P+  WS G
Sbjct: 26939 QLESSTSKMLKAGIRGI-PPKI--EALPSD--ISIDEGKVLTVACAFTGEPTPEVTWSCG 26993

Query: 563   DKAI-MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              + I  +  GR   E+  D +TL+I   ++ D G+Y ++L NE G   A++ + +
Sbjct: 26994 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27048



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 201/953 (21%), Positives = 329/953 (34%), Gaps = 190/953 (19%)

Query: 259   DPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMT 317
             D  Y   +    R  + +   P   V W K    +   T+   E       L + +CQ +
Sbjct: 13617 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 13676

Query: 318   DDSEYYVT----AGDEKCSTELFVREPPIMVTKQL--EDTTAYC------------GERV 359
             D  +Y +T    AG ++ +  + V   P + T  +  ++ TA              G  +
Sbjct: 13677 DAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEI 13736

Query: 360   ELECEVSEDDANVKWFKNGEEIIPGPKSRYRI-----------RVEGKKHILIIEGATKA 408
                     D  N KW      +    K+ +R+           RV  +    + EG    
Sbjct: 13737 TNYILEKRDSVNNKWVTCASAV---QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSE 13793

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC-LKCEISENIPGKWTK- 466
                                VD++   +    TD     G  I     E  E     W + 
Sbjct: 13794 PIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA 13853

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL 526
             N  P++  D  KV              LTE   +Y F   A N+    K  +   P + L
Sbjct: 13854 NKTPIRMRD-FKVT------------GLTEGL-EYEFRVMAINLAGVGKPSLPSEPVVAL 13899

Query: 527   DGLDAD----------NTVTVI-------AGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             D +D            N+VT+I        G+KL   I    + P K+ W + +      
Sbjct: 13900 DPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS-WMKANHV---- 13954

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYH--INLKNEAGEAHA-SIKVKVVDFPDPPVAP 626
                    + P+ +  V D+ E    G Y   I  KN AG   A S   + +   D   AP
Sbjct: 13955 -------NVPECAFTVTDLVE---GGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 14004

Query: 627   TVTEVGDDWCIMNWEPPAYDG-----GSPIL--GYFIERKKKQSSRWMRLNFDL----CK 675
             T+            +P   DG     G  I+     I  K    S W +   D+      
Sbjct: 14005 TIV----------LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDIT 14054

Query: 676   ETTFEPKKMIEGVAYEVR-------IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             + T  P   +  + Y  R       I A N  G     +       L V  PP  + + +
Sbjct: 14055 QITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPVEISN 14111

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKI 788
             V+    T+ W PP   G + +  Y+LE        W V ++D I   +   T L    + 
Sbjct: 14112 VSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLLWTVVSED-IQSCRHVATKLIQGNEY 14170

Query: 789   FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 848
               RV AVN  G  EP   S+P+ + +   PP                G      +    K
Sbjct: 14171 IFRVSAVNHYGKGEP-VQSEPVKMVDRFGPP----------------GPPEKPEVSNVTK 14213

Query: 849   PRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETA 904
                 ++WK+     G+EI    +  R  E  ++ ++R  +   S   DL+ KV    E +
Sbjct: 14214 NTATVSWKRPVDDGGSEITGYHVERR--EKKSLRWVRAIKTPVS---DLRCKVTGLQEGS 14268

Query: 905   SIDIQIIDR-----------------------PGPPQIVKIEDVWGENVALTWTPPKDDG 941
             + + ++                          PGPP    + D   ++ +L W  P  DG
Sbjct: 14269 TYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDG 14328

Query: 942   NAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN-----EYYFRVFSENMCGLS 996
                ITGY ++        W   I+    T+  IT+ V+ +     +Y FR+ + N  G+ 
Sbjct: 14329 GLEITGYVVEHQKVGDEAW---IKDTTGTALRITQFVVPDLQTKEKYNFRISAINDAGVG 14385

Query: 997   EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGN 1055
             E A +         D +I +  +  DF+          L  T  + AG +  +   ++G 
Sbjct: 14386 EPAVIP--------DVEIVEREMAPDFELDAE------LRRTLVVRAGLSIRIFVPIKGR 14431

Query: 1056  PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
             P P++TW K+ + + +  R  + + +    L I + + YD G +     N  G
Sbjct: 14432 PAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTGKFVMTIENPAG 14482



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 127/584 (21%), Positives = 221/584 (37%), Gaps = 94/584 (16%)

Query: 581   SSTLVIDIAERDDSGV--YHINLKNEAGEAH----ASIKVKV------VDFPDPPVAPTV 628
             S T  I++++  +  V  + +  KNE G +       I VK       VD  D P A   
Sbjct: 21143 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVT 21202

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEG 687
               +G +   ++ E P      P + +  +    + S ++R +    K T + +  K   G
Sbjct: 21203 VRIGHN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHG 21259

Query: 688   VAYEVRI--------FAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
               Y V +          +  I +  PS P  P            +  D +   +V + W 
Sbjct: 21260 GKYTVILDNAVCRIAVPITVITLGPPSKPKGP------------IRFDEIKADSVILSWD 21307

Query: 740   PPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 799
              P+  G   +  Y +E       +W +     + +T F +  L  DA+   RV+A N  G
Sbjct: 21308 VPEDNGGGEITCYSIEKRETSQTNWKMVCSS-VARTTFKVPNLVKDAEYQFRVRAENRYG 21366

Query: 800   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD- 858
              S      QP++   I+   + RIP           G+ V   +   G     LTW    
Sbjct: 21367 VS------QPLVSSIIVAKHQFRIPGP--------PGKPVIYNVTSDGM---SLTWDAPV 21409

Query: 859   ---GAEIDKNQINIRNSETDTIIFIRKAERSHSGK------------YDLQVKVDKFVET 903
                G+E+     ++   E ++I++ +      SG+            Y  +V  +     
Sbjct: 21410 YDGGSEV--TGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQFRVYAENSAGL 21467

Query: 904   AS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
             +S        + +  +D PG P  +   DV  E + L W PP  DG + I GY+I+K   
Sbjct: 21468 SSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPPLRDGGSKIVGYSIEKRQG 21524

Query: 956   KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1015
                              T+T L  G+ Y FR+ + N  G     + +    ++ RD  + 
Sbjct: 21525 NERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSS-GIIMTRDENV- 21582

Query: 1016  KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1075
               P   +F     P +   L+     +G +  +   V+G P P++TW K+ V I      
Sbjct: 21583 --PPIVEF----GPEYFDGLIIK---SGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNM 21633

Query: 1076  RMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              +    G  +L +R  +    G Y  +A N  G+ + E K++V+
Sbjct: 21634 EITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21677



 Score = 92.8 bits (229), Expect = 2e-18
 Identities = 113/454 (24%), Positives = 172/454 (37%), Gaps = 74/454 (16%)

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R  AVN   + KP  P+ P            L ++ +T    ++ W  P   G A +D Y
Sbjct: 19499 RSVAVNCKVLDKPGPPAGP------------LEINGLTAEKCSLSWGRPQEDGGADIDYY 19546

Query: 753   VLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 812
             ++E        W +   +L   T   +T L    +   RV  VN  G  EP    + + +
Sbjct: 19547 IVEKRETSHLAWTICEGEL-QMTSCKVTKLLKGNEYIFRVTGVNKYGVGEPL---ESVAI 19602

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 872
             K +        P  L+ T + +  E++ L        RPE      G+EI    I  R  
Sbjct: 19603 KALDPFTVPSPPTSLEITSVTK--ESMTLCWS-----RPE---SDGGSEISGYIIERR-- 19650

Query: 873   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI---------------------- 910
             E +++ ++R  ++     YDL+VK     E    + ++                      
Sbjct: 19651 EKNSLRWVRVNKKP---VYDLRVKSTGLREGCEYEYRVYAENAAGLSLPSETSPLIRAED 19707

Query: 911   -IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 969
              +  P PP   KI D     + + W  P  DG A ITGYT++       +W T I+    
Sbjct: 19708 PVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVEYKKSDDTDWKTSIQSLRG 19767

Query: 970   TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1029
             T  TI+ L  G EY FRV S N  G S+ +  +        D +I K    E     ++ 
Sbjct: 19768 TEYTISGLTTGAEYVFRVKSVNKVGASDPSDSS--------DPQIAKEREEEPLFDIDSE 19819

Query: 1030  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMF--SNQGVCTLE 1087
             M    +V     AG + T+    RG P P + W K       D R R +  +     +L 
Sbjct: 19820 MRKTLIVK----AGASFTMTVPFRGRPVPNVLWSKPDT----DLRTRAYVDTTDSRTSLT 19871

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1121
             I   +  D G Y     N L    +   L VKV+
Sbjct: 19872 IENANRNDSGKYTLTIQNVLSAASL--TLVVKVL 19903



 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 133/609 (21%), Positives = 230/609 (37%), Gaps = 111/609 (18%)

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            WSR +K+++    +   +   +  T V  +   + +G    +  ++   AH  I      
Sbjct: 8576 WSRVNKSLLNAL-KANVDGLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISP---- 8630

Query: 619  FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT 678
             P PP+ P VT+       + WEPPA++GG  I+GYF++++   ++ W R    + K   
Sbjct: 8631 -PGPPI-PRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIKVRQ 8688

Query: 679  FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRW 738
            +  K++ EG  Y++R+ AVNA G   P        P+ V  P                  
Sbjct: 8689 YTVKEIREGADYKLRVSAVNAAGEGPPGETQ----PVTVAEPQ----------------- 8727

Query: 739  RPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 798
             PP    A  LD  V      G +  I+A K L  +    +TG P   K++ +       
Sbjct: 8728 EPP----AVELDVSVKG----GIQ--IMAGKTL--RIPAVVTGRPVPTKVWTK------- 8768

Query: 799  GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV--------IPFQGKPR 850
               E +     +++  +    ++ I   L++ + R V  A N          +     P 
Sbjct: 8769 --EEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPG 8826

Query: 851  PELTWKKDGAEIDKNQINIRNSETDT------IIFIRKAERSHSGKYDLQVKVDKFVETA 904
            P L  K          +N  + E D        I  RK  + H+ +  ++ +  K   T 
Sbjct: 8827 PVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITG 8886

Query: 905  SID------------------------IQIIDRPGPP---QIVKIEDVWGENVALTWTPP 937
             ++                        I  +D  GPP   + +   +     + L W  P
Sbjct: 8887 LLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEP 8946

Query: 938  KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYY-FRVFSENMCGLS 996
            + +G + I GY I+K      ++  V +    T++ + E +  ++ Y FRV + N  G S
Sbjct: 8947 RSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGES 9006

Query: 997  EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGN 1055
            E +       V+ +D ++               +      +T  + AG    +   V G 
Sbjct: 9007 EPSLPLN---VVIQDDEVPPT----------IKLRLSVRGDTIKVKAGEPVHIPADVTGL 9053

Query: 1056 PKPKITWMKNKVAI------VDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGT 1109
            P PKI W KN+  I      +   +  +  ++    L I K    D GTY   A N LG+
Sbjct: 9054 PMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGS 9113

Query: 1110 VEIECKLEV 1118
            V     +EV
Sbjct: 9114 VFRNVHVEV 9122



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 98/417 (23%), Positives = 169/417 (40%), Gaps = 47/417 (11%)

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKFTI 779
             PP  + +D V+  ++T+ W PP++ G   +  Y++E     +  W + ++  + +T   I
Sbjct: 19118 PPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQ-AVARTSIKI 19176

Query: 780   TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP----KIRIPRHLKQTYIRR- 834
               L T ++   RV A N  G S     S  ++ +    PP      ++    K T +   
Sbjct: 19177 VRLTTGSEYQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGPPGTPKVVHATKSTMLVTW 19235

Query: 835   ---VGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG 889
                V +  + VI +  + K R  + W K       N+I I     DT + +   +     
Sbjct: 19236 QVPVNDGGSRVIGYHLEYKERSSILWSK------ANKILI----ADTQMKVSGLDEGLMY 19285

Query: 890   KYDLQVKVDKFVETASIDIQII------DRPGPPQIVKIEDVWGENVALTWTPPKDDGNA 943
             +Y +  +    +   S   + +      D PG P++  I     ++V+L W+ P  DG A
Sbjct: 19286 EYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITR---KSVSLKWSKPHYDGGA 19342

Query: 944   AITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMC-GLSEDATM 1001
              ITGY +++ +     W      +   T   +TEL     Y FRVF+ N    +SE +  
Sbjct: 19343 KITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSES 19402

Query: 1002  TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKIT 1061
             T    +I +D  +    V  D  F +  +           AG    +N  + G P P I+
Sbjct: 19403 T--GPIIVKDD-VEPPRVMMDVKFRDVIVVK---------AGEVLKINADIAGRPLPVIS 19450

Query: 1062  WMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGT--VEIECKL 1116
             W K+ + I +  R  + S      L ++     D G Y     N  GT  V + CK+
Sbjct: 19451 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 19507



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 18/216 (8%)

Query: 912   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRT 970
             ++PG P    I  V  ++  + W PP  DG A I  Y ++K +KK  +W +V  E    T
Sbjct: 24451 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 24510

Query: 971   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFS-EAP 1029
               ++  L+ G EY FRV  EN+ G SE + +++              P+    D   +AP
Sbjct: 24511 VFSVKNLIEGLEYEFRVKCENLGGESEWSEISE--------------PITPKSDVPIQAP 24556

Query: 1030  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFS-NQGVCTLE 1087
              F + L N       NATL C V G+PKP + W +  K  I D  +YR+     G   L 
Sbjct: 24557 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 24616

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
             I   +  D   Y  +A N  G+V     LEV+V A+
Sbjct: 24617 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAK 24652



 Score = 90.9 bits (224), Expect = 6e-18
 Identities = 99/442 (22%), Positives = 167/442 (37%), Gaps = 60/442 (13%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  + +  P  P  PF             +  +     ++ W  P   G + +  Y++E 
Sbjct: 12612 IKVVVMDAPGPPQPPF------------DISDIDADACSLSWHIPLEDGGSNITNYIVEK 12659

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI- 815
             C     DW+ A    + KT   +  L    +   RV+A N  G SEP   + P +V +  
Sbjct: 12660 CDVSRGDWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRFGISEP--LTSPKMVAQFP 12716

Query: 816   ----IEPPKIRIPRHLKQ----TYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKN 865
                  EP   R+ +  K      + R   +  + +I +  + K R  L W K       N
Sbjct: 12717 FGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIERKERNSLLWVK------AN 12770

Query: 866   QINIRNSETDTIIFIRKAERS------HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI 919
                +R++E      +   E S      +        K  ++V TA + +   D PG P++
Sbjct: 12771 DTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV-TARMPV---DPPGKPEV 12826

Query: 920   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF---TVIEHYHRTSATITE 976
             +   DV    V+L W  PK DG + I GY ++       +W    T      +   T T 
Sbjct: 12827 I---DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQEEYTATG 12883

Query: 977   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV 1036
             L    +Y FR  +     +S  +  +    ++A +      P   D   +   + T    
Sbjct: 12884 LEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV-----PPRIDLSVAMKSLLTVK-- 12936

Query: 1037  NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG 1096
                  AG N  L+ +V G P P ++W K+   +      +M   + +CTLE+   +  D 
Sbjct: 12937 -----AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDS 12991

Query: 1097  GTYCCKAVNDLGTVEIECKLEV 1118
             G Y   A N  G+     KL+V
Sbjct: 12992 GDYTITAENSSGSKSATIKLKV 13013



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 117/543 (21%), Positives = 204/543 (37%), Gaps = 60/543 (11%)

Query: 603   NEAGEAHASIKVKVVDFPDP-----PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N AG   AS+        DP     P  P VT+       + W PP  DGGS + GY +E
Sbjct: 10027 NAAGVGPASLPSDPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVE 10086

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
              K++    W +      + T      + EG  Y+   F V A+ I+    P    V   +
Sbjct: 10087 YKEEGKEEWEKGKDKEVRGTKLVVTGLKEGAFYK---FRVRAVNIAGIGEPGE--VTDVI 10141

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKTKF 777
                  L++ D   D +V  R R   H G        +      T  W +  + L  +   
Sbjct: 10142 EMKDRLVSPDLQLDASV--RDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATI 10199

Query: 778   TITGLPTDAKI---------FVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIP---- 824
               T + +   I            + A N AG  +     + I+V  +  P  +  P    
Sbjct: 10200 ETTAISSSMVIKNCQRSHQGVYSLLAKNEAGERK-----KTIIVDVLDVPGPVGTPFLAH 10254

Query: 825   ----RHLKQTYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTII 878
                    K T+     +  + +  +  + +      W      + +    ++        
Sbjct: 10255 NLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAY 10314

Query: 879   FIRKAERSHSGKYDLQVKVDKFVETASIDI--QIIDRPGPPQIVKIEDVWGENVALTWTP 936
             F R A  +  G       +  FVET+   +  + I  P  P+ +++++V    V LTW P
Sbjct: 10315 FFRIAAENSIG-------MGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNP 10367

Query: 937   PKDDGNAAITGYTIQKADKKSMEWFTVI-EHYHRTSATITELVIGNEYYFRVFSENMCGL 995
             PK DG + I  Y ++     + ++  V  ++      T+  L  G+ Y +RV + N+ G 
Sbjct: 10368 PKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQ 10427

Query: 996   SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
              + +  TK    I    ++    ++ DF        T  +   +A+ G  +       G 
Sbjct: 10428 GKPSFCTKP---ITCKDELAPPTLHLDF----RDKLTIRVGEAFALTGRYS-------GK 10473

Query: 1056  PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1115
             PKPK++W K++  +++D R  + +      LE  K    D G YC    N  G+ +  C+
Sbjct: 10474 PKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQ 10533

Query: 1116  LEV 1118
             + V
Sbjct: 10534 VNV 10536



 Score = 87.0 bits (214), Expect = 9e-17
 Identities = 96/437 (21%), Positives = 162/437 (37%), Gaps = 75/437 (17%)

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
             N+  ++  +  S  +  +D  DPP  P    +      + W  P Y GG  I  Y +E++
Sbjct: 14965 NMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKR 15024

Query: 660   KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVPLAVT 718
                + RW++ NF    E  F    + E  AYE R+ A NA G IS PS PS         
Sbjct: 15025 DLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDV 15084

Query: 719   SPPTLLTVDSVTDTTV-------------------TMRWRP--PDHIGAAGLDGYVLEYC 757
               P +       DT +                   TM W     +  G A L+  + ++ 
Sbjct: 15085 EAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFS 15144

Query: 758   FEGTEDWIVANKDLI--DKTKFTITGLPTD--AKIFVRVKAVNAAGASEPKYYSQPILVK 813
                     + NKD    D   +T+T       AK    VK ++  G  E      P+ V 
Sbjct: 15145 TN------LVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-----GPLAVT 15193

Query: 814   EIIE--------PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN 865
             E+          PP            +   G  ++  I  Q +    L W    +E+   
Sbjct: 15194 EVTSEKCVLSWFPP------------LDDGGAKIDHYI-VQKRETSRLAWTNVASEVQVT 15240

Query: 866   QINI-RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIED 924
             ++ + +  + +  IF   A   +     L+           + +     P PP+  ++  
Sbjct: 15241 KLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-------SEPVLAVNPYGPPDPPKNPEVTT 15293

Query: 925   VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-----TVIEHYHRTSATITELVI 979
             +  +++ + W  P  DG + I  Y +++ DK    W      T+ +  ++ S     L  
Sbjct: 15294 ITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSG----LTE 15349

Query: 980   GNEYYFRVFSENMCGLS 996
             G+EY FR+ +EN  G+S
Sbjct: 15350 GHEYEFRIMAENAAGIS 15366



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 94/359 (26%), Positives = 158/359 (44%), Gaps = 23/359 (6%)

Query: 285  WYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT---AGDEKCST-ELFVREP 340
            W K+G  IR S K+ F   G  R L I + Q++D  EY         EK ST +L V E 
Sbjct: 4779 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 4838

Query: 341  PIMVTKQL-EDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHI 399
            P+   K L E+ T   G+ + L CE+++ + +V W K+G+ ++  P  R    V G    
Sbjct: 4839 PVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKP-GRIVPGVIGLMRA 4896

Query: 400  LIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL-----TPLTDQTVNLGKEICLKC 454
            L I  A   DA  Y+V T    ++ + S  +K ++++      P+ DQ V         C
Sbjct: 4897 LTINDADDTDAGTYTV-TVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 4955

Query: 455  EISENIPG-KWTK--NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 511
            +I+++ P  KW K  + +P + +D+ +++  G    L I NA+ ED  +Y  A +     
Sbjct: 4956 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEY--AVEIEGKR 5013

Query: 512  LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             PAK+ + +    +L  ++    VT+        +  IS    P     +G+  ++  S 
Sbjct: 5014 YPAKLTLGEREVELLKPIE---DVTIYEKESASFDAEISEADIPGQWKLKGE--LLRPSP 5068

Query: 572  RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                ++      L +   + D +G       N    A  ++K   +DF  P    TV E
Sbjct: 5069 TCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPE 5127



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 104/434 (23%), Positives = 164/434 (37%), Gaps = 44/434 (10%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             ++ I + KP  P  P            +  D V+   V + W PP + G   +  Y++E 
Sbjct: 18025 LSVIVLEKPGPPVGP------------VRFDEVSADFVVISWEPPAYTGGCQISNYIVEK 18072

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV---- 812
                 T  W + +   + +T   IT L T  +   R+ A N  G S P   S+ ++V    
Sbjct: 18073 RDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRYGKSAP-LDSKAVIVQYPF 18130

Query: 813   KEIIEPPKIRIPRHLKQTYIRRVGEAVN------LVIPFQGKPRPELTWKKDGAEIDKNQ 866
             KE   P    +    K   + +  E VN      +    + K +  + W K    ++K  
Sbjct: 18131 KEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVK----LNKTP 18186

Query: 867   INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVW 926
             I     +T  +    + E   S +  + +     V    +     D PG P+ + I    
Sbjct: 18187 IQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITR-- 18244

Query: 927   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYF 985
               NV L W  P  DG + ITGY ++K D     W      +   T  T++ LV    Y F
Sbjct: 18245 -NNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYEF 18303

Query: 986   RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1045
             RV + N  G   + +     A+ ARD     N   +       P +   +V     AG  
Sbjct: 18304 RVIARNAAGNFSEPS-DSSGAITARDEIDAPNASLD-------PKYKDVIV---VHAGET 18352

Query: 1046  ATLNCSVRGNPKPKITWMKNKVAIVDD-PRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAV 1104
               L   +RG P P + W K+   + +   R  + S     TL ++     DGG Y  K  
Sbjct: 18353 FVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLS 18412

Query: 1105  NDLGTVEIECKLEV 1118
             N  GT  I   ++V
Sbjct: 18413 NVGGTKSIPITVKV 18426



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 78/292 (26%), Positives = 125/292 (42%), Gaps = 60/292 (20%)

Query: 265   DKGGRVRFV--VELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             ++GG V++V  +E  D   +V WY   +++  S KY   ++    IL++ +    DD  Y
Sbjct: 25208 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 25267

Query: 323   YVTA----GDEKCSTELFVR---------------------------EPPIMVTKQLEDT 351
                     G++    ELFV+                           E P   T  L + 
Sbjct: 25268 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 25327

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK-SRYRIRVEGKKHILIIEGATKAD 409
             TAY GE V     ++   + +V W+K+G++I PG    +Y    +   + L I   T  D
Sbjct: 25328 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25387

Query: 410   AAEYSVMTTG--GQSS--AKLSVDLKPLKILTPLTDQTV-------------NLGKEICL 452
              AEY+V+     G+ S  AKL+V L P     P TD T+               G+ +C 
Sbjct: 25388 DAEYTVVARNKYGEDSCKAKLTVTLHP-----PPTDSTLRPMFKRLLANAECQEGQSVCF 25442

Query: 453   KCEISENIPG--KWTKNGLPVQESDRLKVVHKG-RIHKLVIANALTEDEGDY 501
             +  +S   P   KW K+G P+     ++++H+G   + L I + L ED G Y
Sbjct: 25443 EIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 25494



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 102/444 (22%), Positives = 169/444 (38%), Gaps = 63/444 (14%)

Query: 696   AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             ++  + + KP  P  P            +  D V+  ++T+ W PP + G   +  Y+++
Sbjct: 16942 SIEIVTLDKPDPPKGP------------VKFDDVSAESITLSWNPPLYTGGCQITNYIVQ 16989

Query: 756   YCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 815
                  T  W V +   + +T   +T L T  +   R+ A N  G S     S PI+ +  
Sbjct: 16990 KRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFAENRYGQSFA-LESDPIVAQYP 17047

Query: 816   IE---PPKIRIPRHL-KQTYIRRVGEAVN------LVIPFQGKPRPELTWKKDGAEIDKN 865
              +   PP       + K + + +  E VN      +    + K R  + W K    ++K 
Sbjct: 17048 YKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTK----VNKT 17103

Query: 866   QINIRNSETDTIIFIRKAERSHSG-KYDLQVKVDKFVETAS--------IDIQIIDRPGP 916
              I+      DT     KA+    G +Y+ +V  +  V            +     D PG 
Sbjct: 17104 IIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPPGT 17154

Query: 917   PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATIT 975
             P+ + ++      + L WT P  DG + ITGY ++K D     W      +   T  T++
Sbjct: 17155 PEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVS 17211

Query: 976   ELVIGNEYYFRVFSENMCG-LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQP 1034
              L     Y FRV ++N  G +S+ +  T         G I      E    S  P F   
Sbjct: 17212 GLTEDQRYEFRVIAKNAAGAISKPSDST---------GPITAKDEVELPRISMDPKFRDT 17262

Query: 1035  LVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPY 1094
             +V     AG    L   V G P P I W++    I +  R  + +      L ++     
Sbjct: 17263 IVVN---AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRI 17319

Query: 1095  DGGTYCCKAVNDLGTVEIECKLEV 1118
             DGG Y  +A N  G+      ++V
Sbjct: 17320 DGGQYILRASNVAGSKSFPVNVKV 17343



 Score = 84.3 bits (207), Expect = 6e-16
 Identities = 105/451 (23%), Positives = 168/451 (37%), Gaps = 79/451 (17%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  I + KP  P+ P            + +D +  T++T+ W PP+  G A L GYV+E 
Sbjct: 23452 IKVIILDKPGPPTGP------------IKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 23499

Query: 757   CFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
                    W+  ++  + ++ F  T L    +   RV A N  G           L  E+I
Sbjct: 23500 RDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRFGIGS-------YLQSEVI 23551

Query: 817   E-PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW---KKDGAE------IDKNQ 866
             E    IRIP           G    L I    +    LTW   + DG        +++ +
Sbjct: 23552 ECRSSIRIP-----------GPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVERKE 23600

Query: 867   INIR-----NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------IDIQIIDR 913
             +        N    T+   R    +   +Y+ +V       +          + +  I  
Sbjct: 23601 VRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAP 23660

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF------TVIEHY 967
             PG PQ  ++ D    +V+L W+ P+D+G + +TGY I+       EW       T I  Y
Sbjct: 23661 PGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKIREY 23720

Query: 968   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1027
                  T+T L  G EY FRV + N  G  E A        +    K+ +   Y D++  E
Sbjct: 23721 -----TLTHLPQGAEYRFRVLACNAGGPGEPAE-------VPGTVKVTEMLEYPDYELDE 23768

Query: 1028  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
                  +     +   G    L   ++G P P   W K    I    R  + +++    L 
Sbjct: 23769 -----RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI--SKRAMIATSETHTELV 23821

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             I++    D GTY     N  G   +  K+ V
Sbjct: 23822 IKEADRGDSGTYDLVLENKCGKKAVYIKVRV 23852



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 93/410 (22%), Positives = 160/410 (39%), Gaps = 66/410 (16%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEI----RPSTKYIFEHKGCQRILFINNCQMTD 318
            QV +  R     E+ +  ++  WYK+G EI    +   KY+ E +     +FI+  + +D
Sbjct: 3111 QVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR--IHRMFISETRQSD 3168

Query: 319  DSEYYVTAGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFK 376
              EY   AG  + S  L+V  P P  V ++L+  T   G+       +S      + W+K
Sbjct: 3169 AGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYK 3228

Query: 377  NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA--------EYSVMTTGGQSSAKL-- 426
              + +  G K ++    +G+++ L++  A   DAA        +Y V TT    S ++  
Sbjct: 3229 EEQLLSTGFKCKF--LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286

Query: 427  ------SVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKV 479
                   + + P  I+TPL D   + G+    +C +S  ++   W      ++ S   ++
Sbjct: 3287 VVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3346

Query: 480  VHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD--ADNT--- 534
                  ++L IA A  EDEG Y F      V   A   V     + L+G     +NT   
Sbjct: 3347 TQFEDTYQLEIAEAYPEDEGTYTF------VASNAVGQVSSTANLSLEGFSKFEENTSNS 3400

Query: 535  ---------------------------VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
                                       + V  G  +R    +SG P P+  W    + I+
Sbjct: 3401 QWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLIL 3460

Query: 568  EGSGRI-RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
                 +   E     + ++I  A  + +G Y     N AGEA  +  + V
Sbjct: 3461 PTKDVVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 21/194 (10%)

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTE-------SYPDSSTLVIDIAERDDSGVYHI 599
            + +  EPP         + ++E   R+ T        + PD +  V D+ E  +   + +
Sbjct: 7828 VDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQ-FQV 7886

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPVAPT------VTEVGDDWCIMNWEPPAYDGGSPILG 653
              +NEAG  H S   +++   DP   P+      VT+ G     + W+PP  +GGSPI+G
Sbjct: 7887 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 7946

Query: 654  YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVA----YEVRIFAVNAIGISKPSMPS 709
            Y +E     + +WMR+N    K+  F   K+ EGV     Y +R+ AVNAIG+S+PS  S
Sbjct: 7947 YHVEMCPVGTEKWMRVNSRPIKDLKF---KVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 8003

Query: 710  RPFVPLAVTSPPTL 723
               V       PT+
Sbjct: 8004 ENVVAKDPDCKPTI 8017



 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 105/447 (23%), Positives = 173/447 (38%), Gaps = 58/447 (12%)

Query: 696   AVNAIGISKPSMPSR-PFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVL 754
             A NA G +K  +  +    P  V  P   +   ++T   +T+ W  P + G A +  Y++
Sbjct: 21661 AKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWWDAPLNDGCAPITHYII 21717

Query: 755   EYCFEGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVK- 813
             E        W +  +D  +   +T   L    +   RV AVN  G   P   S P++ + 
Sbjct: 21718 EKRETSRLAWALI-EDKCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRP-LDSDPVVAQI 21775

Query: 814   --EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRN 871
                + + P I  P ++        G ++ L        RPE      G+EI +  +  R 
Sbjct: 21776 QYTVPDAPGIPEPSNI-------TGNSITLTWA-----RPE---SDGGSEIQQYILERRE 21820

Query: 872   SE-TDTIIFIRKAERSHS----------GKYDLQVKVDKF--VETASIDIQII------D 912
              + T  +  I K   S +           +Y+  V  +    V  AS   ++I      +
Sbjct: 21821 KKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVN 21880

Query: 913   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTS 971
              PGPP +VK+ D     V+L W+ P  DG   I GY I+       +W  V  E   +T 
Sbjct: 21881 PPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTR 21940

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1031
              T+T+L  G EY FRV + N  G  +   +T     I    ++    +  D +F +  + 
Sbjct: 21941 YTVTDLQAGEEYKFRVSAINGAGKGDSCEVT---GTIKAVDRLTAPELDIDANFKQTHVV 21997

Query: 1032  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1091
                       AG +  L  + +G P P   W K    +    R  + +     TL +   
Sbjct: 21998 R---------AGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENC 22046

Query: 1092  SPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             +  D G Y     N+ G+  I   ++V
Sbjct: 22047 NRNDAGKYTLTVENNSGSKSITFTVKV 22073



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 64/235 (27%), Positives = 91/235 (38%), Gaps = 46/235 (19%)

Query: 914  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT-SA 972
            P PP  V++ +   E + +TW PP  DG + I GY I+K  K    W    EH     + 
Sbjct: 8208 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 8267

Query: 973  TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1032
            T   L  G EY FRV +EN  G+SE +  T  +  +            +  D  +  + T
Sbjct: 8268 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAV------------DPIDAPKVILRT 8315

Query: 1033 QPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-------PRYRM-------- 1077
               V      G    L+ S+ G+P P ITW+K++  IV +       P  R         
Sbjct: 8316 SLEVKR----GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEE 8371

Query: 1078 --------------FSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                           S +G   L +R     D G Y  K  ND G  +  C + V
Sbjct: 8372 EPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8426



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 59/203 (29%), Positives = 83/203 (40%), Gaps = 14/203 (6%)

Query: 908   IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY 967
             ++  + P PP  + I D+    V+L W  PK DG + ITGY I+   K S +W T I   
Sbjct: 14587 VKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTV 14645

Query: 968   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1027
                   +  L  G EY F+V + N  G S      +ES  +     + +  +  + D   
Sbjct: 14646 KGLECVVRNLTEGEEYTFQVMAVNSAGRSAP----RESRPVI----VKEQTMLPELDLRG 14697

Query: 1028  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
                  Q LV   A AG N  +   V G PKP +TW K    +    R    +      L 
Sbjct: 14698 ---IYQKLV--IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILN 14752

Query: 1088  IRKPSPYDGGTYCCKAVNDLGTV 1110
             I +    D G Y   A N +G V
Sbjct: 14753 INECVRSDSGPYPLTARNIVGEV 14775



 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 13/197 (6%)

Query: 912   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 971
             ++P PP+ + + D    +  L W  P  DG + ITGY ++   K S  W     H  + +
Sbjct: 22172 EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLT 22230

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1031
              T+  LV   EY FRV ++N  G SE       S+VI ++ +I           ++    
Sbjct: 22231 FTVERLVEKTEYEFRVKAKNDAGYSEPREAF--SSVIIKEPQIEPT--------ADLTGI 22280

Query: 1032  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1091
             T  L+   A  G   T++  + G P PK+TW   ++ + +  R  + + +   TL ++  
Sbjct: 22281 TNQLITCKA--GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22338

Query: 1092  SPYDGGTYCCKAVNDLG 1108
                D G Y     N  G
Sbjct: 22339 MRGDSGRYFLTLENTAG 22355



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 134/663 (20%), Positives = 230/663 (34%), Gaps = 120/663 (18%)

Query: 2     PEPTKKEENEVPAP----APPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLS 57
             PEP  K    V +P    +P P  P       T P        TP  + Q    +     
Sbjct: 26297 PEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP--------TPTEKVQHLPVSAPPKI 26348

Query: 58    ILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFE 117
               F++       +  ++I  +  V    +LR   + W+K          GK L+    F+
Sbjct: 26349 TQFLK------AEASKEIAKLTCVVESSVLRAKEVTWYKD---------GKKLKENGHFQ 26393

Query: 118   RH-SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFK 176
              H S   T+E++I    ++  G Y CE+                                
Sbjct: 26394 FHYSADGTYELKINNLTESDQGEYVCEI-------------------------------- 26421

Query: 177   RSGEGQEDAGELDFSG---------LLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF 227
              SGEG      L F G         + K  E K+ +++       + +  +P   E I+ 
Sbjct: 26422 -SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTEST--VTRKTEPKAPEPIS- 26477

Query: 228   QYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYK 287
                                   K      + D     D   +   V    +P+    W K
Sbjct: 26478 ---------------------SKPVIVTGLQDTTVSSDSVAKFA-VKATGEPRPTAIWTK 26515

Query: 288   NGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT----AGDEKCSTELFVREPPIM 343
             +G+ I    KY          L I+    +D   Y  T    AG    S +L ++   I 
Sbjct: 26516 DGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--IK 26573

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
              T+  + +T    E    +  V +++ + K  ++ E  +   KS+ ++ ++ +   ++I 
Sbjct: 26574 DTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLIS 26633

Query: 404   GATKADAA---EYSVMTTGGQSSAKLSVDLKP-LKILTPLTDQTVNLGKEICLKCEISEN 459
                K  AA   E S++      +++ S +++   +I    T  ++N G+ + LK  I+  
Sbjct: 26634 EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA 26693

Query: 460   IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--------FAPDAYNVT 511
                KW  NG+ +  S+  +    G    L I  A   DEG                Y++T
Sbjct: 26694 TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLT 26753

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             L  ++   D P  I        +  +  G  +     ISGEP P+  W + +  I   S 
Sbjct: 26754 LSKELS--DAPAFI----SQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISS 26806

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
              +      +  +L I  A   DSG Y I  KN  G+  A+  + V+   + P    V   
Sbjct: 26807 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRT 26866

Query: 632   GDD 634
               D
Sbjct: 26867 SGD 26869



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 94/408 (23%), Positives = 146/408 (35%), Gaps = 40/408 (9%)

Query: 717   VTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLIDKT 775
             +  PPT  +  D V+   VT  W PP++ G   +  YV+E     +  W+     +I +T
Sbjct: 14786 IPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVI-RT 14844

Query: 776   KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ-TYIRR 834
              +  T L T  +   RVKA N  G   P   S  I+      P K+  P    Q T + +
Sbjct: 14845 TYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANY---PFKVPGPPGTPQVTAVTK 14900

Query: 835   VGEAVNLVIPF------------QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIF-IR 881
                 ++   P             + K R  + W+     +    I   +  TD I +  R
Sbjct: 14901 DSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFR 14960

Query: 882   KAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDG 941
                 + +GK     K  K  E   + +  ID PG P  + I       V L W  P+  G
Sbjct: 14961 VIAENMAGKS----KPSKPSEPM-LALDPIDPPGKPVPLNITR---HTVTLKWAKPEYTG 15012

Query: 942   NAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1000
                IT Y ++K D  +  W      +      T++ L     Y FRV ++N  G     +
Sbjct: 15013 GFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPS 15072

Query: 1001  MTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKI 1060
                ++     D +  K  V  D  F +  +           AG    L   V G P P +
Sbjct: 15073 EPSDAITCRDDVEAPKIKV--DVKFKDTVILK---------AGEAFRLEADVSGRPPPTM 15121

Query: 1061  TWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1108
              W K+   +    +  +        L  +  +  D G Y   A N  G
Sbjct: 15122 EWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGG 15169



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 19/303 (6%)

Query: 341  PIMVTKQLEDT----TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
            P+   K+++D     + + G     EC VS   A   W K+G  I   PK  +R   +GK
Sbjct: 4742 PLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPK--HRFIADGK 4799

Query: 397  KHILIIEGATKADAAEYSVMTTGGQ----SSAKLSVDLKPLKILTPLTDQ-TVNLGKEIC 451
               L I     +DA EY+ +   G     S+AKL V+  P++ +  L ++ TV  G+ + 
Sbjct: 4800 DRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 4859

Query: 452  LKCEISENIPGKWTKNG-LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYN 509
            L CE+++     W K+G + V++  R+     G +  L I +A   D G Y V   +A N
Sbjct: 4860 LSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANN 4919

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
            +   + V V++   +I D L        +      +      +  P   W +G   I   
Sbjct: 4920 LECSSCVKVVE---VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI-PA 4975

Query: 570  SGRIRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
                +TE   D + L + I  A  +D   Y + ++ +   A  ++  + V+   P    T
Sbjct: 4976 EPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVT 5035

Query: 628  VTE 630
            + E
Sbjct: 5036 IYE 5038



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 31/92 (33%), Positives = 43/92 (46%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1088
            P     L N   I G + TL C + G P P +TW +    I     +++    G+  L I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1089 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
            R+    D G + C AVN+ GTV   C L V+V
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 988



 Score = 61.2 bits (147), Expect = 5e-09
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 913   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH-YHRTS 971
             RP PP++ K+     E + + W PP+ DG  +ITGY ++K +K S  W  V +       
Sbjct: 12026 RPDPPEVTKVSK---EEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERR 12082

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1011
               +  L+  +EY FRV +EN  G+ E +  ++   V+A+D
Sbjct: 12083 MKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR--PVVAKD 12120



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/324 (22%), Positives = 129/324 (39%), Gaps = 19/324 (5%)

Query: 811  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID----- 863
            L +E   P +   P  + +  ++++ E  ++V   Q  G P+P + WKK G  +      
Sbjct: 1023 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 864  KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 923
            K   N +  E   +I +  A+   +G+Y + V+ +K  ET S    +++      ++K +
Sbjct: 1083 KVSYNKQTGECKLVISMTFAD--DAGEYTIVVR-NKHGET-SASASLLEEADYELLMKSQ 1138

Query: 924  DVWGENVALTWTPPKDDGNAAITGYTIQKADKK-SMEWFTVIEHYHRTSATITELVIGNE 982
                    +T    +        G+   + +K+   E   + +   + +  +   V   E
Sbjct: 1139 QEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQE 1198

Query: 983  YYFRVFSENMCGLSEDATM-TKESAVIARDGKIYKNPVYEDFDFSEAPM--FTQPLVNTY 1039
            ++   F E +    E   + T    ++  DG+     +  D   SEA    F   + N  
Sbjct: 1199 FHISSFEERLIKEIEYRIIKTTLEELLEEDGE---EKMAVDISESEAVESGFDSRIKNYR 1255

Query: 1040 AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRM-FSNQGVCTLEIRKPSPYDGGT 1098
             + G   T +C + G P PKI W K+   I    RY+M F   G  +L I    P D G 
Sbjct: 1256 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1315

Query: 1099 YCCKAVNDLGTVEIECKLEVKVIA 1122
            Y   A N  G      KL V+  A
Sbjct: 1316 YTAFASNIKGNAICSGKLYVEPAA 1339



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 345 TKQLEDTTAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
           T+ L+      G     E  +S      V WF++G+ I        +I     +  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 404 GATKADAAEYSVMTTGGQSSAKLSVDL------KPLKILTPLTDQTVNLGKEICLKCEIS 457
             TKA++  YS+  T G   A  + +L       P   +  L   TV  G ++ L+  ++
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 458 ENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             IP    K+ ++G  +Q S   ++  +G ++ L+IA A  ED G Y
Sbjct: 129 -GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 39/140 (27%), Positives = 56/140 (40%), Gaps = 9/140 (6%)

Query: 985   FRVFSENMCGLSEDATM---TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1041
             F+   E +  +SE       T ES V  +       P+      S  P+    L +T   
Sbjct: 26439 FKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI------SSKPVIVTGLQDTTVS 26492

Query: 1042  AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1101
             +   A       G P+P   W K+  AI    +Y++  ++G   LEI K    D G Y C
Sbjct: 26493 SDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTC 26552

Query: 1102  KAVNDLGTVEIECKLEVKVI 1121
                N  G+V   CKL +K I
Sbjct: 26553 TVKNSAGSVSSSCKLTIKAI 26572



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 74/348 (21%), Positives = 121/348 (34%), Gaps = 77/348 (22%)

Query: 847   GKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYD------------- 892
             G+PRP   W KDG  I +  +  +   +    + I K + S SG Y              
Sbjct: 26505 GEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSS 26564

Query: 893   --LQVKVDKFVETASIDIQIIDRPGPPQIVKIED------VWGENVALTWTPP------K 938
               L +K  K  E   +  Q      P +   +++      +  E + ++          K
Sbjct: 26565 CKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALK 26624

Query: 939   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS-------------ATITELVIGNEYYF 985
             ++ +  +    ++K+   S+E   V E   +TS             A  T++ I NE   
Sbjct: 26625 EEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSI-NEGQR 26683

Query: 986   RVFSENMCGLSE-----------------------DATMT------KESAVIARDGKIYK 1016
              V   N+ G ++                       D T+T      ++  ++    K  +
Sbjct: 26684 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 26743

Query: 1017  NPVYEDFDF------SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1070
               V   +D       S+AP F     +     G N    C + G P P+I W KN + I 
Sbjct: 26744 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 26803

Query: 1071  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
                   +  ++ V +LEIR  S  D G Y  KA N  G       L V
Sbjct: 26804 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26851



 Score = 54.7 bits (130), Expect = 5e-07
 Identities = 52/221 (23%), Positives = 77/221 (34%), Gaps = 45/221 (20%)

Query: 902  ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 961
            +TA  D++++ RP P      E  W             DG   +  YT +          
Sbjct: 1426 QTARFDLKVVGRPMP------ETFWFH-----------DGQQIVNDYTHK---------- 1458

Query: 962  TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1021
             VI+     S  I      +   + V ++N  G S  + +    AV              
Sbjct: 1459 VVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV-------------- 1504

Query: 1022 DFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFS 1079
              +    PMF + L N     G    +     GNP P I W+KN   IV    P+ R+  
Sbjct: 1505 --EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEG 1562

Query: 1080 NQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
             +G   L+I      D   Y   A+N  G     CK+ V+V
Sbjct: 1563 TKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1603



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 86/414 (20%), Positives = 162/414 (39%), Gaps = 69/414 (16%)

Query: 263  QVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIF--EHKGCQRILFINNCQMTDD 319
            +V  G  VRF   ++  PK E++W+ N Q I P+   +F  E      ++ I +      
Sbjct: 3429 RVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHA 3488

Query: 320  SEYYV----TAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWF 375
             +Y      +AG+  C+  L        VT +  ++  +  ER+E E E+   + +  + 
Sbjct: 3489 GQYSCKAANSAGEATCAATL-------TVTPKAPESILH--ERIEQEIEMEMKEFSSSFL 3539

Query: 376  KNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKI 435
               EE +   + +   ++     +L          +E  V  T   S  + +  +     
Sbjct: 3540 SAEEEGLHSAELQLS-KINETLELL----------SESPVYPTKFDSEKEGTGPI----F 3584

Query: 436  LTPLTDQTVNLGKEICLKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
            +  +++  +++G    L   +   IP    +W  NG+ +  S   K V  G  H L+I  
Sbjct: 3585 IKEVSNADISMGDVATLSVTVI-GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILF 3643

Query: 493  ALTEDEGDYV-FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL------ 545
               EDEG+Y   A + Y  T+ +    I+      +G     T + +A +  +L      
Sbjct: 3644 TKLEDEGEYTCMASNDYGKTICSAYLKINSKG---EGHKDTETESAVAKSLEKLGGPCPP 3700

Query: 546  -------------------EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
                               E  + GEP P   W + +K +          +   S T ++
Sbjct: 3701 HFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIV 3760

Query: 587  DIAERDDSGVYHINLKNEAGEAHASIKVKVV----DFPDPPV-APTVTEVGDDW 635
            +  +R+DSG+Y    +N  GE+  + ++ V+    D  D P  A +  E  +D+
Sbjct: 3761 NDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPEAPEDF 3814



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 56/305 (18%), Positives = 122/305 (40%), Gaps = 22/305 (7%)

Query: 824   PRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID-KNQINIRNSETDTIIFI 880
             P  + Q   + + E  N++   +  G+P PE+ W K+   I   + ++I  S     + I
Sbjct: 26762 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 26821

Query: 881   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDR-PGPPQIVKIEDVWGENVALTWTPPKD 939
             R A  S SGKY ++ K  +   +A+  + ++     P + V +      ++  +++    
Sbjct: 26822 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 26881

Query: 940   DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 999
               +A+    +       S    T ++    ++ +++ +    E +  + S +  G+S   
Sbjct: 26882 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM---QESFVEMSSSSFMGISNMT 26938

Query: 1000  TMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKP 1058
              +   ++ + + G                P   + L +  +I  G   T+ C+  G P P
Sbjct: 26939 QLESSTSKMLKAG------------IRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTP 26986

Query: 1059  KITWM--KNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
             ++TW     K+   +  R+ + +   + TL I      DGG Y     N+ G+      +
Sbjct: 26987 EVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 27046

Query: 1117  EVKVI 1121
              ++ I
Sbjct: 27047 HIRSI 27051



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 96/424 (22%), Positives = 163/424 (38%), Gaps = 79/424 (18%)

Query: 714  PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGTEDWIVANKDLID 773
            PLA+     LL  +   +  +     PPD I  +  +   ++   E      V  +DL+ 
Sbjct: 4093 PLALEEKQVLLKEEHSDNVVM-----PPDQIIESKREPVAIKKVQE------VQGRDLLS 4141

Query: 774  KTKFTITGLPTDAKIFVRV---KAVNAAGASE-PKYYSQPILVKEIIEPPKIRI---PRH 826
            K    ++G+P + ++ +++   +A+ AA ASE P  +S+ +   E +E   + I   PRH
Sbjct: 4142 KESL-LSGIPEEQRLNLKIQICRALQAAVASEQPGLFSEWLRNIEKVEVEAVNITQEPRH 4200

Query: 827  LKQTYI----RRVGEAVNLVIPFQGKPRPELTWKKDGA--EIDKNQINIRNSETDTIIFI 880
            +   Y+    + V E V ++I         L  +   A   I   +I+I  +E   I   
Sbjct: 4201 IMCMYLVTSAKSVTEEVTIIIEDVDPQMANLKMELRDALCAIIYEEIDILTAEGPRI--- 4257

Query: 881  RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVA-----LTWT 935
                     K  LQ ++D F  +  ++           ++  E+V   NV      L  T
Sbjct: 4258 -----QQGAKTSLQEEMDSFSGSQKVEPITEPEVESKYLISTEEVSYFNVQSRVKYLDAT 4312

Query: 936  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 995
            P      +A+       +D+K  E     E    +S+                     G 
Sbjct: 4313 PVTKGVASAVV------SDEKQDESLKPSEEKEESSSE-------------------SGT 4347

Query: 996  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGN 1055
             E AT+  + A    +G + K          + PM   PLV+T +  G    L  S+  N
Sbjct: 4348 EEVATVKIQEA----EGGLIKE---------DGPMIHTPLVDTVSEEGDIVHLTTSIT-N 4393

Query: 1056 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG-GTYCCKAVNDLGTVEIEC 1114
             K ++ W      +  D +++   +Q   TL I K +  D  G Y C+A+ND G      
Sbjct: 4394 AK-EVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSA 4452

Query: 1115 KLEV 1118
            KL V
Sbjct: 4453 KLTV 4456



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 59/283 (20%), Positives = 97/283 (34%), Gaps = 70/283 (24%)

Query: 836  GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 895
            GE+V L     G P P +TW ++  +I+                                
Sbjct: 911  GESVTLECHISGYPSPTVTWYREDYQIE-------------------------------- 938

Query: 896  KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 955
                    +SID QI  + G  +++  E    ++   T +   + G  + + Y   +   
Sbjct: 939  --------SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ--- 987

Query: 956  KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1015
                   V E + + +  +TE     E   + F E+   +  D ++T+E A        Y
Sbjct: 988  -------VSEEFEKETTAVTEKFTTEE---KRFVESRDVVMTDTSLTEEQAGPGEPAAPY 1037

Query: 1016 KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1075
                            T+P+V    + G +    C V GNPKP + W K+ V +    RY
Sbjct: 1038 --------------FITKPVVQKL-VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 1076 RMFSNQ--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1116
            ++  N+  G C L I      D G Y     N  G       L
Sbjct: 1083 KVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 1026 SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFSNQGV 1083
            ++AP FTQPL +   + G  AT    + G P P+++W ++   I     P  ++  + G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1084 CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
              L I   +  + G Y  KA N  G      +L VK
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 64/324 (19%), Positives = 119/324 (36%), Gaps = 26/324 (8%)

Query: 817  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETD 875
            EPP++   + L+   ++  G+         G+P+P+++W K+   +    +    +   +
Sbjct: 3191 EPPQVL--QELQPVTVQS-GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQE 3247

Query: 876  TIIFIRKAERSHSGKYDLQVKVDKFVET--ASIDIQIIDRPGPPQ---------IVKIED 924
              + + +A    +  Y  + K D  V T  AS+ +++ +   P Q         I  ++D
Sbjct: 3248 YTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQD 3307

Query: 925  -VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 983
             V  E     +       +  ++ Y+  K  K S  +F + +        I E    +E 
Sbjct: 3308 TVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPS-RFFRMTQFEDTYQLEIAEAYPEDEG 3366

Query: 984  YFRVFSENMCG-------LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV 1036
             +   + N  G       LS +     E         +  +  ++     + P F QPL 
Sbjct: 3367 TYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLS 3426

Query: 1037 NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV--DDPRYRMFSNQGVCTLEIRKPSPY 1094
            +     G     +  V G PKP+I W  N+  I+   D  +    + G+  + I      
Sbjct: 3427 SLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSE 3486

Query: 1095 DGGTYCCKAVNDLGTVEIECKLEV 1118
              G Y CKA N  G       L V
Sbjct: 3487 HAGQYSCKAANSAGEATCAATLTV 3510



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 36/105 (34%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 512 LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
           +PA V +   P  ++ GL     VTVI G  + LE  ISG P P   W R D  I E S 
Sbjct: 886 VPAPVEIPVTPPTLVSGL---KNVTVIEGESVTLECHISGYPSPTVTWYREDYQI-ESSI 941

Query: 572 RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
             +       + L+I  A  +DSG +  +  NEAG    S  + V
Sbjct: 942 DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 1029  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV---DDPRYRMFSNQGVCT 1085
             P FT PL N  A  G N     ++  +P+P +TW K+   I    +D +Y   S++G+  
Sbjct: 25318 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25377

Query: 1086  LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
             L I   +  D   Y   A N  G    + KL V
Sbjct: 25378 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25410



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 1016 KNPVYEDFDFSE----APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1071
            ++PVY     SE     P+F + + N     G  ATL+ +V G PKPKI W  N V +  
Sbjct: 3565 ESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTP 3624

Query: 1072 DPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1118
               Y+   +    +L I      D G Y C A ND G       L++
Sbjct: 3625 SADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3671



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 42/93 (45%)

Query: 1028 APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1087
            AP+  + +       G+ A   C ++  P  +  W K    I +  +  + S++ + +LE
Sbjct: 4461 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLE 4520

Query: 1088 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
            I +    D G Y CKA N+ G+V     L V V
Sbjct: 4521 ILRTQVVDCGEYTCKASNEYGSVSCTATLTVTV 4553



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 3/96 (3%)

Query: 1029 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN-QGVCTLE 1087
            P F + L       G  A    +V G P P +TW K    +     Y +  N  G  T  
Sbjct: 3700 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3759

Query: 1088 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1123
            +  P   D G Y CKA N LG  E  C  E+ V+ +
Sbjct: 3760 VNDPQREDSGLYICKAENMLG--ESTCAAELLVLLE 3793



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 914   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH--YHRTS 971
             P  P    + +V  ++  +TW  P D G   IT Y ++K +  S  W  V +   +  T 
Sbjct: 10640 PDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETMSKRWARVTKDPIHPYTK 10698

Query: 972   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1011
               + +L+ G +Y FRV +EN  G+ + +  +K   V A+D
Sbjct: 10699 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK--PVFAKD 10736



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 120/582 (20%), Positives = 208/582 (35%), Gaps = 92/582 (15%)

Query: 316  MTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDA-NVKW 374
            MTD S     AG  + +   F+ +P  +V K +E      G  V   C+V  +   +V W
Sbjct: 1018 MTDTSLTEEQAGPGEPAAPYFITKP--VVQKLVE------GGSVVFGCQVGGNPKPHVYW 1069

Query: 375  FKNGEEIIPGPKSRYRIRVEGKKHI----LIIEGATKADAAEYSVMTTG--GQSSAKLSV 428
             K+G  +  G    YR +V   K      L+I      DA EY+++     G++SA  S+
Sbjct: 1070 KKSGVPLTTG----YRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125

Query: 429  DLKPLKILTPLTDQTVNLGKEICL---KCEISENIPGKWTKNGLPVQESDRLKVVHKGRI 485
              +    L   + Q +    ++     + ++ E  PG +  +    +      ++ K   
Sbjct: 1126 LEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPG-FVYSEYEKEYEKEQALIRKKMA 1184

Query: 486  HKLVIANALTEDEGDYVFAPDA----------YNVTLPAKVHVIDPPKIILD-------- 527
               V+     ED+  ++ + +              TL   +      K+ +D        
Sbjct: 1185 KDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVE 1244

Query: 528  -GLDAD-NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STL 584
             G D+      ++ G  +     +SG P PK  W +  K I  G  R + +   D  ++L
Sbjct: 1245 SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE-RYQMDFLQDGRASL 1303

Query: 585  VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPA 644
             I +   +D G+Y     N  G A  S K+ V      P AP    +G    I   EP  
Sbjct: 1304 RIPVVLPEDEGIYTAFASNIKGNAICSGKLYV-----EPAAP----LGAPTYIPTLEP-- 1352

Query: 645  YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
                       + R +  S R +  +          P +M        R+     +  + 
Sbjct: 1353 -----------VSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETD 1401

Query: 705  PSMPSRPFVPLAVTSPPTLLTVDSVT---DTTVTMRWRPPD---HIGAAGLDGYVLEYCF 758
             S   R + P+ V  P +   ++  T   D  V  R  P     H G   ++ Y  +   
Sbjct: 1402 ESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVI 1461

Query: 759  --EGTEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 816
              +GT+  I+      D  ++T+              A N AG S     S  + V+ + 
Sbjct: 1462 KEDGTQSLIIVPATPSDSGEWTVV-------------AQNRAGRSS---ISVILTVEAVE 1505

Query: 817  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 858
               K      LK   I+  G  + + +   G P P++ W K+
Sbjct: 1506 HQVKPMFVEKLKNVNIKE-GSRLEMKVRATGNPNPDIVWLKN 1546



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 62/284 (21%), Positives = 105/284 (36%), Gaps = 51/284 (17%)

Query: 851  PELT--WKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDL----QVKVDK-FVE 902
            P++T  W KD  E+   ++I I+  +    + I     S +GKY +     V   K FVE
Sbjct: 3038 PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3097

Query: 903  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA------AITGYTIQKADKK 956
               + I+ I +       +++ +  +   + +   +DD +A          + +Q+  K 
Sbjct: 3098 GRDVRIRSIKK-------EVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK- 3149

Query: 957  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1016
                + V    HR   + T      EY F V   N   ++                 +Y 
Sbjct: 3150 ----YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVT-----------------LYV 3187

Query: 1017 NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1076
            N         E P   Q L      +G  A     + G P+PKI+W K +  +    + +
Sbjct: 3188 NA-------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3240

Query: 1077 MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1120
               +    TL + +  P D   Y C+A ND G       L V+V
Sbjct: 3241 FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV 3284



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
           ++TV  G+++RL++ ++G P P   + R D A ++ S   +     D  +L+I  A  +D
Sbjct: 112 SMTVRQGSQVRLQVRVTGIPTPVVKFYR-DGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170

Query: 594 SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
           SG Y +N  N  G A ++ ++ V    + P   T T V
Sbjct: 171 SGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIV 208



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 64/320 (20%), Positives = 110/320 (34%), Gaps = 40/320 (12%)

Query: 315   QMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SEDDANVK 373
             Q T + +Y      E  S + F  +    +T ++      CG+       V S+  A VK
Sbjct: 25981 QKTSERKY------EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVK 26034

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT-------------KADAAEYSVM-TTG 419
             W+ NG E+    K  Y     G   + I++  T             K +A++Y+ +  TG
Sbjct: 26035 WYHNGVELQESSKIHYT-NTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG 26093

Query: 420   GQSSAKLSV---DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDR 476
             G  +   S    +  P  +   LT              E+  +   +  K+ +       
Sbjct: 26094 GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESL 26153

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                 H       + + AL E   +          TL A++            L    ++T
Sbjct: 26154 SSYEHSASAE--MKSAALEEKSLEEKSTTRKIKTTLAARI------------LTKPRSMT 26199

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
             V  G   R      GEP P   W R  + ++  S R +  +    ST  I   +  D G 
Sbjct: 26200 VYEGESARFSCDTDGEPVPTVTWLRKGQ-VLSTSARHQVTTTKYKSTFEISSVQASDEGN 26258

Query: 597   YHINLKNEAGEAHASIKVKV 616
             Y + ++N  G+  A   + +
Sbjct: 26259 YSVVVENSEGKQEAEFTLTI 26278



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 94/440 (21%), Positives = 160/440 (36%), Gaps = 71/440 (16%)

Query: 246  REEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKG 304
            ++EK+        +P  +V +G   RF   +   P+ +V WY NGQ IR S ++   + G
Sbjct: 1789 QKEKQKPDIVLYPEPV-RVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG 1847

Query: 305  CQRILFINNCQMTDDSEYYVTAG------DEKCSTELFVREP------------------ 340
                L I +C+  D  E  VTA       + K   E+  RE                   
Sbjct: 1848 I-HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH 1906

Query: 341  --------------PIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGE-----EI 381
                          P+  T+  E       ER+  E    E +     FK        E 
Sbjct: 1907 EPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEA 1966

Query: 382  IPGPKSRYRIRVEGKKHIL-------------IIEGATKADAAEYSV-MTTGGQSSAKLS 427
            I   + + R + E  + +L             + E   KA A E  + + T      +LS
Sbjct: 1967 ITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELS 2026

Query: 428  VDLKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLK-VVHKGR 484
              ++  KI   +  QTV  G +   +  +    +   +W KNG+ ++ SDR+     +  
Sbjct: 2027 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2086

Query: 485  IHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH---VIDPPKIILDGLDADNTVTVIAGN 541
            + +LVI +   ED    +    A N+      H   ++   ++I    +  + V      
Sbjct: 2087 VCELVIRDVTAEDSASIMV--KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2144

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE-SYPDSSTLVIDIAERDDSGVYHI 599
                E   S EP  K  W +    + EG   R+ ++      S L ID ++ +D     +
Sbjct: 2145 MATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2203

Query: 600  NLKNEAGEAHASIKVKVVDF 619
              +N    A   ++  VV+F
Sbjct: 2204 EDENVKTTAKLIVEGAVVEF 2223



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1041 IAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1100
            + G  A   C V G P+PK+ W  N   I    R+R+    G+  L+I     YD G   
Sbjct: 1807 LEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVK 1865

Query: 1101 CKAVNDLGTVEIECKLEVK 1119
              A N  G +E + KLE++
Sbjct: 1866 VTAENPEGVIEHKVKLEIQ 1884



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 59/286 (20%), Positives = 102/286 (35%), Gaps = 24/286 (8%)

Query: 836   GEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 894
             G+    ++  Q KP  E+ W  +G E+ + ++I+  N+     + I       SG Y  +
Sbjct: 26016 GQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY--R 26073

Query: 895   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 954
                  +   AS D   +D  G            E V  +  P      A    Y +    
Sbjct: 26074 AVCTNYKGEAS-DYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA----YAVSSFK 26128

Query: 955   KKS-MEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1013
             K S ME  + +       + +TE             E++      A+   +SA +     
Sbjct: 26129 KTSEMEASSSVRE---VKSQMTET-----------RESLSSYEHSASAEMKSAALEEKSL 26174

Query: 1014  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1073
               K+   +      A + T+P   T    G +A  +C   G P P +TW++    +    
Sbjct: 26175 EEKSTTRKIKTTLAARILTKPRSMT-VYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 26233

Query: 1074  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1119
             R+++ + +   T EI      D G Y