BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|94536774 serine peptidase inhibitor, Kazal type 9 [Homo sapiens] (86 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|94536774 serine peptidase inhibitor, Kazal type 9 [Homo sapiens] 187 1e-48 gi|14211875 esophagus cancer-related gene-2 [Homo sapiens] 63 6e-11 gi|68299793 serine protease inhibitor, Kazal type 6 [Homo sapiens] 52 1e-07 gi|92110017 serine PI Kazal type 5-like 3 [Homo sapiens] 51 2e-07 gi|45505132 serine protease inhibitor, Kazal type 1 precursor [H... 50 5e-07 gi|10863911 serine protease inhibitor, Kazal type 2 (acrosin-try... 49 7e-07 gi|47679099 Kazal type serine protease inhibitor 5-like 2 [Homo ... 47 4e-06 gi|189163504 serine peptidase inhibitor, Kazal type 5 isoform c ... 45 1e-05 gi|74027261 serine peptidase inhibitor, Kazal type 5 isoform b p... 45 1e-05 gi|189163501 serine peptidase inhibitor, Kazal type 5 isoform a ... 45 1e-05 gi|7657453 serine peptidase inhibitor, Kazal type 4 [Homo sapiens] 41 2e-04 gi|29568105 transmembrane protein with EGF-like and two follista... 40 4e-04 gi|12383051 transmembrane protein with EGF-like and two follista... 39 0.001 gi|122937482 serine peptidase inhibitor, Kazal type 8 (putative)... 37 0.003 gi|5453652 follistatin isoform FST317 precursor [Homo sapiens] 36 0.006 gi|7242222 follistatin isoform FST344 precursor [Homo sapiens] 36 0.006 gi|78190498 secreted modular calcium-binding protein 1 isoform 1... 36 0.007 gi|11545873 secreted modular calcium-binding protein 1 isoform 2... 36 0.007 gi|54873613 agrin [Homo sapiens] 35 0.013 gi|225637477 solute carrier organic anion transporter family, me... 34 0.028 gi|225637475 solute carrier organic anion transporter family, me... 34 0.028 gi|225637473 solute carrier organic anion transporter family, me... 34 0.028 gi|190358524 follistatin-like 5 isoform c [Homo sapiens] 33 0.048 gi|190358522 follistatin-like 5 isoform b [Homo sapiens] 33 0.048 gi|190358520 follistatin-like 5 isoform a [Homo sapiens] 33 0.048 gi|54792136 follistatin-like 4 [Homo sapiens] 33 0.063 gi|5901956 follistatin-like 1 precursor [Homo sapiens] 32 0.14 gi|19923632 Kazal-type serine peptidase inhibitor domain 1 precu... 30 0.31 gi|190194423 SPARC-like 1 [Homo sapiens] 30 0.41 gi|190341024 SPARC-like 1 [Homo sapiens] 30 0.41 >gi|94536774 serine peptidase inhibitor, Kazal type 9 [Homo sapiens] Length = 86 Score = 187 bits (476), Expect = 1e-48 Identities = 86/86 (100%), Positives = 86/86 (100%) Query: 1 MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT 60 MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT Sbjct: 1 MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT 60 Query: 61 YKNDCFFCSKVKKTDGTLKFVHFGKC 86 YKNDCFFCSKVKKTDGTLKFVHFGKC Sbjct: 61 YKNDCFFCSKVKKTDGTLKFVHFGKC 86 >gi|14211875 esophagus cancer-related gene-2 [Homo sapiens] Length = 85 Score = 62.8 bits (151), Expect = 6e-11 Identities = 34/86 (39%), Positives = 48/86 (55%), Gaps = 1/86 (1%) Query: 1 MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT 60 M+ T +LLL + S E A + + VDCS YKK P C Y P+CGSD T Sbjct: 1 MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIP-CPITYLPVCGSDYIT 59 Query: 61 YKNDCFFCSKVKKTDGTLKFVHFGKC 86 Y N+C C++ K++G ++F+H G C Sbjct: 60 YGNECHLCTESLKSNGRVQFLHDGSC 85 >gi|68299793 serine protease inhibitor, Kazal type 6 [Homo sapiens] Length = 80 Score = 52.0 bits (123), Expect = 1e-07 Identities = 31/86 (36%), Positives = 44/86 (51%), Gaps = 6/86 (6%) Query: 1 MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT 60 M+ + + LLL+L L F Q Q VDC ++ + +C +P CGSDG+T Sbjct: 1 MKLSGMFLLLSLALFC-FLTGVFSQGGQ-VDCGEFQD----PKVYCTRESNPHCGSDGQT 54 Query: 61 YKNDCFFCSKVKKTDGTLKFVHFGKC 86 Y N C FC + K+ G + H GKC Sbjct: 55 YGNKCAFCKAIVKSGGKISLKHPGKC 80 >gi|92110017 serine PI Kazal type 5-like 3 [Homo sapiens] Length = 94 Score = 51.2 bits (121), Expect = 2e-07 Identities = 20/55 (36%), Positives = 32/55 (58%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 C Y L P C ++ P+C S+G T++N+CFFC + ++ +KF +GKC Sbjct: 39 CKMYIPLDPDYNADCPNVTAPVCASNGHTFQNECFFCVEQREFHYRIKFEKYGKC 93 >gi|45505132 serine protease inhibitor, Kazal type 1 precursor [Homo sapiens] Length = 79 Score = 49.7 bits (117), Expect = 5e-07 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 7/86 (8%) Query: 1 MRATAIVLLLALTLATMFSIECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKT 60 M+ T I LL AL L ++ A + C Y +L C +YDP+CG+DG T Sbjct: 1 MKVTGIFLLSALALLSLSGNTGADSLGREAKC--YNEL-----NGCTKIYDPVCGTDGNT 53 Query: 61 YKNDCFFCSKVKKTDGTLKFVHFGKC 86 Y N+C C + +K ++ G C Sbjct: 54 YPNECVLCFENRKRQTSILIQKSGPC 79 >gi|10863911 serine protease inhibitor, Kazal type 2 (acrosin-trypsin inhibitor) [Homo sapiens] Length = 84 Score = 49.3 bits (116), Expect = 7e-07 Identities = 27/81 (33%), Positives = 42/81 (51%), Gaps = 7/81 (8%) Query: 7 VLLLALTLATMFSIECAKQTKQMV-DCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDC 65 +LLLA+T A + +K +CS Y+ PG C ++P+CGSD TY N+C Sbjct: 10 LLLLAVTFAASLIPQFGLFSKYRTPNCSQYRL--PG----CPRHFNPVCGSDMSTYANEC 63 Query: 66 FFCSKVKKTDGTLKFVHFGKC 86 C K+++ +K + G C Sbjct: 64 TLCMKIREGGHNIKIIRNGPC 84 >gi|47679099 Kazal type serine protease inhibitor 5-like 2 [Homo sapiens] Length = 97 Score = 46.6 bits (109), Expect = 4e-06 Identities = 18/41 (43%), Positives = 25/41 (60%) Query: 46 CHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 C +Y PICG++ TY N C C + K+ G ++F H GKC Sbjct: 57 CPGLYQPICGTNFITYDNPCILCVESLKSHGRIRFYHDGKC 97 >gi|189163504 serine peptidase inhibitor, Kazal type 5 isoform c precursor [Homo sapiens] Length = 916 Score = 45.1 bits (105), Expect = 1e-05 Identities = 19/57 (33%), Positives = 29/57 (50%) Query: 30 VDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 ++C +KK C Y+ +CG+DGKTY N C C++ KT + G+C Sbjct: 95 LNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGEC 151 Score = 38.5 bits (88), Expect = 0.001 Identities = 16/48 (33%), Positives = 24/48 (50%) Query: 24 KQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 K+ + C +++L + FC DP+ G DGKT+ N C C V Sbjct: 624 KREAEKETCDEFRRLLQNGKLFCTRENDPVRGPDGKTHGNKCAMCKAV 671 Score = 38.1 bits (87), Expect = 0.002 Identities = 19/48 (39%), Positives = 22/48 (45%) Query: 21 ECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 E K T CS Y+KL + C DPI G DGK + N C C Sbjct: 356 ESGKATSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMC 403 Score = 37.0 bits (84), Expect = 0.003 Identities = 16/37 (43%), Positives = 19/37 (51%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 CS Y+K + FC DPI G DGK + N C C Sbjct: 437 CSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMC 473 Score = 35.8 bits (81), Expect = 0.007 Identities = 15/51 (29%), Positives = 24/51 (47%) Query: 21 ECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 EC + CS ++ + C DP+ G DGKT+ N C C+++ Sbjct: 150 ECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL 200 Score = 35.8 bits (81), Expect = 0.007 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKK 73 C Y+K + FC DP+ G DG+ + N C C+++ K Sbjct: 225 CKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFK 266 Score = 33.5 bits (75), Expect = 0.037 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 31 DCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 +C+ Y++ + C DP+ +DGK+Y N C C Sbjct: 706 ECAEYREQMKNGRLSCTRESDPVRDADGKSYNNQCTMC 743 Score = 32.3 bits (72), Expect = 0.083 Identities = 15/37 (40%), Positives = 17/37 (45%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 CS Y+ FC DPI G DGK + N C C Sbjct: 297 CSQYQNQAKNGILFCTRENDPIRGPDGKMHGNLCSMC 333 Score = 32.3 bits (72), Expect = 0.083 Identities = 15/53 (28%), Positives = 24/53 (45%) Query: 23 AKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTD 75 AK+ CS ++ C ++P+ G DGK + N C C+ V K + Sbjct: 487 AKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLE 539 Score = 32.0 bits (71), Expect = 0.11 Identities = 12/39 (30%), Positives = 18/39 (46%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSK 70 C ++ + C DP+ G DGKT+ N C C + Sbjct: 774 CDEFRSQMKNGKLICTRESDPVRGPDGKTHGNKCTMCKE 812 Score = 31.2 bits (69), Expect = 0.18 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query: 20 IECAKQTKQMVD--CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 +E K ++ V CS Y+ + C DPI G DGK + N C C Sbjct: 553 VEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTCSMC 603 Score = 25.8 bits (55), Expect = 7.7 Identities = 9/40 (22%), Positives = 17/40 (42%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 C ++ + + C +P+ G GK + N C C + Sbjct: 849 CREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSI 888 >gi|74027261 serine peptidase inhibitor, Kazal type 5 isoform b precursor [Homo sapiens] Length = 1064 Score = 45.1 bits (105), Expect = 1e-05 Identities = 19/57 (33%), Positives = 29/57 (50%) Query: 30 VDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 ++C +KK C Y+ +CG+DGKTY N C C++ KT + G+C Sbjct: 95 LNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGEC 151 Score = 38.5 bits (88), Expect = 0.001 Identities = 16/48 (33%), Positives = 24/48 (50%) Query: 24 KQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 K+ + C +++L + FC DP+ G DGKT+ N C C V Sbjct: 624 KREAEKETCDEFRRLLQNGKLFCTRENDPVRGPDGKTHGNKCAMCKAV 671 Score = 38.5 bits (88), Expect = 0.001 Identities = 15/45 (33%), Positives = 23/45 (51%) Query: 31 DCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTD 75 +CS ++ + C DP+ G+DGK Y N C+ C V T+ Sbjct: 915 ECSEFRNYIRNNELICPRENDPVHGADGKFYTNKCYMCRAVFLTE 959 Score = 38.1 bits (87), Expect = 0.002 Identities = 19/48 (39%), Positives = 22/48 (45%) Query: 21 ECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 E K T CS Y+KL + C DPI G DGK + N C C Sbjct: 356 ESGKATSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMC 403 Score = 37.0 bits (84), Expect = 0.003 Identities = 16/37 (43%), Positives = 19/37 (51%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 CS Y+K + FC DPI G DGK + N C C Sbjct: 437 CSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMC 473 Score = 36.6 bits (83), Expect = 0.004 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSK--VKKTDGTLKFVHFGKC 86 C Y+ LP C P+CG DG+TY N C C + +++T+ ++ GKC Sbjct: 993 CKDYRVLPRIGY-LCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRST--GKC 1046 Score = 35.8 bits (81), Expect = 0.007 Identities = 15/51 (29%), Positives = 24/51 (47%) Query: 21 ECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 EC + CS ++ + C DP+ G DGKT+ N C C+++ Sbjct: 150 ECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL 200 Score = 35.8 bits (81), Expect = 0.007 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKK 73 C Y+K + FC DP+ G DG+ + N C C+++ K Sbjct: 225 CKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFK 266 Score = 33.5 bits (75), Expect = 0.037 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 31 DCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 +C+ Y++ + C DP+ +DGK+Y N C C Sbjct: 706 ECAEYREQMKNGRLSCTRESDPVRDADGKSYNNQCTMC 743 Score = 32.3 bits (72), Expect = 0.083 Identities = 15/37 (40%), Positives = 17/37 (45%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 CS Y+ FC DPI G DGK + N C C Sbjct: 297 CSQYQNQAKNGILFCTRENDPIRGPDGKMHGNLCSMC 333 Score = 32.3 bits (72), Expect = 0.083 Identities = 15/53 (28%), Positives = 24/53 (45%) Query: 23 AKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTD 75 AK+ CS ++ C ++P+ G DGK + N C C+ V K + Sbjct: 487 AKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLE 539 Score = 32.0 bits (71), Expect = 0.11 Identities = 12/39 (30%), Positives = 18/39 (46%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSK 70 C ++ + C DP+ G DGKT+ N C C + Sbjct: 774 CDEFRSQMKNGKLICTRESDPVRGPDGKTHGNKCTMCKE 812 Score = 31.2 bits (69), Expect = 0.18 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query: 20 IECAKQTKQMVD--CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 +E K ++ V CS Y+ + C DPI G DGK + N C C Sbjct: 553 VEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTCSMC 603 Score = 25.8 bits (55), Expect = 7.7 Identities = 9/40 (22%), Positives = 17/40 (42%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 C ++ + + C +P+ G GK + N C C + Sbjct: 849 CREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSI 888 >gi|189163501 serine peptidase inhibitor, Kazal type 5 isoform a precursor [Homo sapiens] Length = 1094 Score = 45.1 bits (105), Expect = 1e-05 Identities = 19/57 (33%), Positives = 29/57 (50%) Query: 30 VDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 ++C +KK C Y+ +CG+DGKTY N C C++ KT + G+C Sbjct: 95 LNCDDFKKGERDGDFICPDYYEAVCGTDGKTYDNRCALCAENAKTGSQIGVKSEGEC 151 Score = 38.5 bits (88), Expect = 0.001 Identities = 16/48 (33%), Positives = 24/48 (50%) Query: 24 KQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 K+ + C +++L + FC DP+ G DGKT+ N C C V Sbjct: 624 KREAEKETCDEFRRLLQNGKLFCTRENDPVRGPDGKTHGNKCAMCKAV 671 Score = 38.5 bits (88), Expect = 0.001 Identities = 15/45 (33%), Positives = 23/45 (51%) Query: 31 DCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTD 75 +CS ++ + C DP+ G+DGK Y N C+ C V T+ Sbjct: 945 ECSEFRNYIRNNELICPRENDPVHGADGKFYTNKCYMCRAVFLTE 989 Score = 38.1 bits (87), Expect = 0.002 Identities = 19/48 (39%), Positives = 22/48 (45%) Query: 21 ECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 E K T CS Y+KL + C DPI G DGK + N C C Sbjct: 356 ESGKATSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMC 403 Score = 37.0 bits (84), Expect = 0.003 Identities = 16/37 (43%), Positives = 19/37 (51%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 CS Y+K + FC DPI G DGK + N C C Sbjct: 437 CSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMC 473 Score = 36.6 bits (83), Expect = 0.004 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSK--VKKTDGTLKFVHFGKC 86 C Y+ LP C P+CG DG+TY N C C + +++T+ ++ GKC Sbjct: 1023 CKDYRVLPRIGY-LCPKDLKPVCGDDGQTYNNPCMLCHENLIRQTNTHIRST--GKC 1076 Score = 35.8 bits (81), Expect = 0.007 Identities = 15/51 (29%), Positives = 24/51 (47%) Query: 21 ECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 EC + CS ++ + C DP+ G DGKT+ N C C+++ Sbjct: 150 ECKSSNPEQDVCSAFRPFVRDGRLGCTRENDPVLGPDGKTHGNKCAMCAEL 200 Score = 35.8 bits (81), Expect = 0.007 Identities = 14/42 (33%), Positives = 22/42 (52%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKK 73 C Y+K + FC DP+ G DG+ + N C C+++ K Sbjct: 225 CKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFK 266 Score = 33.5 bits (75), Expect = 0.037 Identities = 12/38 (31%), Positives = 20/38 (52%) Query: 31 DCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 +C+ Y++ + C DP+ +DGK+Y N C C Sbjct: 706 ECAEYREQMKNGRLSCTRESDPVRDADGKSYNNQCTMC 743 Score = 32.3 bits (72), Expect = 0.083 Identities = 15/37 (40%), Positives = 17/37 (45%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 CS Y+ FC DPI G DGK + N C C Sbjct: 297 CSQYQNQAKNGILFCTRENDPIRGPDGKMHGNLCSMC 333 Score = 32.3 bits (72), Expect = 0.083 Identities = 15/53 (28%), Positives = 24/53 (45%) Query: 23 AKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTD 75 AK+ CS ++ C ++P+ G DGK + N C C+ V K + Sbjct: 487 AKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLE 539 Score = 32.0 bits (71), Expect = 0.11 Identities = 12/39 (30%), Positives = 18/39 (46%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSK 70 C ++ + C DP+ G DGKT+ N C C + Sbjct: 774 CDEFRSQMKNGKLICTRESDPVRGPDGKTHGNKCTMCKE 812 Score = 31.2 bits (69), Expect = 0.18 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Query: 20 IECAKQTKQMVD--CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFC 68 +E K ++ V CS Y+ + C DPI G DGK + N C C Sbjct: 553 VEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTCSMC 603 Score = 25.8 bits (55), Expect = 7.7 Identities = 9/40 (22%), Positives = 17/40 (42%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKV 71 C ++ + + C +P+ G GK + N C C + Sbjct: 849 CREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSI 888 >gi|7657453 serine peptidase inhibitor, Kazal type 4 [Homo sapiens] Length = 86 Score = 40.8 bits (94), Expect = 2e-04 Identities = 27/89 (30%), Positives = 38/89 (42%), Gaps = 8/89 (8%) Query: 1 MRATAIVLLLALTLATMFSIECAKQT---KQMVDCSHYKKLPPGQQRFCHHMYDPICGSD 57 +R I L LA L + A +M C H + P C M + +CG+D Sbjct: 3 VRQWVIALALAALLVVDREVPVAAGKLPFSRMPICEHMVESPT-----CSQMSNLVCGTD 57 Query: 58 GKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 G TY N+C C KT ++ + GKC Sbjct: 58 GLTYTNECQLCLARIKTKQDIQIMKDGKC 86 >gi|29568105 transmembrane protein with EGF-like and two follistatin-like domains 1 [Homo sapiens] Length = 380 Score = 40.0 bits (92), Expect = 4e-04 Identities = 16/41 (39%), Positives = 22/41 (53%) Query: 46 CHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 CH Y P+CGS+G TY+N+CF K + + G C Sbjct: 103 CHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIARGPC 143 Score = 33.9 bits (76), Expect = 0.028 Identities = 21/78 (26%), Positives = 32/78 (41%), Gaps = 26/78 (33%) Query: 18 FSIECAKQTKQM-----VDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFF----C 68 + EC + + + +DCS Y ++P+C SDG +Y N CF C Sbjct: 175 YKAECDEDAENVGCVCNIDCSGYS-------------FNPVCASDGSSYNNPCFVREASC 221 Query: 69 SKVKKTDGTLKFVHFGKC 86 K ++ D H G C Sbjct: 222 IKQEQID----IRHLGHC 235 >gi|12383051 transmembrane protein with EGF-like and two follistatin-like domains 2 [Homo sapiens] Length = 374 Score = 38.5 bits (88), Expect = 0.001 Identities = 14/41 (34%), Positives = 24/41 (58%) Query: 46 CHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 C++ Y P+CGS+G++Y+N+C+ K + V G C Sbjct: 95 CNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSC 135 Score = 30.4 bits (67), Expect = 0.31 Identities = 11/37 (29%), Positives = 20/37 (54%) Query: 50 YDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 ++P+C SDGK+Y N C + ++ + G+C Sbjct: 191 FNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRC 227 >gi|122937482 serine peptidase inhibitor, Kazal type 8 (putative) [Homo sapiens] Length = 97 Score = 37.4 bits (85), Expect = 0.003 Identities = 15/36 (41%), Positives = 22/36 (61%) Query: 51 DPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 +PICGSD TY +DC CSK+ + ++ G+C Sbjct: 59 EPICGSDQVTYSSDCHLCSKILFEGLNITKLYDGQC 94 >gi|5453652 follistatin isoform FST317 precursor [Homo sapiens] Length = 317 Score = 36.2 bits (82), Expect = 0.006 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 10/73 (13%) Query: 24 KQTKQMVDCSHYKKLPPGQQRF--------CHHMY--DPICGSDGKTYKNDCFFCSKVKK 73 K+T + VDC KK ++ C ++ P+CG DGKTY+N+C K Sbjct: 92 KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCK 151 Query: 74 TDGTLKFVHFGKC 86 L+ + G+C Sbjct: 152 EQPELEVQYQGRC 164 Score = 28.9 bits (63), Expect = 0.91 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 51 DPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 +P+C SD TY ++C + L+ H G C Sbjct: 281 EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316 >gi|7242222 follistatin isoform FST344 precursor [Homo sapiens] Length = 344 Score = 36.2 bits (82), Expect = 0.006 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 10/73 (13%) Query: 24 KQTKQMVDCSHYKKLPPGQQRF--------CHHMY--DPICGSDGKTYKNDCFFCSKVKK 73 K+T + VDC KK ++ C ++ P+CG DGKTY+N+C K Sbjct: 92 KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCK 151 Query: 74 TDGTLKFVHFGKC 86 L+ + G+C Sbjct: 152 EQPELEVQYQGRC 164 Score = 28.9 bits (63), Expect = 0.91 Identities = 11/36 (30%), Positives = 17/36 (47%) Query: 51 DPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 +P+C SD TY ++C + L+ H G C Sbjct: 281 EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316 >gi|78190498 secreted modular calcium-binding protein 1 isoform 1 [Homo sapiens] Length = 435 Score = 35.8 bits (81), Expect = 0.007 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 52 PICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 PIC SDG++Y++ C + + K D TL VH G+C Sbjct: 54 PICASDGRSYESMCEY-QRAKCRDPTLGVVHRGRC 87 >gi|11545873 secreted modular calcium-binding protein 1 isoform 2 [Homo sapiens] Length = 434 Score = 35.8 bits (81), Expect = 0.007 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Query: 52 PICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 PIC SDG++Y++ C + + K D TL VH G+C Sbjct: 54 PICASDGRSYESMCEY-QRAKCRDPTLGVVHRGRC 87 >gi|54873613 agrin [Homo sapiens] Length = 2045 Score = 35.0 bits (79), Expect = 0.013 Identities = 12/20 (60%), Positives = 15/20 (75%) Query: 46 CHHMYDPICGSDGKTYKNDC 65 C +YDP+CGSDG TY + C Sbjct: 494 CSSLYDPVCGSDGVTYGSAC 513 Score = 33.1 bits (74), Expect = 0.048 Identities = 13/41 (31%), Positives = 19/41 (46%) Query: 46 CHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 C Y P+C DG+TY +DC+ + + H G C Sbjct: 421 CDGAYRPVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPC 461 Score = 32.7 bits (73), Expect = 0.063 Identities = 15/41 (36%), Positives = 19/41 (46%) Query: 46 CHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC 86 C P+CG DG TY+NDC L+ V G+C Sbjct: 349 CPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQC 389 Score = 30.8 bits (68), Expect = 0.24 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 46 CHHMYDPICGSDGKTYKNDC 65 C + P+CGSD TY N+C Sbjct: 202 CPSVVAPVCGSDASTYSNEC 221 Score = 30.4 bits (67), Expect = 0.31 Identities = 10/20 (50%), Positives = 14/20 (70%) Query: 46 CHHMYDPICGSDGKTYKNDC 65 C + P+CGSDG TY ++C Sbjct: 559 CVALAQPVCGSDGHTYPSEC 578 Score = 28.5 bits (62), Expect = 1.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Query: 52 PICGSDGKTYKNDC 65 P+CGSDG TY +C Sbjct: 716 PVCGSDGVTYSTEC 729 Score = 27.3 bits (59), Expect = 2.7 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 10/34 (29%) Query: 32 CSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDC 65 C + PPG P+CGSDG TY + C Sbjct: 620 CPRCEHPPPG----------PVCGSDGVTYGSAC 643 Score = 27.3 bits (59), Expect = 2.7 Identities = 9/13 (69%), Positives = 11/13 (84%) Query: 53 ICGSDGKTYKNDC 65 +CGSDG TY N+C Sbjct: 936 VCGSDGVTYGNEC 948 >gi|225637477 solute carrier organic anion transporter family, member 5A1 isoform 2 [Homo sapiens] Length = 687 Score = 33.9 bits (76), Expect = 0.028 Identities = 12/18 (66%), Positives = 14/18 (77%) Query: 48 HMYDPICGSDGKTYKNDC 65 H Y+P+CGSDG TY N C Sbjct: 564 HEYEPVCGSDGITYFNPC 581 >gi|225637475 solute carrier organic anion transporter family, member 5A1 isoform 3 [Homo sapiens] Length = 793 Score = 33.9 bits (76), Expect = 0.028 Identities = 12/18 (66%), Positives = 14/18 (77%) Query: 48 HMYDPICGSDGKTYKNDC 65 H Y+P+CGSDG TY N C Sbjct: 509 HEYEPVCGSDGITYFNPC 526 >gi|225637473 solute carrier organic anion transporter family, member 5A1 isoform 1 [Homo sapiens] Length = 848 Score = 33.9 bits (76), Expect = 0.028 Identities = 12/18 (66%), Positives = 14/18 (77%) Query: 48 HMYDPICGSDGKTYKNDC 65 H Y+P+CGSDG TY N C Sbjct: 564 HEYEPVCGSDGITYFNPC 581 >gi|190358524 follistatin-like 5 isoform c [Homo sapiens] Length = 837 Score = 33.1 bits (74), Expect = 0.048 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 46 CHHMYDPICGSDGKTYKNDC 65 C Y P+CGSDG+ Y+N C Sbjct: 92 CKRHYKPVCGSDGEFYENHC 111 >gi|190358522 follistatin-like 5 isoform b [Homo sapiens] Length = 846 Score = 33.1 bits (74), Expect = 0.048 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 46 CHHMYDPICGSDGKTYKNDC 65 C Y P+CGSDG+ Y+N C Sbjct: 92 CKRHYKPVCGSDGEFYENHC 111 >gi|190358520 follistatin-like 5 isoform a [Homo sapiens] Length = 847 Score = 33.1 bits (74), Expect = 0.048 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 46 CHHMYDPICGSDGKTYKNDC 65 C Y P+CGSDG+ Y+N C Sbjct: 93 CKRHYKPVCGSDGEFYENHC 112 >gi|54792136 follistatin-like 4 [Homo sapiens] Length = 842 Score = 32.7 bits (73), Expect = 0.063 Identities = 11/20 (55%), Positives = 14/20 (70%) Query: 46 CHHMYDPICGSDGKTYKNDC 65 C Y P+CGSDG+ Y+N C Sbjct: 93 CRPSYVPVCGSDGRFYENHC 112 >gi|5901956 follistatin-like 1 precursor [Homo sapiens] Length = 308 Score = 31.6 bits (70), Expect = 0.14 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 8/66 (12%) Query: 21 ECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKF 80 ECA K C ++ P ++ P+CGS+GKTY N C T ++ Sbjct: 41 ECAVTEKGEPTCLCIEQCKPHKR--------PVCGSNGKTYLNHCELHRDACLTGSKIQV 92 Query: 81 VHFGKC 86 + G C Sbjct: 93 DYDGHC 98 >gi|19923632 Kazal-type serine peptidase inhibitor domain 1 precursor [Homo sapiens] Length = 304 Score = 30.4 bits (67), Expect = 0.31 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 52 PICGSDGKTYKNDCFFCSKVK-KTDGTLKFVHFGKC 86 P+CGSDG TY C + + D L H G C Sbjct: 133 PLCGSDGHTYSQICRLQEAARARPDANLTVAHPGPC 168 >gi|190194423 SPARC-like 1 [Homo sapiens] Length = 664 Score = 30.0 bits (66), Expect = 0.41 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Query: 51 DPICGSDGKTYKNDCFFCSKVKKTDGT-----LKFVHFGKC 86 D +CG+D +TY + C + + +GT L+ +FG C Sbjct: 469 DQVCGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGAC 509 >gi|190341024 SPARC-like 1 [Homo sapiens] Length = 664 Score = 30.0 bits (66), Expect = 0.41 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 5/41 (12%) Query: 51 DPICGSDGKTYKNDCFFCSKVKKTDGT-----LKFVHFGKC 86 D +CG+D +TY + C + + +GT L+ +FG C Sbjct: 469 DQVCGTDNQTYASSCHLFATKCRLEGTKKGHQLQLDYFGAC 509 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.328 0.138 0.455 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,437,732 Number of Sequences: 37866 Number of extensions: 131900 Number of successful extensions: 534 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 12 Number of HSP's that attempted gapping in prelim test: 437 Number of HSP's gapped (non-prelim): 108 length of query: 86 length of database: 18,247,518 effective HSP length: 58 effective length of query: 28 effective length of database: 16,051,290 effective search space: 449436120 effective search space used: 449436120 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.