BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|111185922 F-box protein 36 [Homo sapiens] (188 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|111185922 F-box protein 36 [Homo sapiens] 386 e-108 gi|15812186 F-box only protein 3 isoform 1 [Homo sapiens] 39 0.003 gi|15812188 F-box only protein 3 isoform 2 [Homo sapiens] 39 0.003 gi|11545739 F-box and WD repeat domain containing 4 [Homo sapiens] 38 0.006 gi|8923179 F-box and leucine-rich repeat protein 12 [Homo sapiens] 34 0.065 gi|30089926 F-box only protein 11 isoform 1 [Homo sapiens] 34 0.085 gi|30089924 F-box only protein 11 isoform 2 [Homo sapiens] 34 0.085 gi|30089922 F-box only protein 11 isoform 3 [Homo sapiens] 34 0.085 gi|4502477 beta-transducin repeat containing protein isoform 2 [... 33 0.14 gi|16117783 beta-transducin repeat containing protein isoform 1 ... 33 0.14 gi|54112382 F-box and leucine-rich repeat protein 10 isoform a [... 32 0.25 gi|54112380 F-box and leucine-rich repeat protein 10 isoform b [... 32 0.25 gi|161333854 F-box and leucine-rich repeat protein 13 isoform 2 ... 32 0.25 gi|161333852 F-box and leucine-rich repeat protein 13 isoform 1 ... 32 0.25 gi|48928050 F-box and WD repeat domain containing 11 isoform C [... 32 0.25 gi|48928048 F-box and WD repeat domain containing 11 isoform A [... 32 0.25 gi|48928046 F-box and WD repeat domain containing 11 isoform B [... 32 0.25 gi|16306574 F-box and leucine-rich repeat protein 5 isoform 2 [H... 32 0.32 gi|16306572 F-box and leucine-rich repeat protein 5 isoform 1 [H... 32 0.32 gi|229576894 F-box and WD repeat domain containing 12 isoform 2 ... 32 0.42 gi|229576873 F-box and WD repeat domain containing 12 isoform 1 ... 32 0.42 gi|6912466 F-box and leucine-rich repeat protein 7 [Homo sapiens] 32 0.42 gi|11024696 F-box only protein 24 isoform 2 [Homo sapiens] 31 0.55 gi|16306595 S-phase kinase-associated protein 2 isoform 1 [Homo ... 31 0.72 gi|14249170 S-phase kinase-associated protein 2 isoform 2 [Homo ... 31 0.72 gi|27734755 F-box and leucine-rich repeat protein 20 [Homo sapiens] 31 0.72 gi|15812196 F-box only protein 24 isoform 1 [Homo sapiens] 31 0.72 gi|48928044 F-box only protein 8 [Homo sapiens] 30 0.94 gi|61743926 F-box and WD repeat domain containing 7 isoform 3 [H... 30 1.2 gi|16117781 F-box and WD repeat domain containing 7 isoform 1 [H... 30 1.2 >gi|111185922 F-box protein 36 [Homo sapiens] Length = 188 Score = 386 bits (992), Expect = e-108 Identities = 188/188 (100%), Positives = 188/188 (100%) Query: 1 MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHED 60 MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHED Sbjct: 1 MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHED 60 Query: 61 FLENSHLQGQTALIFGARILDYVINLCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQT 120 FLENSHLQGQTALIFGARILDYVINLCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQT Sbjct: 61 FLENSHLQGQTALIFGARILDYVINLCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQT 120 Query: 121 SHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKY 180 SHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKY Sbjct: 121 SHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGWRQLFFTNKLQLQRQLRKRKQKY 180 Query: 181 GNLREKQP 188 GNLREKQP Sbjct: 181 GNLREKQP 188 >gi|15812186 F-box only protein 3 isoform 1 [Homo sapiens] Length = 471 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/43 (41%), Positives = 24/43 (55%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQ 136 LE L D LL I+S+LD D+ C S R ++L D LW + Sbjct: 13 LESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRR 55 >gi|15812188 F-box only protein 3 isoform 2 [Homo sapiens] Length = 415 Score = 38.9 bits (89), Expect = 0.003 Identities = 18/43 (41%), Positives = 24/43 (55%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQ 136 LE L D LL I+S+LD D+ C S R ++L D LW + Sbjct: 13 LESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRR 55 >gi|11545739 F-box and WD repeat domain containing 4 [Homo sapiens] Length = 412 Score = 37.7 bits (86), Expect = 0.006 Identities = 18/51 (35%), Positives = 29/51 (56%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDT 144 L RL ++LLL I SYLD+ + RL Q + D LW +I +++ ++ Sbjct: 28 LWRLPEELLLLICSYLDMRALGRLAQVCRWLRRFTSCDLLWRRIARASLNS 78 >gi|8923179 F-box and leucine-rich repeat protein 12 [Homo sapiens] Length = 326 Score = 34.3 bits (77), Expect = 0.065 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDV 149 L L D +LL I SYL + D R+ + HR+ +L LW V T T+ P V Sbjct: 4 LVELPDSVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRH-VDLTLYTMRPKV 58 >gi|30089926 F-box only protein 11 isoform 1 [Homo sapiens] Length = 843 Score = 33.9 bits (76), Expect = 0.085 Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 95 ERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITP 147 E+L D+++L I SYL +D+ R RF++L LW+++ + P Sbjct: 73 EKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRP 125 >gi|30089924 F-box only protein 11 isoform 2 [Homo sapiens] Length = 686 Score = 33.9 bits (76), Expect = 0.085 Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 95 ERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITP 147 E+L D+++L I SYL +D+ R RF++L LW+++ + P Sbjct: 73 EKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRP 125 >gi|30089922 F-box only protein 11 isoform 3 [Homo sapiens] Length = 585 Score = 33.9 bits (76), Expect = 0.085 Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 95 ERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITP 147 E+L D+++L I SYL +D+ R RF++L LW+++ + P Sbjct: 73 EKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRP 125 >gi|4502477 beta-transducin repeat containing protein isoform 2 [Homo sapiens] Length = 569 Score = 33.1 bits (74), Expect = 0.14 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Query: 99 DDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGW 158 D + I+SYLD + + + ++ LW+++++ T + R LAE GW Sbjct: 154 DHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSL-WRGLAERRGW 212 Query: 159 RQLFFTNK 166 Q F NK Sbjct: 213 GQYLFKNK 220 >gi|16117783 beta-transducin repeat containing protein isoform 1 [Homo sapiens] Length = 605 Score = 33.1 bits (74), Expect = 0.14 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Query: 99 DDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGW 158 D + I+SYLD + + + ++ LW+++++ T + R LAE GW Sbjct: 190 DHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSL-WRGLAERRGW 248 Query: 159 RQLFFTNK 166 Q F NK Sbjct: 249 GQYLFKNK 256 >gi|54112382 F-box and leucine-rich repeat protein 10 isoform a [Homo sapiens] Length = 1336 Score = 32.3 bits (72), Expect = 0.25 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Query: 100 DLLLTIISYLDLEDIA---RLCQTSHRFAKLCMSDKLWEQIVQSTCDTITP 147 ++ + + SYL +D+ R+C+T +R+ C +LW +I + C +ITP Sbjct: 1068 EVWMAVFSYLSHQDLCVCMRVCRTWNRW---CCDKRLWTRIDLNHCKSITP 1115 >gi|54112380 F-box and leucine-rich repeat protein 10 isoform b [Homo sapiens] Length = 1265 Score = 32.3 bits (72), Expect = 0.25 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 6/51 (11%) Query: 100 DLLLTIISYLDLEDIA---RLCQTSHRFAKLCMSDKLWEQIVQSTCDTITP 147 ++ + + SYL +D+ R+C+T +R+ C +LW +I + C +ITP Sbjct: 999 EVWMAVFSYLSHQDLCVCMRVCRTWNRW---CCDKRLWTRIDLNHCKSITP 1046 >gi|161333854 F-box and leucine-rich repeat protein 13 isoform 2 [Homo sapiens] Length = 690 Score = 32.3 bits (72), Expect = 0.25 Identities = 17/63 (26%), Positives = 29/63 (46%) Query: 97 LSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDT 156 L + +L I YL L+D+ Q +H + + + LW I S+ + PD ++ Sbjct: 158 LPERAILQIFFYLSLKDVIICGQVNHAWMLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQ 217 Query: 157 GWR 159 WR Sbjct: 218 RWR 220 >gi|161333852 F-box and leucine-rich repeat protein 13 isoform 1 [Homo sapiens] Length = 735 Score = 32.3 bits (72), Expect = 0.25 Identities = 17/63 (26%), Positives = 29/63 (46%) Query: 97 LSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDT 156 L + +L I YL L+D+ Q +H + + + LW I S+ + PD ++ Sbjct: 158 LPERAILQIFFYLSLKDVIICGQVNHAWMLMTQLNSLWNAIDFSSVKNVIPDKYIVSTLQ 217 Query: 157 GWR 159 WR Sbjct: 218 RWR 220 >gi|48928050 F-box and WD repeat domain containing 11 isoform C [Homo sapiens] Length = 542 Score = 32.3 bits (72), Expect = 0.25 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Query: 99 DDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGW 158 D + I+SYLD + + ++ LW+++++ T P + L+E GW Sbjct: 129 DHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRT-DPLWKGLSERRGW 187 Query: 159 RQLFFTNK 166 Q F N+ Sbjct: 188 DQYLFKNR 195 >gi|48928048 F-box and WD repeat domain containing 11 isoform A [Homo sapiens] Length = 508 Score = 32.3 bits (72), Expect = 0.25 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Query: 99 DDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGW 158 D + I+SYLD + + ++ LW+++++ T P + L+E GW Sbjct: 95 DHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRT-DPLWKGLSERRGW 153 Query: 159 RQLFFTNK 166 Q F N+ Sbjct: 154 DQYLFKNR 161 >gi|48928046 F-box and WD repeat domain containing 11 isoform B [Homo sapiens] Length = 529 Score = 32.3 bits (72), Expect = 0.25 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Query: 99 DDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAEDTGW 158 D + I+SYLD + + ++ LW+++++ T P + L+E GW Sbjct: 116 DHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRT-DPLWKGLSERRGW 174 Query: 159 RQLFFTNK 166 Q F N+ Sbjct: 175 DQYLFKNR 182 >gi|16306574 F-box and leucine-rich repeat protein 5 isoform 2 [Homo sapiens] Length = 565 Score = 32.0 bits (71), Expect = 0.32 Identities = 12/44 (27%), Positives = 28/44 (63%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQI 137 + L +++L+I SYL+ +++ R Q S ++++L + LW+ + Sbjct: 79 ITHLPPEVMLSIFSYLNPQELCRCSQVSMKWSQLTKTGSLWKHL 122 >gi|16306572 F-box and leucine-rich repeat protein 5 isoform 1 [Homo sapiens] Length = 691 Score = 32.0 bits (71), Expect = 0.32 Identities = 12/44 (27%), Positives = 28/44 (63%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQI 137 + L +++L+I SYL+ +++ R Q S ++++L + LW+ + Sbjct: 205 ITHLPPEVMLSIFSYLNPQELCRCSQVSMKWSQLTKTGSLWKHL 248 >gi|229576894 F-box and WD repeat domain containing 12 isoform 2 [Homo sapiens] Length = 394 Score = 31.6 bits (70), Expect = 0.42 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 4/79 (5%) Query: 96 RLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAED 155 RL D L I S+LDL + ++ Q + + ++ SD LW + D + L Sbjct: 4 RLPDLALKRIFSFLDLFGLLQVSQVNKHWNRIADSDYLWRSLSLQRWDCSNFTNQHLGTH 63 Query: 156 TGWRQLFFTNKLQLQRQLR 174 T W+Q F Q +++LR Sbjct: 64 T-WKQFFLH---QRRKELR 78 >gi|229576873 F-box and WD repeat domain containing 12 isoform 1 [Homo sapiens] Length = 464 Score = 31.6 bits (70), Expect = 0.42 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 4/79 (5%) Query: 96 RLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVRALAED 155 RL D L I S+LDL + ++ Q + + ++ SD LW + D + L Sbjct: 4 RLPDLALKRIFSFLDLFGLLQVSQVNKHWNRIADSDYLWRSLSLQRWDCSNFTNQHLGTH 63 Query: 156 TGWRQLFFTNKLQLQRQLR 174 T W+Q F Q +++LR Sbjct: 64 T-WKQFFLH---QRRKELR 78 >gi|6912466 F-box and leucine-rich repeat protein 7 [Homo sapiens] Length = 491 Score = 31.6 bits (70), Expect = 0.42 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 7/69 (10%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPD----- 148 ++RL D ++ I S+L + R + R+ L +LW + ++ T +TI D Sbjct: 114 IDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLW-RTIRLTGETINVDRALKV 172 Query: 149 -VRALAEDT 156 R L +DT Sbjct: 173 LTRRLCQDT 181 >gi|11024696 F-box only protein 24 isoform 2 [Homo sapiens] Length = 318 Score = 31.2 bits (69), Expect = 0.55 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 8/76 (10%) Query: 88 KGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITP 147 KG ++ +L+ IIS+L + D+ L QT F ++C + +W +I C ++P Sbjct: 33 KGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRI----CRRLSP 88 Query: 148 DVRALAEDTGWRQLFF 163 + +D + L+F Sbjct: 89 RL----QDQDTKGLYF 100 >gi|16306595 S-phase kinase-associated protein 2 isoform 1 [Homo sapiens] Length = 424 Score = 30.8 bits (68), Expect = 0.72 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 95 ERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDV 149 + L D+LLL I S L L ++ ++ R+ +L + LW Q + T + PDV Sbjct: 98 DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW-QTLDLTGKNLHPDV 151 >gi|14249170 S-phase kinase-associated protein 2 isoform 2 [Homo sapiens] Length = 410 Score = 30.8 bits (68), Expect = 0.72 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 95 ERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDV 149 + L D+LLL I S L L ++ ++ R+ +L + LW Q + T + PDV Sbjct: 98 DSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLW-QTLDLTGKNLHPDV 151 >gi|27734755 F-box and leucine-rich repeat protein 20 [Homo sapiens] Length = 436 Score = 30.8 bits (68), Expect = 0.72 Identities = 14/43 (32%), Positives = 24/43 (55%) Query: 95 ERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQI 137 ++L +LLL I S+LD+ + R Q S + L + W++I Sbjct: 26 KKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRI 68 >gi|15812196 F-box only protein 24 isoform 1 [Homo sapiens] Length = 580 Score = 30.8 bits (68), Expect = 0.72 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Query: 88 KGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITP 147 KG ++ +L+ IIS+L + D+ L QT F ++C + +W +I C ++P Sbjct: 33 KGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRI----CRRLSP 88 >gi|48928044 F-box only protein 8 [Homo sapiens] Length = 319 Score = 30.4 bits (67), Expect = 0.94 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Query: 94 LERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQST 141 LE L +L TI+SYL+ D LC S + L + LW+ + +ST Sbjct: 71 LEMLPPELSFTILSYLNATD---LCLASCVWQDLANDELLWQGLCKST 115 >gi|61743926 F-box and WD repeat domain containing 7 isoform 3 [Homo sapiens] Length = 589 Score = 30.0 bits (66), Expect = 1.2 Identities = 13/45 (28%), Positives = 25/45 (55%) Query: 92 DFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQ 136 DF+ L +L L ++S+L+ +D+ + QT + L + LW + Sbjct: 161 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWRE 205 >gi|16117781 F-box and WD repeat domain containing 7 isoform 1 [Homo sapiens] Length = 707 Score = 30.0 bits (66), Expect = 1.2 Identities = 13/45 (28%), Positives = 25/45 (55%) Query: 92 DFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQ 136 DF+ L +L L ++S+L+ +D+ + QT + L + LW + Sbjct: 279 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWRE 323 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.322 0.137 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,476,283 Number of Sequences: 37866 Number of extensions: 292171 Number of successful extensions: 782 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 740 Number of HSP's gapped (non-prelim): 43 length of query: 188 length of database: 18,247,518 effective HSP length: 96 effective length of query: 92 effective length of database: 14,612,382 effective search space: 1344339144 effective search space used: 1344339144 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (27.3 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.