Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 46049119

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|46049119 myosin binding protein C, slow type isoform 3 [Homo
sapiens]
         (1141 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...  2319   0.0  
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...  2271   0.0  
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...  2258   0.0  
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...  2255   0.0  
gi|133908641 myosin binding protein C, fast type [Homo sapiens]      1158   0.0  
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]        1139   0.0  
gi|55956914 myosin binding protein H [Homo sapiens]                   448   e-125
gi|194018539 myosin binding protein H-like [Homo sapiens]             375   e-103
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     291   3e-78
gi|110349719 titin isoform N2-A [Homo sapiens]                        288   2e-77
gi|110349717 titin isoform novex-2 [Homo sapiens]                     288   2e-77
gi|110349713 titin isoform novex-1 [Homo sapiens]                     288   2e-77
gi|110349715 titin isoform N2-B [Homo sapiens]                        288   2e-77
gi|148839296 immunoglobulin-like and fibronectin type III domain...   239   8e-63
gi|110349721 titin isoform novex-3 [Homo sapiens]                     139   2e-32
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   129   2e-29
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   129   2e-29
gi|156104903 myomesin 2 [Homo sapiens]                                125   2e-28
gi|140560917 myomesin 1 isoform b [Homo sapiens]                      122   1e-27
gi|118572606 hemicentin 1 [Homo sapiens]                              119   2e-26
gi|144226847 obscurin-like 1 [Homo sapiens]                           116   1e-25
gi|20127422 Down syndrome cell adhesion molecule isoform CHD2-42...   111   3e-24
gi|21359935 Down syndrome cell adhesion molecule like 1 [Homo sa...   111   4e-24
gi|157785645 SPEG complex locus [Homo sapiens]                        110   8e-24
gi|19743806 roundabout 1 isoform b [Homo sapiens]                     105   3e-22
gi|4506569 roundabout 1 isoform a [Homo sapiens]                      105   3e-22
gi|140560919 myomesin 1 isoform a [Homo sapiens]                      105   3e-22
gi|224994173 roundabout 1 isoform d [Homo sapiens]                    102   2e-21
gi|224994171 roundabout 1 isoform c [Homo sapiens]                    102   2e-21
gi|239748173 PREDICTED: similar to roundabout 1 isoform 1 [Homo ...   102   2e-21

>gi|46049119 myosin binding protein C, slow type isoform 3 [Homo
            sapiens]
          Length = 1141

 Score = 2319 bits (6009), Expect = 0.0
 Identities = 1141/1141 (100%), Positives = 1141/1141 (100%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60

Query: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120
            IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS
Sbjct: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120

Query: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180
            RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE
Sbjct: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180

Query: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240
            GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR
Sbjct: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240

Query: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300
            LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF
Sbjct: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300

Query: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
            EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE
Sbjct: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360

Query: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
            LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG
Sbjct: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420

Query: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480
            QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV
Sbjct: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480

Query: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540
            HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG
Sbjct: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540

Query: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600
            NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN
Sbjct: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600

Query: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660
            LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK
Sbjct: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660

Query: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
            KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP
Sbjct: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720

Query: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE 780
            PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE
Sbjct: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE 780

Query: 781  DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR 840
            DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR
Sbjct: 781  DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR 840

Query: 841  IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK 900
            IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK
Sbjct: 841  IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK 900

Query: 901  AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN 960
            AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN
Sbjct: 901  AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN 960

Query: 961  AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT 1020
            AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT
Sbjct: 961  AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT 1020

Query: 1021 KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1080
            KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW
Sbjct: 1021 KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1080

Query: 1081 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA 1140
            MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA
Sbjct: 1081 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA 1140

Query: 1141 Q 1141
            Q
Sbjct: 1141 Q 1141


>gi|46049110 myosin binding protein C, slow type isoform 4 [Homo
            sapiens]
          Length = 1123

 Score = 2271 bits (5886), Expect = 0.0
 Identities = 1122/1141 (98%), Positives = 1123/1141 (98%), Gaps = 18/1141 (1%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF 60

Query: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120
            IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS
Sbjct: 61   IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS 120

Query: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180
            RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE
Sbjct: 121  RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE 180

Query: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240
            GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR
Sbjct: 181  GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240

Query: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300
            LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF
Sbjct: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300

Query: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
            EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE
Sbjct: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360

Query: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
            LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG
Sbjct: 361  LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420

Query: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480
            QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV
Sbjct: 421  QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV 480

Query: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540
            HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG
Sbjct: 481  HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540

Query: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600
            NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN
Sbjct: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600

Query: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660
            LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK
Sbjct: 601  LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK 660

Query: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
            KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP
Sbjct: 661  KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720

Query: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE 780
            PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG+                  E
Sbjct: 721  PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGT------------------E 762

Query: 781  DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR 840
            DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR
Sbjct: 763  DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR 822

Query: 841  IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK 900
            IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK
Sbjct: 823  IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK 882

Query: 901  AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN 960
            AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN
Sbjct: 883  AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN 942

Query: 961  AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT 1020
            AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT
Sbjct: 943  AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT 1002

Query: 1021 KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1080
            KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW
Sbjct: 1003 KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1062

Query: 1081 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA 1140
            MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA
Sbjct: 1063 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA 1122

Query: 1141 Q 1141
            Q
Sbjct: 1123 Q 1123


>gi|46049125 myosin binding protein C, slow type isoform 2 [Homo
            sapiens]
          Length = 1148

 Score = 2258 bits (5850), Expect = 0.0
 Identities = 1122/1166 (96%), Positives = 1123/1166 (96%), Gaps = 43/1166 (3%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD------------------------- 35
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD                         
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSD 60

Query: 36   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 95
            WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF
Sbjct: 61   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 120

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF
Sbjct: 121  KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 180

Query: 156  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 215
            DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK
Sbjct: 181  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 240

Query: 216  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 275
            NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE
Sbjct: 241  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 300

Query: 276  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
            LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL
Sbjct: 301  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 360

Query: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG
Sbjct: 361  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 420

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
            KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE
Sbjct: 421  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 480

Query: 456  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 515
            ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK
Sbjct: 481  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 540

Query: 516  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 575
            VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT
Sbjct: 541  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 600

Query: 576  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
            ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW
Sbjct: 601  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 660

Query: 636  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
            CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF
Sbjct: 661  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 720

Query: 696  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
            AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE
Sbjct: 721  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 780

Query: 756  YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
            YCFEG+                  EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA
Sbjct: 781  YCFEGT------------------EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 822

Query: 816  AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 875
            AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK
Sbjct: 823  AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 882

Query: 876  DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 935
            DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP
Sbjct: 883  DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 942

Query: 936  QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 995
            QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL
Sbjct: 943  QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 1002

Query: 996  VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1055
            VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN
Sbjct: 1003 VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1062

Query: 1056 TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1115
            TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG
Sbjct: 1063 TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1122

Query: 1116 TYCCKAVNDLGTVEIECKLEVKVIAQ 1141
            TYCCKAVNDLGTVEIECKLEVKVIAQ
Sbjct: 1123 TYCCKAVNDLGTVEIECKLEVKVIAQ 1148


>gi|45976288 myosin binding protein C, slow type isoform 1 [Homo
            sapiens]
          Length = 1171

 Score = 2255 bits (5844), Expect = 0.0
 Identities = 1121/1166 (96%), Positives = 1122/1166 (96%), Gaps = 43/1166 (3%)

Query: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD------------------------- 35
            MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKD                         
Sbjct: 1    MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDEEEVSPPSALPPGLGSRALERKDSD 60

Query: 36   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 95
            WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF
Sbjct: 61   WTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWF 120

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF
Sbjct: 121  KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 180

Query: 156  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 215
            DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK
Sbjct: 181  DLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLK 240

Query: 216  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 275
            NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE
Sbjct: 241  NAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVE 300

Query: 276  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
            LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL
Sbjct: 301  LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 360

Query: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG
Sbjct: 361  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 420

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
            KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE
Sbjct: 421  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 480

Query: 456  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 515
            ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK
Sbjct: 481  ISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK 540

Query: 516  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 575
            VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT
Sbjct: 541  VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT 600

Query: 576  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
            ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW
Sbjct: 601  ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 660

Query: 636  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
            CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF
Sbjct: 661  CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 720

Query: 696  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
            AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE
Sbjct: 721  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 780

Query: 756  YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
            YCFEG+                  EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA
Sbjct: 781  YCFEGT------------------EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 822

Query: 816  AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 875
            AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK
Sbjct: 823  AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 882

Query: 876  DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 935
            DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP
Sbjct: 883  DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 942

Query: 936  QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 995
            QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL
Sbjct: 943  QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 1002

Query: 996  VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1055
            VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN
Sbjct: 1003 VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1062

Query: 1056 TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1115
            TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG
Sbjct: 1063 TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1122

Query: 1116 TYCCKAVNDLGTVEIECKLEVKVIAQ 1141
            TYCCKAVNDLGTVEIECKLEVKVI Q
Sbjct: 1123 TYCCKAVNDLGTVEIECKLEVKVIYQ 1148


>gi|133908641 myosin binding protein C, fast type [Homo sapiens]
          Length = 1141

 Score = 1158 bits (2996), Expect = 0.0
 Identities = 572/1153 (49%), Positives = 782/1153 (67%), Gaps = 62/1153 (5%)

Query: 13   PAPAPPPEEPSKE-KEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKV 71
            P  APP E P++  KEA   P +D    ++P  EE            +F++KP   +V+ 
Sbjct: 22   PKEAPPKEAPAEAPKEA---PPED----QSPTAEEPTG---------VFLKKPDSVSVET 65

Query: 72   GEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
            G+D   +AKV  ++L  KPTIKWFKGKW++L SK+G     KE+    S VYT E+ I K
Sbjct: 66   GKDAVVVAKVNGKELPDKPTIKWFKGKWLELGSKSGARFSFKESHNSASNVYTVELHIGK 125

Query: 132  AKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQED-AGELDF 190
                  G YR EV  KD  DSC F+++V           + S FKR+ E + D AGELDF
Sbjct: 126  VVLGDRGYYRLEVKAKDTCDSCGFNIDVEAPRQDASGQSLES-FKRTSEKKSDTAGELDF 184

Query: 191  SGLLKRREVKQQEEEPQV----------DVWELLKNAKPSEYEKIAFQYGITDLRGMLKR 240
            SGLLK+REV ++E++ +           ++WELLK AK SEYEKIAFQYGITDLRGMLKR
Sbjct: 185  SGLLKKREVVEEEKKKKKKDDDDLGIPPEIWELLKGAKKSEYEKIAFQYGITDLRGMLKR 244

Query: 241  LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF 300
            LK+ + E KKSAAF K LDPAYQVD+G +++ +VE++DP L +KW+KNGQEI+PS+KY+F
Sbjct: 245  LKKAKVEVKKSAAFTKKLDPAYQVDRGNKIKLMVEISDPDLTLKWFKNGQEIKPSSKYVF 304

Query: 301  EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
            E+ G +RIL IN C + DD+ Y V   DEKC TELFV+EPP+++   LED   + G+RVE
Sbjct: 305  ENVGKKRILTINKCTLADDAAYEVAVKDEKCFTELFVKEPPVLIVTPLEDQQVFVGDRVE 364

Query: 361  LECEVSEDDANVKWFKNGEEIIPGP--KSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
            +  EVSE+ A V W K+G E+      K+RYR + +GK+HILI     + D   Y V+T 
Sbjct: 365  MAVEVSEEGAQVMWMKDGVELTREDSFKARYRFKKDGKRHILIFSDVVQEDRGRYQVITN 424

Query: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
            GGQ  A+L V+ K L++L  + D TV   ++   KCE+S E + GKW KNG+ V+ S R+
Sbjct: 425  GGQCEAELIVEEKQLEVLQDIADLTVKASEQAVFKCEVSDEKVTGKWYKNGVEVRPSKRI 484

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVID----------PPKIILD 527
             + H GR HKLVI +   EDEGDY F PD Y ++L AK++ ++          PPKI LD
Sbjct: 485  TISHVGRFHKLVIDDVRPEDEGDYTFVPDGYALSLSAKLNFLEIKVEYVPKQEPPKIHLD 544

Query: 528  --GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLV 585
              G  ++N + V+AGNKLRL++ I+GEPPP A W +GD+      GR R E   D S+ V
Sbjct: 545  CSGKTSENAIVVVAGNKLRLDVSITGEPPPVATWLKGDEVFTTTEGRTRIEKRVDCSSFV 604

Query: 586  IDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAY 645
            I+ A+R+D G Y I + N  GE  ASI ++VVD PDPP A  +T VG+DW I+ WEPP Y
Sbjct: 605  IESAQREDEGRYTIKVTNPVGEDVASIFLQVVDVPDPPEAVRITSVGEDWAILVWEPPMY 664

Query: 646  DGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKP 705
            DGG P+ GY +ERKKK S RWM+LNF++  ETT+E  KMIEG+ YE+R+FAVNAIG+S+P
Sbjct: 665  DGGKPVTGYLVERKKKGSQRWMKLNFEVFTETTYESTKMIEGILYEMRVFAVNAIGVSQP 724

Query: 706  SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
            SM ++PF+P+A TS P  L V+ VTDTT T++WRPP+ IGA G+DGY++EYC EGS    
Sbjct: 725  SMNTKPFMPIAPTSEPLHLIVEDVTDTTTTLKWRPPNRIGAGGIDGYLVEYCLEGS---- 780

Query: 766  QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
                          E+W+ AN + +++  FT+  LPT A+I  RV  VN AG SEP   +
Sbjct: 781  --------------EEWVPANTEPVERCGFTVKNLPTGARILFRVVGVNIAGRSEPATLA 826

Query: 826  QPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQI 885
            QP+ ++EI EPPKIR+PRHL+QTYIR+VGE +NLV+PFQGKPRP++ W K GA +D +++
Sbjct: 827  QPVTIREIAEPPKIRLPRHLRQTYIRKVGEQLNLVVPFQGKPRPQVVWTKGGAPLDTSRV 886

Query: 886  NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWG 945
            ++R S+ DT+ F+R+A RS SG+Y+L V+++   +TA+I I+++++ GPP  V +++VWG
Sbjct: 887  HVRTSDFDTVFFVRQAARSDSGEYELSVQIENMKDTATIRIRVVEKAGPPINVMVKEVWG 946

Query: 946  ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 1005
             N  + W  PKDDGN+ I GY +QKADKK+MEWF V E    TS T+++L++GNEYYFRV
Sbjct: 947  TNALVEWQAPKDDGNSEIMGYFVQKADKKTMEWFNVYERNRHTSCTVSDLIVGNEYYFRV 1006

Query: 1006 FSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT 1065
            ++EN+CGLS+   ++K +A I + G  +K   Y++ DF  AP F  PL++   +AGY+A 
Sbjct: 1007 YTENICGLSDSPGVSKNTARILKTGITFKPFEYKEHDFRMAPKFLTPLIDRVVVAGYSAA 1066

Query: 1066 LNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDL 1125
            LNC+VRG+PKPK+ WMKNK+ I +DP++ + + QGV TL IR+PSP+D GTY C+AVN+L
Sbjct: 1067 LNCAVRGHPKPKVVWMKNKMEIREDPKFLITNYQGVLTLNIRRPSPFDAGTYTCRAVNEL 1126

Query: 1126 GTVEIECKLEVKV 1138
            G    ECKLEV+V
Sbjct: 1127 GEALAECKLEVRV 1139


>gi|148596957 myosin binding protein C, cardiac [Homo sapiens]
          Length = 1274

 Score = 1139 bits (2946), Expect = 0.0
 Identities = 583/1204 (48%), Positives = 776/1204 (64%), Gaps = 95/1204 (7%)

Query: 3    EPTKKEENEVPAPAP------PPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQN----- 51
            E  K E    PAPAP      P E P+   E G +         +P G   A  N     
Sbjct: 96   EAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGES-------APSPKGSSSAALNGPTPG 148

Query: 52   ANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQ 111
            A      LF+ +PQ G V VG  ITF A+V    LL+ P +KWFKGKW+DL+SK G+HLQ
Sbjct: 149  APDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQ 208

Query: 112  LKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDI 171
            L ++++R S+VY FE+ I  A+  F G+YRCEV+ KDKFD  +F+L VHE+ GT  ++D+
Sbjct: 209  LHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTG-DLDL 267

Query: 172  RSAFKRSG---------EGQEDAGELDFSGLLKRREV------KQQEEEPQVDVWELLKN 216
             SAF+R+          +  ED G LDFS LLK+R+        + E   + DVWE+L+ 
Sbjct: 268  LSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQ 327

Query: 217  AKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVEL 276
            A PSEYE+IAFQYG+TDLRGMLKRLK MRR+EKKS AF K L+PAYQV KG ++R  VEL
Sbjct: 328  APPSEYERIAFQYGVTDLRGMLKRLKGMRRDEKKSTAFQKKLEPAYQVSKGHKIRLTVEL 387

Query: 277  ADPKLEVKWYKNGQEIRPS-TKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
            AD   EVKW KNGQEI+ S +KYIFE  G +R L I+ C + DD+ Y    G EKCSTEL
Sbjct: 388  ADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTEL 447

Query: 336  FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            FV+EPP+++T+ LED     G+RVE ECEVSE+ A VKW K+G E+      +YR + +G
Sbjct: 448  FVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDG 507

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
            ++H LII  A   DA  Y++ T+GGQ+ A+L V  K L++   + D  V    +   KCE
Sbjct: 508  QRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEKKLEVYQSIADLMVGAKDQAVFKCE 567

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S EN+ G W KNG  +    R+KV H GR+HKL I +    DE DY F P+ +   L A
Sbjct: 568  VSDENVRGVWLKNGKELVPDSRIKVSHIGRVHKLTIDDVTPADEADYSFVPEGFACNLSA 627

Query: 515  KVHVID----------PPKIILD--GLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR- 561
            K+H ++          PPKI LD  G   D T+ V+AGNKLRL++PISG+P P  +W + 
Sbjct: 628  KLHFMEVKIDFVPRQEPPKIHLDCPGRIPD-TIVVVAGNKLRLDVPISGDPAPTVIWQKA 686

Query: 562  -------------------GD--------KAIMEGSGRIRTESYPDSSTLVIDIAERDDS 594
                               GD        K + E  GR+R E+  D S   ++ AE++D 
Sbjct: 687  ITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDE 746

Query: 595  GVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
            GVY + +KN  GE   ++ VKV+D PD P AP ++ VG+D C + WEPPAYDGG PILGY
Sbjct: 747  GVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCTVQWEPPAYDGGQPILGY 806

Query: 655  FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVP 714
             +ERKKK+S RWMRLNFDL +E + E ++MIEGV YE+R++AVNAIG+S+PS  S+PF+P
Sbjct: 807  ILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVVYEMRVYAVNAIGMSRPSPASQPFMP 866

Query: 715  LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAA 774
            +   S PT L V+ V+DTTV+++WRPP+ +GA GLDGY +EYC EG +            
Sbjct: 867  IGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGGLDGYSVEYCPEGCS------------ 914

Query: 775  YDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 834
                  +W+ A + L + T   +  LPT A++  RV+A N AG   P   ++P+ V+EI+
Sbjct: 915  ------EWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEPVTVQEIL 968

Query: 835  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT 894
            + P++++PRHL+QT  ++VGE VNL+IPFQGKPRP++TW K+G  +   +++IRNS TDT
Sbjct: 969  QRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVSIRNSPTDT 1028

Query: 895  IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTP 954
            I+FIR A R HSG Y + V+++   + A++ +Q++D+P PPQ +++ D WG NVAL W P
Sbjct: 1029 ILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGLNVALEWKP 1088

Query: 955  PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
            P+D GN  + GYT+QKADKK+MEWFTV+EHY RT   + EL+IGN YYFRVFS+NM G S
Sbjct: 1089 PQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQNMVGFS 1148

Query: 1015 EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNP 1074
            + A  TKE   I R G  Y+ P Y+  DFSEAP FTQPLVN   IAGY A L C+VRG+P
Sbjct: 1149 DRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAMLCCAVRGSP 1208

Query: 1075 KPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
            KPKI+W KN + + +D R+RMFS QGV TLEIRKP P+DGG Y C+A N  G    EC+L
Sbjct: 1209 KPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEARCECRL 1268

Query: 1135 EVKV 1138
            EV+V
Sbjct: 1269 EVRV 1272



 Score = 39.3 bits (90), Expect = 0.022
 Identities = 33/131 (25%), Positives = 51/131 (38%), Gaps = 6/131 (4%)

Query: 248 EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
           +K  +AF+K    + +V  G    F  E     ++V+W + G +I  S KY    +G + 
Sbjct: 6   KKPVSAFSK-KPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRH 64

Query: 308 ILFINNCQMTDDSEYYVTAGDEKCSTELFV-----REPPIMVTKQLEDTTAYCGERVELE 362
            L +      D   Y V AG  K   +L V      EP +       + T   GE     
Sbjct: 65  TLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPA 124

Query: 363 CEVSEDDANVK 373
            E+ E   + K
Sbjct: 125 AELGESAPSPK 135



 Score = 39.3 bits (90), Expect = 0.022
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 6/97 (6%)

Query: 338 REPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKK 397
           ++P    +K+        G     E E       V+W + G +I     ++Y +  EG +
Sbjct: 6   KKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDI--SASNKYGLATEGTR 63

Query: 398 HILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLK 434
           H L +     AD   Y+V+      S+K+  DLK ++
Sbjct: 64  HTLTVREVGPADQGSYAVIA----GSSKVKFDLKVIE 96


>gi|55956914 myosin binding protein H [Homo sapiens]
          Length = 477

 Score =  448 bits (1153), Expect = e-125
 Identities = 222/445 (49%), Positives = 294/445 (66%), Gaps = 23/445 (5%)

Query: 696  AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
            A  A   +KP+ PS       V S P LLT+D V+ ++VT+ W PP+ +G  GL GYVLE
Sbjct: 54   APTASTATKPAPPSED-----VPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLE 108

Query: 756  YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
             C EG                  A +W+  +   +  T+ T+  L    K  +RV AV++
Sbjct: 109  LCREG------------------ASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSS 150

Query: 816  AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 875
            AGA  P    QPI ++E IE PKIR+PRHL+QTYIR+VGE VNL IPFQGKP+P+ TW  
Sbjct: 151  AGAGPPAMLDQPIHIRENIEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTH 210

Query: 876  DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP 935
            +G  +D  ++++R  + D+I+FIR A+RS SG+Y+L V+V+     A IDI +I++PGPP
Sbjct: 211  NGHALDSQRVSMRTGDQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDILVIEKPGPP 270

Query: 936  QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 995
              +++ DVWG N AL WTPP+D GN  + GY +QKADKK+ +WFTV+E YH T+ TI++L
Sbjct: 271  SSIRLLDVWGCNAALQWTPPQDTGNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDL 330

Query: 996  VIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVN 1055
            +IGN Y FRVFSEN+CGLS  AT+TKE A I +     K   + + DFSEAP FTQPL +
Sbjct: 331  IIGNSYSFRVFSENLCGLSTSATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLAD 390

Query: 1056 TYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1115
              +  GY+  L CSVR +PKPKI WMKNK+ I  +P+YR  S QGVCTLEIRKPSP+D G
Sbjct: 391  HTSTPGYSTQLFCSVRASPKPKIIWMKNKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSG 450

Query: 1116 TYCCKAVNDLGTVEIECKLEVKVIA 1140
             Y CKA+N LG   ++C+LEVK  A
Sbjct: 451  VYTCKAINVLGEASVDCRLEVKASA 475



 Score = 89.7 bits (221), Expect = 1e-17
 Identities = 50/164 (30%), Positives = 84/164 (51%), Gaps = 3/164 (1%)

Query: 540 GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
           G  + L+IP  G+P P+A W+    A+   S R+   +    S L I  A+R DSG Y +
Sbjct: 189 GETVNLQIPFQGKPKPQATWTHNGHAL--DSQRVSMRTGDQDSILFIRSAQRSDSGRYEL 246

Query: 600 NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
            ++ E  EA A I + V++ P PP +  + +V      + W PP   G + +LGY +++ 
Sbjct: 247 TVRVEDLEAKAVIDILVIEKPGPPSSIRLLDVWGCNAALQWTPPQDTGNTELLGYMVQKA 306

Query: 660 KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
            K++ +W  +  +    TT     +I G +Y  R+F+ N  G+S
Sbjct: 307 DKKTGQWFTV-LERYHPTTCTISDLIIGNSYSFRVFSENLCGLS 349



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 24/94 (25%), Positives = 46/94 (48%)

Query: 618 DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET 677
           D P  P+  T+ +V      ++WEPP   G   + GY +E  ++ +S W+ ++      T
Sbjct: 69  DVPSAPLLLTLDDVSSSSVTVSWEPPERLGRLGLQGYVLELCREGASEWVPVSARPMMVT 128

Query: 678 TFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRP 711
               + +  G  + +R+ AV++ G   P+M  +P
Sbjct: 129 QQTVRNLALGDKFLLRVSAVSSAGAGPPAMLDQP 162



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 73/314 (23%), Positives = 118/314 (37%), Gaps = 45/314 (14%)

Query: 337 VREPPIMVTKQLEDT-TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
           +  P I V + L  T     GE V L+     +      W  NG  +      R  +R  
Sbjct: 169 IEAPKIRVPRHLRQTYIRQVGETVNLQIPFQGKPKPQATWTHNGHAL---DSQRVSMRTG 225

Query: 395 GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNL----GKEI 450
            +  IL I  A ++D+  Y +        AK  +D+  L I  P    ++ L    G   
Sbjct: 226 DQDSILFIRSAQRSDSGRYELTVRVEDLEAKAVIDI--LVIEKPGPPSSIRLLDVWGCNA 283

Query: 451 CLKCEISENIPGKWTKNGLPVQESDR--------LKVVHKGR--IHKLVIANALTEDEGD 500
            L+    ++  G     G  VQ++D+        L+  H     I  L+I N+ +     
Sbjct: 284 ALQWTPPQDT-GNTELLGYMVQKADKKTGQWFTVLERYHPTTCTISDLIIGNSYSFR--- 339

Query: 501 YVFAPDAYNVTLPA----------KVHVIDPPK--IILDGLDADNTVTVIA------GNK 542
            VF+ +   ++  A          K  +   PK  I  D  +A +    +A      G  
Sbjct: 340 -VFSENLCGLSTSATVTKELAHIQKADIAAKPKGFIERDFSEAPSFTQPLADHTSTPGYS 398

Query: 543 LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
            +L   +   P PK +W + +K  ++G+ + R  S     TL I      DSGVY     
Sbjct: 399 TQLFCSVRASPKPKIIWMK-NKMEIQGNPKYRALSEQGVCTLEIRKPSPFDSGVYTCKAI 457

Query: 603 NEAGEAHASIKVKV 616
           N  GEA    +++V
Sbjct: 458 NVLGEASVDCRLEV 471


>gi|194018539 myosin binding protein H-like [Homo sapiens]
          Length = 354

 Score =  375 bits (963), Expect = e-103
 Identities = 172/322 (53%), Positives = 232/322 (72%), Gaps = 4/322 (1%)

Query: 817  GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD 876
            GA  P     P L+  I E PKI +PR L+QTYIR+VG+ VNL+IPFQGKP+P+  W  D
Sbjct: 35   GAGSPT----PQLLPPIEEHPKIWLPRALRQTYIRKVGDTVNLLIPFQGKPKPQAIWTHD 90

Query: 877  GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 936
            G  +D  ++++RN E D+I+FIR+A+R+ SG+Y L+V++     TA+IDI +I+RPGPPQ
Sbjct: 91   GCALDTRRVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDILVIERPGPPQ 150

Query: 937  IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 996
             +K+ DVWG +  L WTPP+D GN A+ GYT+QKAD KS  WFTV+EHYHRTS  +++L+
Sbjct: 151  SIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLI 210

Query: 997  IGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
            IGN Y FRVF+EN CGLSE A +T + A I +   +YK   +   DFSEAP FTQPL + 
Sbjct: 211  IGNSYAFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADC 270

Query: 1057 YAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGT 1116
              + GYN  L C VR +P+PKI W+KNK+ I  +P+YR  ++ G+C+LEIRKP P+DGG 
Sbjct: 271  TTVTGYNTQLFCCVRASPRPKIIWLKNKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGI 330

Query: 1117 YCCKAVNDLGTVEIECKLEVKV 1138
            Y CKAVN LG   ++C+++VKV
Sbjct: 331  YTCKAVNPLGEASVDCRVDVKV 352



 Score = 81.3 bits (199), Expect = 5e-15
 Identities = 48/165 (29%), Positives = 84/165 (50%), Gaps = 3/165 (1%)

Query: 540 GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
           G+ + L IP  G+P P+A+W+    A+   + R+   +    S L I  A+R DSG Y +
Sbjct: 68  GDTVNLLIPFQGKPKPQAIWTHDGCAL--DTRRVSVRNGEQDSILFIREAQRADSGRYQL 125

Query: 600 NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
            ++    EA A+I + V++ P PP +  + +V      + W PP   G + +LGY +++ 
Sbjct: 126 RVQLGGLEATATIDILVIERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGYTVQKA 185

Query: 660 KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             +S  W  +  +    T+     +I G +Y  R+FA N  G+S+
Sbjct: 186 DTKSGLWFTV-LEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSE 229



 Score = 34.7 bits (78), Expect = 0.53
 Identities = 57/260 (21%), Positives = 93/260 (35%), Gaps = 38/260 (14%)

Query: 388 RYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLG 447
           R  +R   +  IL I  A +AD+  Y +    G   A  ++D+  L I  P   Q++ L 
Sbjct: 98  RVSVRNGEQDSILFIREAQRADSGRYQLRVQLGGLEATATIDI--LVIERPGPPQSIKLV 155

Query: 448 KEICLKCEISENIP---GKWTKNGLPVQESDR--------LKVVHKGR--IHKLVIANA- 493
                   +    P   G     G  VQ++D         L+  H+    +  L+I N+ 
Sbjct: 156 DVWGFSATLEWTPPQDTGNTALLGYTVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSY 215

Query: 494 -----------------LTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                            +T D      A   Y     A+    + PK      D     T
Sbjct: 216 AFRVFAENQCGLSETAPITTDLAHIQKAATVYKTKGFAQRDFSEAPKFTQPLADC----T 271

Query: 537 VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
            + G   +L   +   P PK +W + +K  ++G+ + R  ++    +L I      D G+
Sbjct: 272 TVTGYNTQLFCCVRASPRPKIIWLK-NKMDIQGNPKYRALTHLGICSLEIRKPGPFDGGI 330

Query: 597 YHINLKNEAGEAHASIKVKV 616
           Y     N  GEA    +V V
Sbjct: 331 YTCKAVNPLGEASVDCRVDV 350


>gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]
          Length = 1326

 Score =  291 bits (744), Expect = 3e-78
 Identities = 245/906 (27%), Positives = 381/906 (42%), Gaps = 64/906 (7%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +  R     EL    + ++W K+GQ +   TKY   H+G +  L I + Q++D  EY
Sbjct: 429  RVKERSRACLECELTSKDVTLRWKKDGQLLMHGTKYSMNHEGKRAELIIEDAQLSDGGEY 488

Query: 323  YVTAGDEKCSTELF------VREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFK 376
             V A  +   TE +      V E    V   + D  A  G   EL   ++++     W K
Sbjct: 489  TVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVLNDEKVEGVWLK 548

Query: 377  NGEEI--IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL- 433
            +G+EI  +PG     +I  +G  H LI          +Y+    G +S A + +   P  
Sbjct: 549  DGKEITDLPG----MQIVKQGAVHKLIFPSMGPEHEGKYTFRAKGTESEASVFIADPPTI 604

Query: 434  --KILTPLTDQ--TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHK 487
               +L  L     TV +G    +K         K  W K+G+ V E +R+ +        
Sbjct: 605  DPSVLEALAAHAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEERVSMERGEDQAL 664

Query: 488  LVIANALTEDEGDYVFA--PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
            L I+N + ED G  +     D  + T    + V+D PK     ++           K + 
Sbjct: 665  LTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLELSGSCVHMKWKA 724

Query: 546  EIPISGEPPPKAMWSR---GDKA---IMEGSGRIR---TESYPDSSTLVIDIAERDDSGV 596
                 G P  + +  R   G K+   I E  G++    T    +       I   +  GV
Sbjct: 725  PKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAYQFRILAVNSEGV 784

Query: 597  YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
                  ++  E         ++ P     P VT+V  +   + W  P  DGG+P+LGY +
Sbjct: 785  ------SDPLETEEVFAGNPIEPPGFASQPQVTDVTKEAVTITWNAPTQDGGAPVLGYIV 838

Query: 657  ERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLA 716
            ER+KK S+ W+ +N D  + T      ++E   YE R+ AVN  G  +PS+PS   V   
Sbjct: 839  ERRKKGSNLWVPVNKDPIQGTKCTVDGLLEDTEYEFRVIAVNKAGPGQPSVPSSSVVAKD 898

Query: 717  VTSPPTL---LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEA 773
               PP L   L V   +++++++ WR P         GY+LE   E +            
Sbjct: 899  PVKPPGLVQDLHVSDSSNSSISLAWREPAE--GDPPSGYILEMRAEDT------------ 944

Query: 774  AYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEI 833
                  ++W    K  I  T +T+ GL    K F R++AVN AG  EP    + +     
Sbjct: 945  ------KEWSKCTKIPISGTCYTVGGLIERQKYFFRIRAVNEAGVGEPVELDKGVRAMPP 998

Query: 834  IEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETD 893
               PK  +   LK   + R G A+ +   F G P P++ W+KDG    K +  I  S+  
Sbjct: 999  PAAPKFDLSARLKSHMVVRAGTALCIHAAFSGSPPPDVIWQKDGVP-TKGRETITKSKNH 1057

Query: 894  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWT 953
            +   I   +RS SG Y + ++ +       I +++ D P PP  +++ +     V LTW 
Sbjct: 1058 SQFLINSTKRSDSGVYRILLQNEFGEARYDIHVRVADFPRPPTNLRLFEEVPNTVTLTWN 1117

Query: 954  PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 1013
               D        Y I K D  +  W+T  E       T+T L+ G +YYFRV + N  G 
Sbjct: 1118 HSPDVQEDGEAHYIIMKRDASTATWYTAAERVFSNKYTVTGLLPGRKYYFRVVARNEIGD 1177

Query: 1014 SEDATMTKESAVIARD---GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSV 1070
            SE    ++++ +I +D       K   YE  D+  AP F  PL     + G + T+ C+ 
Sbjct: 1178 SEPLD-SRDTWLINKDQIQDLSAKLKPYEKKDWRHAPRFVTPLKPHTVLRGQDCTMTCAF 1236

Query: 1071 RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1130
             GNP+P +T  K  V I  + ++   S  GVCTL I   +  D G Y     N+LG    
Sbjct: 1237 LGNPRPTVTLYKGDVNITANSKFWYNSTSGVCTLVIPTCTLKDSGDYSVLVENELGKDRS 1296

Query: 1131 ECKLEV 1136
             C L V
Sbjct: 1297 SCTLTV 1302



 Score =  251 bits (642), Expect = 2e-66
 Identities = 230/941 (24%), Positives = 389/941 (41%), Gaps = 150/941 (15%)

Query: 20  EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSIL-----------------FIE 62
           E  S E  + TT  + ++      GEE  ++ ++S +                    F+E
Sbjct: 12  EHVSMEFSSSTTHVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGDSVPEFVE 71

Query: 63  KPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAG--------KHLQLKE 114
           KPQ  T   G+   F A+V+      KP I W +   + +   A         +H+   E
Sbjct: 72  KPQPVTAPEGDKAVFRARVQGN---AKPHISWKRESGIPIKESAKIFYDSINKEHVLKLE 128

Query: 115 TF--------------ERHSRVYTFEMQIIKAKDNFAGNY----RCEVTYKDKFDSCSFD 156
                           +    +YT  + + + ++          R     K K    + +
Sbjct: 129 PLTSDDSDNYKCIASNDHADAIYTVSLLVTEGQEKMDFKKMLKKRAPPAPKKKQKKVANE 188

Query: 157 LEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKN 216
            E+ E     P  D             + G  DF GLL  R++K+ +++ +V+   +LK 
Sbjct: 189 KEMLEILSKVPKKDFEKVCM-------EYGFTDFRGLL--RKLKEMKKKVEVEAIRILKP 239

Query: 217 AKPSEYE-----------------------------KIAFQYGITDLRGMLKR------- 240
            +  E +                             +I +  G  D++ M  +       
Sbjct: 240 LEDKETKVDTTVVFDCIMELKDPNVKMIWIKGTEPLRIQYSLGKYDVKQMGTKYMLVISN 299

Query: 241 -------LKRMRREEKKSAAFAKILDPAYQ---------VDKGGRVRFVVELADPKLEVK 284
                  +  +   +K+ +A   +LD   +         V +     F + L+  +    
Sbjct: 300 VNMNDAGIYSLSVGDKRMSAELTVLDEPLKFLGEMKPVKVTERQTAVFEIRLSKKEPNFV 359

Query: 285 WYKNGQEIRPSTKY--IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
           W  NG+E++   KY       G    L I + +++D  E+   AG+     +L +   PI
Sbjct: 360 WKFNGKELKRDDKYEITVSEDGLTHTLKIKDARLSDSGEFSAEAGNLVQKAQLTIDRIPI 419

Query: 343 MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                L++       R  LECE++  D  ++W K+G+ ++ G K  Y +  EGK+  LII
Sbjct: 420 KFVSNLKNVRVKERSRACLECELTSKDVTLRWKKDGQLLMHGTK--YSMNHEGKRAELII 477

Query: 403 EGATKADAAEYSVMT------TGGQSSAKLSVDLKPLKILTPLTDQTVNLGK--EICLKC 454
           E A  +D  EY+V+       T   S+A ++V+ +   + + ++D     G   E+C+  
Sbjct: 478 EDAQLSDGGEYTVVAMQDGDPTEYYSTAIVTVEERLATVKSGMSDVHAATGSPAELCVVL 537

Query: 455 EISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
              E + G W K+G  + +   +++V +G +HKL+  +   E EG Y F   A      A
Sbjct: 538 N-DEKVEGVWLKDGKEITDLPGMQIVKQGAVHKLIFPSMGPEHEGKYTFR--AKGTESEA 594

Query: 515 KVHVIDPPKI---ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
            V + DPP I   +L+ L A + +TV  G+   +++P  G+P PK  W +    + E   
Sbjct: 595 SVFIADPPTIDPSVLEALAA-HAITVKVGHTAHIKVPFRGKPLPKVTWYKDGMEVTEEE- 652

Query: 572 RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTE 630
           R+  E   D + L I    R+DSG+  + LKN+ G A A++ + V+D P PP       E
Sbjct: 653 RVSMERGEDQALLTISNCVREDSGLILLKLKNDHGSATATLHLSVLDRPKPPQGRVEFLE 712

Query: 631 VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAY 690
           +      M W+ P  +GG P+  + +ER+      W+++     K T F   K+ EG AY
Sbjct: 713 LSGSCVHMKWKAPKDNGGRPVTQFIVERRAVGKKSWIKIGEVDGKVTNFSTNKVEEGKAY 772

Query: 691 EVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAA 747
           + RI AVN+ G+S P      F    +  PP   +   VTD T   VT+ W  P   G A
Sbjct: 773 QFRILAVNSEGVSDPLETEEVFAGNPI-EPPGFASQPQVTDVTKEAVTITWNAPTQDGGA 831

Query: 748 GLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIF 807
            + GY++E   +GS                    W+  NKD I  TK T+ GL  D +  
Sbjct: 832 PVLGYIVERRKKGSNL------------------WVPVNKDPIQGTKCTVDGLLEDTEYE 873

Query: 808 VRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT 848
            RV AVN AG  +P   S  ++ K+ ++PP +    H+  +
Sbjct: 874 FRVIAVNKAGPGQPSVPSSSVVAKDPVKPPGLVQDLHVSDS 914



 Score = 41.6 bits (96), Expect = 0.004
 Identities = 29/95 (30%), Positives = 41/95 (43%), Gaps = 1/95 (1%)

Query: 536  TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSG 595
            TV+ G    +     G P P     +GD  I   S +    S     TLVI      DSG
Sbjct: 1223 TVLRGQDCTMTCAFLGNPRPTVTLYKGDVNITANS-KFWYNSTSGVCTLVIPTCTLKDSG 1281

Query: 596  VYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             Y + ++NE G+  +S  + V D  D  V  ++TE
Sbjct: 1282 DYSVLVENELGKDRSSCTLTVYDKDDKSVVASITE 1316



 Score = 30.8 bits (68), Expect = 7.7
 Identities = 27/124 (21%), Positives = 48/124 (38%), Gaps = 3/124 (2%)

Query: 1002 YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1061
            + + FS+    + E+    K S+++     + ++      D    P F +      A  G
Sbjct: 24   HVQTFSQTTKIVGEEVVRRKSSSIVEFFSLVTRSSNIPAGD--SVPEFVEKPQPVTAPEG 81

Query: 1062 YNATLNCSVRGNPKPKITWMKNK-VAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1120
              A     V+GN KP I+W +   + I +  +    S      L++   +  D   Y C 
Sbjct: 82   DKAVFRARVQGNAKPHISWKRESGIPIKESAKIFYDSINKEHVLKLEPLTSDDSDNYKCI 141

Query: 1121 AVND 1124
            A ND
Sbjct: 142  ASND 145


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  288 bits (738), Expect = 2e-77
 Identities = 218/774 (28%), Positives = 346/774 (44%), Gaps = 70/774 (9%)

Query: 272   FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
             F  +L+  K  VKWY+NG+EI+   KY FE  G    L I +C++ D+ EY     D K 
Sbjct: 12842 FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS 12901

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
                LFV E P+ + +  +D     G  V    E+++D   V+W +N   ++ G K  +++
Sbjct: 12902 RARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDK--HQM 12959

Query: 392   RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
               EGK H L I      D  EY  +    ++ AKL +   P KI T   D  V++GK + 
Sbjct: 12960 MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVGKPLT 13018

Query: 452   LKC--EISENIPGKWTKNGLPV----------QESDRL---KVVHKGRIHKLVIANALTE 496
             +    +       +W K   P+          Q S R+   K   KGR +K+V+ N   +
Sbjct: 13019 MVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGR-YKIVLQNKHGK 13077

Query: 497   DEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
              EG                + VID P  + +    + T T      L  E P++      
Sbjct: 13078 AEGFI-------------NLKVIDVPGPVRN---LEVTETFDGEVSLAWEEPLTDGGSKI 13121

Query: 557   AMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHAS 611
               +    + I   +  + T+        V  + +     ++ ++ +N  G     E    
Sbjct: 13122 IGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNP 13181

Query: 612   IKVKV-VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLN 670
             ++ +   D P PP+  T+T+V      + WEPP YDGG+ I  Y IE + K S RW    
Sbjct: 13182 VEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 13241

Query: 671   FDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTSPPTLLTV 726
                 ++ +     ++EG  Y  R+ A N IG+ KPS  + PFV    P+   SPP  LT 
Sbjct: 13242 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLTS 13300

Query: 727   DSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVAN 786
                T ++V ++W PP   G + + GY++E C EG                   ++WI  N
Sbjct: 13301 SDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK------------------DNWIRCN 13342

Query: 787   KDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLK 846
               L+ +  + +TGL    K   RV A N AG S+P     P+   +    P + +    K
Sbjct: 13343 MKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSA-FK 13401

Query: 847   QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSH 905
                   V   + +++P  G PRP  TW      ++  +++ ++       + I  +ERS 
Sbjct: 13402 DGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSD 13461

Query: 906   SGKYDLQVKVDKFVETAS--IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 963
              G Y L  K++  V+T S  ID+ +I RP  P+ +K  D+  ++V LTW PP DDG + +
Sbjct: 13462 KGIYTL--KLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPL 13519

Query: 964   TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 1017
             TGY ++K +     W  V++       T+ +LV G EY F+V + N CG  E A
Sbjct: 13520 TGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 13573



 Score =  278 bits (711), Expect = 2e-74
 Identities = 166/521 (31%), Positives = 269/521 (51%), Gaps = 35/521 (6%)

Query: 511   TLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             TLP  V     I+PP+I LD  D    V + A   LRL + I G P P+  W + +  + 
Sbjct: 25091 TLPGSVVAQERIEPPEIELDA-DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 25149

Query: 568   EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
             +   R + E     + LVID   R DSG Y++ L+N +G   A + V+V+D P  PV  T
Sbjct: 25150 D---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLT 25206

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             + EV  D   ++WEPP  DGG+ I  Y +E+++     +  +  + C +TTF  + + EG
Sbjct: 25207 IREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEG 25265

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
              +Y  R+ A N  GI  P+  + P        PP  +T+  VT  T T++W  P+  G +
Sbjct: 25266 CSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGS 25325

Query: 748   GLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIF 807
              + GYV+E   +GS                  E W    +  +   + TI+GL    +  
Sbjct: 25326 KITGYVVEMQTKGS------------------EKWSTCTQ--VKTLEATISGLTAGEEYV 25365

Query: 808   VRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 867
              RV AVN  G S+P+    P++ ++I   P + +P H   T+  +  E + + +PF+G+P
Sbjct: 25366 FRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFKGRP 25422

Query: 868   RPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDI 926
             +  + W+KDG  + +  ++N+ +S+T T + I++A +   G Y+L V       T  I I
Sbjct: 25423 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 25482

Query: 927   QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYH 986
              ++DRPGPP  ++I++V  +++ ++W PP+ DG   I+ Y ++K +  S  W  V +   
Sbjct: 25483 IVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVA 25542

Query: 987   RTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIA 1027
             RTS  I  L  G+EY FRV +EN  G S   + ++ SAV+A
Sbjct: 25543 RTSIKIVRLTTGSEYQFRVCAENRYGKS---SYSESSAVVA 25580



 Score =  270 bits (691), Expect = 4e-72
 Identities = 179/588 (30%), Positives = 288/588 (48%), Gaps = 53/588 (9%)

Query: 438   PLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQ------ESDRLKVVHKGRIHKLVIA 491
             P+ D    +   I  KC++S    G+WT    P        E ++L   H+       I 
Sbjct: 22861 PIYDGGCEIQGYIVEKCDVSV---GEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAIN 22917

Query: 492   NALTEDEGDYVFAPDAYNVTLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIP 548
              A   +  D           +P  + V   ++ P I LD L+    + + AG  LRL +P
Sbjct: 22918 KAGVGEHAD-----------VPGPIIVEEKLEAPDIDLD-LELRKIINIRAGGSLRLFVP 22965

Query: 549   ISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEA 608
             I G P P+  W + D  I + +    T S+   ++LV+D   R DSG Y + L+N +G  
Sbjct: 22966 IKGRPTPEVKWGKVDGEIRDAAIIDVTSSF---TSLVLDNVNRYDSGKYTLTLENSSGTK 23022

Query: 609   HASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
              A + V+V+D P PPV   VTE+  D   + WEPP  DGGS I  Y +E+++     +  
Sbjct: 23023 SAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAA 23082

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             +  + C + +++  ++ EG +Y  R+ A N  GI  P+  + P     V  PP  +TVD 
Sbjct: 23083 VVTN-CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDD 23141

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
             VT  +V++ W  P+H G + +  Y++E        AK S++  E A              
Sbjct: 23142 VTRNSVSLSWTKPEHDGGSKIIQYIVE------MQAKHSEKWSECA-------------- 23181

Query: 789   LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT 848
              +   +  IT L    +   RV AVN  G S+P+  + PI+ K+++  P +   +    +
Sbjct: 23182 RVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV---KPAFSS 23238

Query: 849   YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSG 907
             Y  +VG+ + + +P  G+P+P +TW KDG  + +  +IN+ +S   T + I++  +   G
Sbjct: 23239 YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGG 23298

Query: 908   KYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGY 966
             +Y + V      +TASI+I  +D+P PP+  VK +DV  E++ L+W PP   G   IT Y
Sbjct: 23299 QYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNY 23358

Query: 967   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
              +QK D  +  W  V     RT+  +T+L  G EY FR+F+EN  G S
Sbjct: 23359 IVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS 23406



 Score =  259 bits (662), Expect = 1e-68
 Identities = 158/580 (27%), Positives = 280/580 (48%), Gaps = 37/580 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++ P++ LD  +    + V AG   R+ IP  G P P+  WSR +    E + +++ E  
Sbjct: 24019 LEAPELDLDS-ELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEG---EFTDKVQIEKG 24074

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
              + + L ID  +R+D+G Y + L+N +G   A + VKV+D P PP    V EV  D   +
Sbjct: 24075 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFL 24134

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              WEPP  DGG+ +  Y I++++     +  ++   C +T+F+ + + EG  Y  R+ A N
Sbjct: 24135 VWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKTSFKVENLTEGAIYYFRVMAEN 24193

Query: 699   AIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
               G+  P             SPP  +T+  V+ T+ ++ W  P+H G + + GYV+E   
Sbjct: 24194 EFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 24253

Query: 759   EGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 818
             +G+                  E W +  +  +      +TGL +  +   RVKA N  G 
Sbjct: 24254 KGT------------------EKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGK 24293

Query: 819   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 878
             S+P+    P++ K++   P +++P +   TY  + GE + + IP  G+PRP ++W KDG 
Sbjct: 24294 SDPRVLGVPVIAKDLTIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGE 24350

Query: 879   EIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-Q 936
              + +  ++N+  + T T++ I++  +   GKY +         T ++ + ++++PGPP  
Sbjct: 24351 PLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVG 24410

Query: 937   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 996
              V+ ++V  + V ++W PP   G   I+ Y ++K D  +  W  V     RT+  IT+L 
Sbjct: 24411 PVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 24470

Query: 997   IGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
              G EY FR+F+EN  G S  A +  ++ ++      +K P      F  +    Q LV  
Sbjct: 24471 TGTEYQFRIFAENRYGKS--APLDSKAVIVQYP---FKEPGPPGTPFVTSISKDQMLVQW 24525

Query: 1057  YAIAGYNAT--LNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
             +       T  +   +    K  I W+K     + D +++
Sbjct: 24526 HEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 24565



 Score =  248 bits (632), Expect = 3e-65
 Identities = 149/496 (30%), Positives = 252/496 (50%), Gaps = 30/496 (6%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PP+I LD  D    VT+ A   LRL +PI G P P+  W+R     ++ +    T SY  
Sbjct: 21857 PPEIELDA-DLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSY-- 21913

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              + L++    R DSG Y + ++N +G   A + V+V+D P PP    V EV      + W
Sbjct: 21914 -TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTW 21972

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGGS I  Y +E+++     +  +  + C +T+++  ++ EG +Y  R+ A N  
Sbjct: 21973 DPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENEY 22031

Query: 701   GISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
             GI  P+  +          PP  +T+  VT  +V++ W  P+H G + + GY++E   +G
Sbjct: 22032 GIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKG 22091

Query: 761   STSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
             S                  + W  A    +  T+ TITGL    +   RV A N  G S+
Sbjct: 22092 S------------------DKW--ATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISD 22131

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
             P+  S P++ K+++ PP  ++   L  T+    GE + + +PF G+P P +TW KD   +
Sbjct: 22132 PRQLSVPVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPL 22188

Query: 881   DK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IV 938
              +  ++N  ++E ++++ I+ A R   G Y +++         ++++ ++D+PGPP   V
Sbjct: 22189 KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPV 22248

Query: 939   KIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIG 998
             K+++V  +++ L+W PPK DG ++I  Y ++K D  +  W  V     RT+     L  G
Sbjct: 22249 KMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTG 22308

Query: 999   NEYYFRVFSENMCGLS 1014
              EY FR+ +EN  G S
Sbjct: 22309 CEYQFRIAAENRYGKS 22324



 Score =  244 bits (624), Expect = 3e-64
 Identities = 156/511 (30%), Positives = 243/511 (47%), Gaps = 35/511 (6%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG--DKAIMEGSGRIRT 575
             +++PP+I LD       V V AG  +RL   + G P PK  W +   D  + +G    + 
Sbjct: 18600 ILEPPEIDLDA-SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG----QV 18654

Query: 576   ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
             +     + LVI  + RDDSG Y + L N AGE    + V+V+D P P     V++V    
Sbjct: 18655 DLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTS 18714

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++W PP  DGGS +  Y +E+++     W  +  ++ K+T+F    ++ G  Y  R+ 
Sbjct: 18715 CHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNLVPGNEYYFRVT 18773

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             AVN  G   P+   +P +   PL+   PP  L V  +T  + T+ W PP   G A +DGY
Sbjct: 18774 AVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 18833

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             +  Y  E                + PA+ W      ++      +TGL    K   RV A
Sbjct: 18834 ITSYREE----------------EQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAA 18875

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
              NA G S P+        KE + PPKI +P  +      + G+ + +     GKP P   
Sbjct: 18876 RNAVGVSLPREAEGVYEAKEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCK 18931

Query: 873   WKKDGAE-IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
             WKK   E +  + + +  +++ +I+ I+   R  SG Y L  +     +T  I + ++D 
Sbjct: 18932 WKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDA 18991

Query: 932   PGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSA 990
             PGPPQ    I D+  +  +L+W  P +DG + IT Y ++K D    +W T +    +TS 
Sbjct: 18992 PGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSC 19051

Query: 991   TITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
              + +L+ G EY FRV +EN  G+SE  T  K
Sbjct: 19052 RVGKLIPGQEYIFRVRAENRFGISEPLTSPK 19082



 Score =  244 bits (623), Expect = 3e-64
 Identities = 143/488 (29%), Positives = 242/488 (49%), Gaps = 34/488 (6%)

Query: 534   TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSS----TLVIDIA 589
             T+ V AG    + +P  G P P  +WS+ D  +       RT +Y D++    +L I+ A
Sbjct: 26195 TLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-------RTRAYVDTTDSRTSLTIENA 26247

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R+DSG Y + ++N    A  ++ VKV+D P PP   TV +V  +  +++W+ P  DGG+
Sbjct: 26248 NRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGA 26307

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y IE+++     W+ +  + C   +++   + EG  Y  R+   N  G+  P+   
Sbjct: 26308 PVKNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETK 26366

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
                      SPP  L V S++  +V++ W  P+H G + +  YV+E   +G         
Sbjct: 26367 EGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQ-------- 26418

Query: 770   NGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPIL 829
                       ++W+     +   T   ++GL  +++ F RV A N AG S+P+    P+L
Sbjct: 26419 ----------KNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVL 26466

Query: 830   VKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIR 888
             +KE +EPP+I +      T   R G  + + IP  GKP P++T  +DG  +    + N  
Sbjct: 26467 IKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTE 26526

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGEN 947
              +  +  I ++++  + +G+Y++          A I+I ++DRPGPP   V I D+  E+
Sbjct: 26527 ITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEES 26586

Query: 948   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 1007
             V L W PPK DG + +T Y + K +  +  W  V     RT   + +L  G EY FR+ +
Sbjct: 26587 VTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKA 26646

Query: 1008  ENMCGLSE 1015
             EN  G+S+
Sbjct: 26647 ENRFGISD 26654



 Score =  244 bits (622), Expect = 4e-64
 Identities = 157/500 (31%), Positives = 254/500 (50%), Gaps = 31/500 (6%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P + LD    D  V V AG  +R+   +SG+PPP   W+  ++ + + +     E+   S
Sbjct: 16522 PDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAIS 16577

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-VGDDWCIMNW 640
             S++VI   +R   GVY +  KNEAGE   +I V V+D P P   P +   + ++ C + W
Sbjct: 16578 SSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTW 16637

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGGSPI  Y IE+++     W  + + + ++     + +I+G AY  RI A N+I
Sbjct: 16638 FSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSI 16696

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+      S   V   P+ V   P  L V  VT  TVT+ W PP + G + +  YVLE  
Sbjct: 16697 GMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESR 16756

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
               G+    +                 V N +L+ + K+T+ GL        RV AVN  G
Sbjct: 16757 LIGTEKFHK-----------------VTNDNLLSR-KYTVKGLKEGDTYEYRVSAVNIVG 16798

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDG 877
               +P + ++PI  K+ + PP + +    K T   RVGEA  L   + GKP+P+++W KD 
Sbjct: 16799 QGKPSFCTKPITCKDELAPPTLHLDFRDKLTI--RVGEAFALTGRYSGKPKPKVSWFKDE 16856

Query: 878   AEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 936
             A++ + ++ +I+ +     +   KA+RS SGKY + V+           + ++DRPGPP 
Sbjct: 16857 ADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPV 16916

Query: 937   -IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 995
               V  ++V  + + ++W PP DDG + IT Y I+K +     W  V     +T+  +++L
Sbjct: 16917 GPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKL 16976

Query: 996   VIGNEYYFRVFSENMCGLSE 1015
             + G +Y FR+ +EN+ G+S+
Sbjct: 16977 LEGKDYIFRIHAENLYGISD 16996



 Score =  239 bits (611), Expect = 8e-63
 Identities = 151/488 (30%), Positives = 240/488 (49%), Gaps = 28/488 (5%)

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             D   TVT+ AG  LRL + +SG PPP   WS+    +   +    TESY   S L++D  
Sbjct: 29451 DLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY---SLLIVDKV 29507

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R D+G Y I  +N++G+  A++ VKV D P P  +  V EV  D   + WE P  DGG+
Sbjct: 29508 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 29567

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y +E K++ + R  +     C +T +    ++EG  Y  R+   N  GI +P   S
Sbjct: 29568 PVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETS 29626

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
                +   V   P  L V  VT +TVT+ W  P + G + L GYVLE C  G+        
Sbjct: 29627 DAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGT-------- 29678

Query: 770   NGEAAYDLPAEDW--IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQP 827
                       E W  +V  K  +   + T+T L    +   R++A N  G SEP+     
Sbjct: 29679 ----------ERWMKVVTLKPTV--LEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTA 29726

Query: 828   ILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQIN 886
             + V+++   P I +    ++T     G  V LVIP  G+P P  +W   G+++ +  ++ 
Sbjct: 29727 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 29786

Query: 887   IRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWG 945
             +        + IR+     +G+Y L++K      + +I + I+D+PGPP   +KI+++  
Sbjct: 29787 VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA 29846

Query: 946   ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 1005
              ++ ++W PP+ DG A ++GY +++ D     W  V E   R++   T L  GNEY FRV
Sbjct: 29847 TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRV 29906

Query: 1006  FSENMCGL 1013
              + N  G+
Sbjct: 29907 AATNRFGI 29914



 Score =  239 bits (610), Expect = 1e-62
 Identities = 152/526 (28%), Positives = 245/526 (46%), Gaps = 40/526 (7%)

Query: 508   YNVTLPAKVHVIDPPKIILDGLDADNT--------------VTVIAGNKLRLEIPISGEP 553
             Y V+   K  V DP +I L  L AD+               + VI  N + + +P +G P
Sbjct: 13364 YRVSAENKAGVSDPSEI-LGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYP 13422

Query: 554   PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
              P A W  GDK ++E   R++ ++    + LVI  +ER D G+Y + L+N        I 
Sbjct: 13423 RPTATWCFGDK-VLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEID 13481

Query: 614   VKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL 673
             V V+  P  P      ++  D   + WEPP  DGGSP+ GY +E+++     W ++  D 
Sbjct: 13482 VNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDF 13540

Query: 674   CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPF---VPLAVTSPPTLLTVDSVT 730
               +  F    +++G  Y  ++ A N  G  +P+    P     P  V  PP  +     T
Sbjct: 13541 VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRT 13600

Query: 731   DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLI 790
               ++ + W PP + G + + GY++E C  GS                  + W+   +  +
Sbjct: 13601 ANSIFLTWDPPKNDGGSRIKGYIVERCPRGS------------------DKWVACGEP-V 13641

Query: 791   DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYI 850
              +TK  +TGL        RVKA+N  GAS+P   ++ I   +  E P+I +   L     
Sbjct: 13642 AETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLT 13701

Query: 851   RRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKY 909
              + G  + L     GKP P++TW K    + ++ +I I N    + + I  ++RS +G Y
Sbjct: 13702 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 13761

Query: 910   DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
              ++        TA +++ ++D+PGPP    I DV  E+  LTW PP+DDG + IT Y ++
Sbjct: 13762 IIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVE 13821

Query: 970   KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             +    S  W  +      T+   T+L+   EY FRV +ENM G+ E
Sbjct: 13822 RRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGE 13867



 Score =  239 bits (610), Expect = 1e-62
 Identities = 138/399 (34%), Positives = 201/399 (50%), Gaps = 21/399 (5%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT V  D   ++W  P  DGGSPILGY +ERK++    W  ++  L     F
Sbjct: 21259 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIF 21318

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   + +G+AYE R+ A N  G SKPS PS P + L    PP      ++T  TVT++W 
Sbjct: 21319 KSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWA 21378

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P++ G   +  Y++E                    DLP   W+ AN   I + +FT++G
Sbjct: 21379 KPEYTGGFKITSYIVE------------------KRDLPNGRWLKANFSNILENEFTVSG 21420

Query: 800   LPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVN 858
             L  DA    RV A NAAGA S P   S  I  ++ +E PKI++    K T I + GEA  
Sbjct: 21421 LTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFR 21480

Query: 859   LVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDK 917
             L     G+P P + W KDG E++   ++ I+ ++  T +  + + R  SG Y L      
Sbjct: 21481 LEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPG 21540

Query: 918   FVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                    +++++DRPGPP+  + + +V  E   L+W PP DDG A I  Y +QK +   +
Sbjct: 21541 GFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRL 21600

Query: 977   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              W  V      T   +T+L+ GNEY FRV + N  G+ E
Sbjct: 21601 AWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGE 21639



 Score =  239 bits (610), Expect = 1e-62
 Identities = 162/609 (26%), Positives = 285/609 (46%), Gaps = 58/609 (9%)

Query: 429   DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
             D+KP       +  +V +G+++ ++  IS        WTK+GLP++++ R+ V     + 
Sbjct: 23231 DVKPA-----FSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT 23285

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPK--IILDGLDADNTVTVIA 539
              L I     +D G Y            A + ++     DPPK  +  D + A++      
Sbjct: 23286 TLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES------ 23339

Query: 540   GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT-----ESYPDSSTLVIDIAERDDS 594
                    I +S  PP      +    I++      T      +    +TL +   +    
Sbjct: 23340 -------ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTE 23392

Query: 595   GVYHINLKNEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
               + I  +N  G++ A     +V       P PP  P  T +  D  ++ W  P  +GGS
Sbjct: 23393 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 23452

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P++GY +ERK++ S  W ++N  +  +T F+ + + EG+ YE R++A N +G+ K S  S
Sbjct: 23453 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 23512

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
               +V      PP       V    +T++W  P + G + + GY++E              
Sbjct: 23513 ECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVE-------------- 23558

Query: 770   NGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPI 828
                   DLP   W+ A+   + +T+FT++GL  D +   RV A NAAGA S+P   + PI
Sbjct: 23559 ----KRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPI 23614

Query: 829   LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINI 887
               K+ +E P+I +    + T +   GE   L     GKP P + W +   EI+++ +  I
Sbjct: 23615 TAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEI 23674

Query: 888   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGE 946
             +N++   ++ ++ A R   G+Y L+       ++  ++++++DRPGPP+  V++  V  E
Sbjct: 23675 KNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSE 23734

Query: 947   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 1006
               +LTW+PP  DG + I+ Y ++K +   + W  V       S  +T+L+ GNEY FR+ 
Sbjct: 23735 KCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIM 23794

Query: 1007  SENMCGLSE 1015
             + N  G+ E
Sbjct: 23795 AVNKYGVGE 23803



 Score =  239 bits (610), Expect = 1e-62
 Identities = 171/602 (28%), Positives = 283/602 (47%), Gaps = 51/602 (8%)

Query: 436   LTPLTDQTVNL--GKEICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIA 491
             L+ +  +T+++  G+ + L   I+   P    W   G  ++ES+R+ V    ++ KL I 
Sbjct: 29740 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIR 29799

Query: 492   NALTEDEGDYVFAPDAYNVTLPA----KVHVIDPP-----KIILDGLDADNTVTVIAGNK 542
                  D G+Y    +  NVT       KV ++D P      I +D +DA +        +
Sbjct: 29800 ETTIRDTGEYTL--ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPE 29857

Query: 543   LRLEIPISG-----EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
             L    P+SG         +  W    +++   + +    +  +     +    R   G Y
Sbjct: 29858 LDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 29917

Query: 598   HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
                L++E  E  +SI++     P PP    + +V  D   + W PP  DGGS + GY +E
Sbjct: 29918 ---LQSEVIECRSSIRI-----PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVE 29969

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK+ ++ RW+R+N      T +    + EG+ YE R+ A+NA G  KPS PS+P V +  
Sbjct: 29970 RKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDP 30029

Query: 718   TSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAA 774
              +PP       VTDTT   V++ W  P+  G + + GY++E         ++ D++    
Sbjct: 30030 IAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIE--------MQKVDQH---- 30077

Query: 775   YDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 834
                   +W   N       ++T+T LP  A+   RV A NA G  EP      + V E++
Sbjct: 30078 ------EWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEML 30131

Query: 835   EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT 894
             E P   +    ++    R G  + L IP +GKP P   W K+G +I K  + I  SET T
Sbjct: 30132 EYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAM-IATSETHT 30190

Query: 895   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWT 953
              + I++A+R  SG YDL ++     +   I +++I  P  P+  ++ +D+   +V ++W 
Sbjct: 30191 ELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWR 30250

Query: 954   PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 1013
             PP DDG A I GY +++ +     W+T+      TS  +  L    EY+FRV +EN  G+
Sbjct: 30251 PPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGI 30310

Query: 1014  SE 1015
             S+
Sbjct: 30311 SK 30312



 Score =  238 bits (607), Expect = 2e-62
 Identities = 169/578 (29%), Positives = 277/578 (47%), Gaps = 44/578 (7%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH--VIDP 521
             W K+G+ ++E  R +++       L + + +  D G YV        T    V+  V+D 
Sbjct: 25823 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 25882

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + ++GL A+         +      I      K   S     I EG  ++   
Sbjct: 25883 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQM--- 25939

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEV 631
                 +S  V  + + ++  ++ +   N+   GE   S+ +K +D    P PP +  +T V
Sbjct: 25940 ----TSCKVTKLLKGNEY-IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSV 25994

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               +   + W  P  DGGS I GY IER++K S RW+R+N     +   +   + EG  YE
Sbjct: 25995 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 26054

Query: 692   VRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAG 748
              R++A NA G+S PS  S   R   P+ + SPP+   +     TT+T+ W  P   G A 
Sbjct: 26055 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 26114

Query: 749   LDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFV 808
             + GY +EY        K+SD+           DW  + + L   T++TI+GL T A+   
Sbjct: 26115 ITGYTVEY--------KKSDDT----------DWKTSIQSLRG-TEYTISGLTTGAEYVF 26155

Query: 809   RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPR 868
             RVK+VN  GAS+P   S P + KE  E P   I   +++T I + G +  + +PF+G+P 
Sbjct: 26156 RVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPV 26215

Query: 869   PELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI 928
             P + W K   ++ + +  +  +++ T + I  A R+ SGKY L ++      + ++ +++
Sbjct: 26216 PNVLWSKPDTDL-RTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKV 26274

Query: 929   IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT 988
             +D PGPP  + ++DV  E+  L+W  P++DG A +  Y I+K +     W +V  + +R 
Sbjct: 26275 LDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRL 26334

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1026
             S  +T L  G  YYFRV  EN  G+   A  TKE   I
Sbjct: 26335 SYKVTNLQEGAIYYFRVSGENEFGVGIPAE-TKEGVKI 26371



 Score =  236 bits (603), Expect = 7e-62
 Identities = 153/533 (28%), Positives = 261/533 (48%), Gaps = 43/533 (8%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP+  LD  D   T+ + AG  +RL +P+ G PPPK  WS+ +  + +  G +  +S
Sbjct: 19687 ILIPPEGELDA-DLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIG-LDIKS 19744

Query: 578   YPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCI 637
                 + L  +   + D+G Y + L+N  G+   +I VKV+D P PPV  TV E+  D   
Sbjct: 19745 TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAY 19804

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + WEPP  DGGSPI+ Y ++++  +   W  +  + C +T+F    + EG +Y  R+FA 
Sbjct: 19805 VTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAE 19863

Query: 698   NAIGISKPSMPSRPFVPLAVTSPPTL-LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             N  GI  P   +R  V  + T  P + L V SV+ ++ ++ W+ P   G + + GYV+++
Sbjct: 19864 NEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 19922

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                       ++EN           W    K L    +++   L    +   RV A N  
Sbjct: 19923 L---------TEEN----------KWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENEN 19961

Query: 817   GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK- 875
             G   P   +  ++ ++ +  P + +       Y+ +      L IP +GKP P ++WKK 
Sbjct: 19962 GEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 20019

Query: 876   DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-P 934
             +       ++++ +S  +T + +   ++S +GKY + +K     +  +I I+++ +PG P
Sbjct: 20020 EDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIP 20079

Query: 935   PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE 994
                +K ++V  E + L W PPKDDG + IT Y ++K D  + +W T      +T+  +T 
Sbjct: 20080 TGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR 20139

Query: 995   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1047
             L  G EY FRV +EN  G+ E     K   ++AR            FD  +AP
Sbjct: 20140 LHEGMEYTFRVSAENKYGVGEG---LKSEPIVAR----------HPFDVPDAP 20179



 Score =  236 bits (603), Expect = 7e-62
 Identities = 185/698 (26%), Positives = 312/698 (44%), Gaps = 80/698 (11%)

Query: 364   EVSEDDANVKWFK----NGEEII-------PGPKSRYRIRVEGKKHILIIEGATKADAAE 412
             +VS+  A++ W K     G  ++       P    ++ I  E K    ++ G +     +
Sbjct: 24223 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 24282

Query: 413   YSVMTTG--GQSSAKL--------SVDLKPLKILTPLTDQTVNLGKEICLKCEI----SE 458
             + V      G+S  ++         + ++P  +  P    ++  G+++ ++  +      
Sbjct: 24283 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQP-SLKLPFNTYSIQAGEDLKIEIPVIGRPRP 24341

Query: 459   NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKV 516
             NI   W K+G P++++ R+ V        L I     +D G Y       A   T    V
Sbjct: 24342 NI--SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSV 24399

Query: 517   HVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              V++ P      +  D + AD  V             IS EPP      +    I+E   
Sbjct: 24400 IVLEKPGPPVGPVRFDEVSADFVV-------------ISWEPPAYTGGCQISNYIVEKRD 24446

Query: 572   RIRTESYPDSSTLV---IDIAERDDSGVYHINL--KNEAGE-AHASIKVKVVDFP----D 621
                T  +  S+T+    I I +      Y   +  +N  G+ A    K  +V +P     
Sbjct: 24447 TTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPG 24506

Query: 622   PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
             PP  P VT +  D  ++ W  P  DGG+ I+GY +E+K+K S  W++LN    ++T F+ 
Sbjct: 24507 PPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKT 24566

Query: 682   KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
               + EG+ YE ++ A N +GI KPS  S  FV      PP       +T   VT++W+ P
Sbjct: 24567 TGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKP 24626

Query: 742   DHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
              + G + + GY++E                    DLP   W+ A+   + +T+FT++GL 
Sbjct: 24627 AYDGGSKITGYIVE------------------KKDLPDGRWMKASFTNVLETEFTVSGLV 24668

Query: 802   TDAKIFVRVKAVNAAG-ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
              D +   RV A NAAG  SEP   S  I  ++ I+ P   +    K   +   GE   L 
Sbjct: 24669 EDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 24728

Query: 861   IPFQGKPRPELTWKKDGAEIDKN--QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 918
                +GKP P++ W KDG E+++   ++ I+++   T + ++   R+  G+Y L++     
Sbjct: 24729 ADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 24788

Query: 919   VETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
              ++  I ++++DRPGPP+  +K+  V  E   L W PP  DG A I+ Y I+K +   + 
Sbjct: 24789 TKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLS 24848

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V       +  +T+L+ GNEY FRV + N  G+ E
Sbjct: 24849 WTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGE 24886



 Score =  234 bits (596), Expect = 5e-61
 Identities = 171/604 (28%), Positives = 285/604 (47%), Gaps = 46/604 (7%)

Query: 428   VDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             +DLK   +LT     T+ L  E  ++ +    +     K+   +  S R+K+  +    K
Sbjct: 18203 LDLKLSGVLTVKAGDTIRL--EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 18260

Query: 488   LVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
               +  A   D G YV      A +    A V+V+D P     G   +  +  ++ ++   
Sbjct: 18261 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP-----GPVRNLKIVDVSSDRCT- 18314

Query: 546   EIPISGEPPPKAMWSRGDKAIMEG--SGRIRTESYPDS----STLVIDIAERDDSGVYHI 599
                +  +PP           I+E   + R+   +Y  +     T V  + E ++  ++ +
Sbjct: 18315 ---VCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEY-IFRV 18370

Query: 600   NLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
               +N+ G     E+   I     D P  P  P VT+V  +   + W PP YDGG  I GY
Sbjct: 18371 RAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGY 18430

Query: 655   FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV- 713
             F+E+K+K S+RW+ +N     E   + + ++    Y+ R+ A N IGI +PS+PSRP V 
Sbjct: 18431 FLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVA 18490

Query: 714   --PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENG 771
               P+    PPT   V   T  ++T+ W  P + G A + GYV+E         K +D + 
Sbjct: 18491 KDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEM------RPKIADAS- 18543

Query: 772   EAAYDLPAEDWIVANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 830
                   P E W   N    + + +FT+T L  + +   RV A N  G   P    + I  
Sbjct: 18544 ------PDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKP 18597

Query: 831   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE--IDKNQINIR 888
             KEI+EPP+I +   +++  I R G  + L    +G+P P++TW+K G +  + K Q+++ 
Sbjct: 18598 KEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDL- 18656

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENV 948
               +T   + I  + R  SGKY L +      +   ++++++D PGP   +K+ DV   + 
Sbjct: 18657 -VDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSC 18715

Query: 949   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 1008
              ++W PP++DG + +T Y ++K +     W TV     +TS  +T LV GNEYYFRV + 
Sbjct: 18716 HVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAV 18775

Query: 1009  NMCG 1012
             N  G
Sbjct: 18776 NEYG 18779



 Score =  233 bits (594), Expect = 8e-61
 Identities = 202/725 (27%), Positives = 321/725 (44%), Gaps = 83/725 (11%)

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKW----FKNGEEIIP---- 383
             S  L +REP I V ++ ED        +E++ EV+++   + W    +  G EII     
Sbjct: 16705 SEALVIREP-ITVPERPED--------LEVK-EVTKNTVTLTWNPPKYDGGSEIINYVLE 16754

Query: 384   ----GPKSRYRIRVEGK-KHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTP 438
                 G +  +++  +        ++G  + D  EY V         K S   KP+     
Sbjct: 16755 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 16814

Query: 439   LTDQTVNLGKEICLKCEISE------NIPGK------WTKNGLPVQESDRLKVVHKGRIH 486
             L   T++L     L   + E         GK      W K+   V E DR  +       
Sbjct: 16815 LAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 16874

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVIDPPKIILDGLDADNTVTVIAGNK 542
              L    A   D G Y    +  N T   K    V+V+D P   +  +  D          
Sbjct: 16875 ALEKIKAKRSDSGKYCVVVE--NSTGSRKGFCQVNVVDRPGPPVGPVSFDEVT------- 16925

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR------TESYPDSSTLVIDIAERDDSGV 596
              +  + IS +PP     S+    I+E     +      T +   ++  V  + E  D  +
Sbjct: 16926 -KDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY-I 16983

Query: 597   YHINLKNEAG--EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 651
             + I+ +N  G  +   S  +K  D    PD P  P VTEV  D  ++ W  P +DGG PI
Sbjct: 16984 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPI 17042

Query: 652   LGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
               Y +E+++  S RW R+  D +   T F    ++EG  YE R+ A N IGI  PS PS+
Sbjct: 17043 TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK 17102

Query: 711   PFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQS 767
             P     P+A  SPP        T  +V + W+PP H G + + GY++EY        K  
Sbjct: 17103 PVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEY-------QKVG 17155

Query: 768   DENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQP 827
             DE    A   P         +   +TK+ +TGL        RV AVNAAG S+P +  +P
Sbjct: 17156 DEEWRRANHTP---------ESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEP 17206

Query: 828   ILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINI 887
             +LVK+ +EPP++ +  ++ +    +VG+ + L    +G P P++TWKK+  +    +  I
Sbjct: 17207 VLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAP-TKARI 17265

Query: 888   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 947
               +   + + IR A     G Y L V+     +T S+ + ++D+PGPP+ +++ ++  ++
Sbjct: 17266 DVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDS 17325

Query: 948   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 1007
               LTW  P DDG + IT Y +++ D  S +W  +     + S     L  GN+Y FRV +
Sbjct: 17326 CYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAA 17385

Query: 1008  ENMCG 1012
             EN  G
Sbjct: 17386 ENQYG 17390



 Score =  233 bits (593), Expect = 1e-60
 Identities = 172/611 (28%), Positives = 288/611 (47%), Gaps = 45/611 (7%)

Query: 241   LKRMRREEKKSAAFA-------KILDPAYQVDKGGR--VRFVVELADPKLEVKWYKNGQE 291
             L   R E  KSAA         +I++P   ++   +  V F  ++    + +KW KNG+E
Sbjct: 12713 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 12772

Query: 292   IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT 351
             +    +  +     + +L I +C   D+ EY VTAG +K   EL + E P    + LED 
Sbjct: 12773 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 12832

Query: 352   TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA 411
             T    +     C++S + ANVKW++NG EI  G K  Y+   +G  H LII+     D  
Sbjct: 12833 TVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK--YKFEKDGSIHRLIIKDCRLDDEC 12890

Query: 412   EYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLP 470
             EY+      +S A+L V+  P++I+ P  D     G ++    E++ + +  +W +N + 
Sbjct: 12891 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 12950

Query: 471   VQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD 530
             V + D+ +++ +G+IH+L I +    D+G+Y F   A +    AK+ +   PKI      
Sbjct: 12951 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI--AKDKEARAKLELAAAPKI----KT 13004

Query: 531   ADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAE 590
             AD  + V  G  L + +P    P  +A W + ++ +   +     ++  + ++  I  A+
Sbjct: 13005 ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEAK 13060

Query: 591   RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + D G Y I L+N+ G+A   I +KV+D P P     VTE  D    + WE P  DGGS 
Sbjct: 13061 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSK 13120

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE-GVAYEVRIFAVNAIGISKPSMPS 709
             I+GY +ER+  +   W+ L  D  +   F    + + GV Y  R+ A N +G  +P    
Sbjct: 13121 IIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETD 13179

Query: 710   RPFVPLA---VTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
              P    +   V  PP  +T+  V    V++ W PP++ G A +  YV+E      TS + 
Sbjct: 13180 NPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIE--LRDKTSIR- 13236

Query: 767   SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
                  + A  + AED      D+++  +++            RV+A N  G  +P   + 
Sbjct: 13237 ----WDTAMTVRAEDLSATVTDVVEGQEYSF-----------RVRAQNRIGVGKPSAATP 13281

Query: 827   PILVKEIIEPP 837
              + V + IE P
Sbjct: 13282 FVKVADPIERP 13292



 Score =  232 bits (592), Expect = 1e-60
 Identities = 158/525 (30%), Positives = 252/525 (48%), Gaps = 40/525 (7%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS---RGDKAIMEGSGRI--- 573
             + P++ +D + A + +   AG+++R+   I G P PK+ W    +  KA+ +G   I   
Sbjct: 15806 EEPEVFID-IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 15864

Query: 574   -RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVG 632
              + E+  +SS ++I   +R  +G Y I  KN+AG+  A+ +VKV+D P PP    V+++ 
Sbjct: 15865 AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDIT 15924

Query: 633   DDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEV 692
                C ++W+ P  DGG  I GY IE++      W ++N D C  TTF    ++    Y  
Sbjct: 15925 RGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFF 15983

Query: 693   RIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGL 749
             R+ A N  GI  P    +      P+    PP  L +  +T  TV + W+PP + G + +
Sbjct: 15984 RVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPV 16043

Query: 750   DGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVR 809
               Y++E      T  K+             E W   NK  +++ +FT+  L    +   R
Sbjct: 16044 THYIVECLAWDPTGTKK-------------EAWRQCNKRDVEELQFTVEDLVEGGEYEFR 16090

Query: 810   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 869
             VKAVNAAG S+P     P   +    PP I     LK+      G  VN+V   +G P P
Sbjct: 16091 VKAVNAAGVSKPSATVGPCDCQRPDMPPSI----DLKEFMEVEEGTNVNIVAKIKGVPFP 16146

Query: 870   ELTW------KKDGAE---IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
              LTW      K D  E    D +   +   +T T++ I ++ RS +G Y +    +    
Sbjct: 16147 TLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLV-IPQSRRSDTGLYTITAVNNLGTA 16205

Query: 921   TASIDIQIIDRPGPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
             +  + + ++ RPGPP   +K E V  + + L+W PPKDDG + IT Y I+K +     W 
Sbjct: 16206 SKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWV 16265

Query: 980   TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1024
              V       + TI +L+ G+EY FR+ ++N  G+ E      E+A
Sbjct: 16266 HVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETA 16310



 Score =  232 bits (591), Expect = 2e-60
 Identities = 174/651 (26%), Positives = 304/651 (46%), Gaps = 60/651 (9%)

Query: 386   KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
             K++Y+ R   +  + I   +  +D    +++         LSV +K L         TV 
Sbjct: 19259 KAQYQFRAIARTAVNISPPSEPSDPV--TILAENVPPRIDLSVAMKSLL--------TVK 19308

Query: 446   LGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              G  +CL   +  + +P   W K+G  ++ ++ +K+  +  +  L + +   +D GDY  
Sbjct: 19309 AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTI 19368

Query: 504   APDAYNVTLPA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR 561
               +  + +  A  K+ V+D P     G  A   +  +  ++  L    S EPP +   S 
Sbjct: 19369 TAENSSGSKSATIKLKVLDKP-----GPPASVKINKMYSDRAML----SWEPPLEDGGSE 19419

Query: 562   GDKAIMEGSGRIRTESYPDSSTLVI---DIAERDDSGVYHINL--KNEAGEA-----HAS 611
                 I++     R      S+T+ I    + +  +   Y   +  +N+ G         +
Sbjct: 19420 ITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPA 19479

Query: 612   IKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
             I     D P   DPPV   +T+   D   ++W+PPA DGGSPI GY +E+++ Q+  W +
Sbjct: 19480 IAKNPYDPPGRCDPPVISNITK---DHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK 19536

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLT 725
             +N     E T +   + EG  YE R+ A+N  G  KPS  S+      P     PP    
Sbjct: 19537 VNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPK 19596

Query: 726   VDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVA 785
             V   T ++V++ W  P + G + + GY++E         K++D +     +LP       
Sbjct: 19597 VYDTTRSSVSLSWGKPAYDGGSPIIGYLVE--------VKRADSDNWVRCNLPQN----- 19643

Query: 786   NKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHL 845
                 + KT+F +TGL  D +   RV AVN  G S+P         K+I+ PP+  +   L
Sbjct: 19644 ----LQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADL 19699

Query: 846   KQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERS 904
             ++T I R G  + L +P +G+P P++TW K    + D+  ++I++++ DT +      + 
Sbjct: 19700 RKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKY 19759

Query: 905   HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT 964
              +GKY L ++     +  +I ++++D PGPP  V ++++  ++  +TW PP  DG + I 
Sbjct: 19760 DAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPII 19819

Query: 965   GYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              Y +QK D +   W TV     +TS  +  L  G  Y+FRVF+EN  G+ +
Sbjct: 19820 NYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD 19870



 Score =  229 bits (585), Expect = 9e-60
 Identities = 149/513 (29%), Positives = 245/513 (47%), Gaps = 28/513 (5%)

Query: 506   DAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D+  VT   K V  +  P++ +D  +   T  V AG  +RL I   G P P A+WS+ D 
Sbjct: 28338 DSCEVTGTIKAVDRLTAPELDIDA-NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDS 28396

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
              +   +    T+S+   STL ++   R+D+G Y + ++N +G    +  VKV+D P PP 
Sbjct: 28397 NLSLRADIHTTDSF---STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPG 28453

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
               T  +V      + W+ P  DGG+ I  Y +E+++     W  ++ + C    F+   +
Sbjct: 28454 PITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDL 28512

Query: 685   IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
              EGV Y  R+ AVN  G+ +P     P V     +PP  L V   + ++  + W  PDH 
Sbjct: 28513 AEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHD 28572

Query: 745   GAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDA 804
             G + + GY+LE   +GS                  + W+ A      +  FT+  L    
Sbjct: 28573 GGSRITGYLLEMRQKGS------------------DFWVEAGH--TKQLTFTVERLVEKT 28612

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   RVKA N AG SEP+     +++KE    P   +     Q    + G    + +P  
Sbjct: 28613 EYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPIS 28672

Query: 865   GKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 923
             G+P P++TWK +   + + ++++I  ++  T + ++ + R  SG+Y L ++    V+T S
Sbjct: 28673 GRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFS 28732

Query: 924   IDIQIIDRPGP-PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVI 982
             + + +I RPGP    +++  V  E+  L+W  PKD G   IT Y ++K +  +  W  V 
Sbjct: 28733 VTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVN 28792

Query: 983   EHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
                 RT   +T L    EY FRV SEN  G+S+
Sbjct: 28793 SSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSK 28825



 Score =  229 bits (584), Expect = 1e-59
 Identities = 159/586 (27%), Positives = 270/586 (46%), Gaps = 42/586 (7%)

Query: 465   TKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKI 524
             +++G+P++ + R           + +  ++T D G Y       + T  A ++++     
Sbjct: 26511 SRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV----- 26565

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM---EGSGRIRTESYPDS 581
             +LD      T  V+  +     + +  EPP     S+    I+   E S  + TE     
Sbjct: 26566 VLDR-PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATV 26624

Query: 582   STLVIDIAERDDSGVYHINLKNE--------AGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             +  ++ + +      Y   +K E           A  ++K+     P PP  P VT V  
Sbjct: 26625 ARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTT-PGPPSTPWVTNVTR 26683

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             +   + W  P  +GGS ++GY +E K + S  W + N  + + T F+   +  G+ YE R
Sbjct: 26684 ESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFR 26743

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYV 753
             ++A NA G+ KPS PS P + +    PP  + +  ++  +V++ W+ P   G + + GY+
Sbjct: 26744 VYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYI 26803

Query: 754   LEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAV 813
             +E                    DLP   W  A+   + +T+F I+GL  +++   RV A 
Sbjct: 26804 VE------------------RRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFAR 26845

Query: 814   NAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
             NA G+ S P     PI   +    P I +P    +    R G +V L     GKP P + 
Sbjct: 26846 NAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIE 26905

Query: 873   WKKDGAEIDKNQINIRNSETD-TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
             W KD  E+  N +    + TD   I I+ A+R +SG Y+L+++      +A+I +QI+D+
Sbjct: 26906 WYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDK 26965

Query: 932   PGPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSA 990
             PGPP   ++ + V  E + L W PP DDG A IT Y ++K +   + W  V EH      
Sbjct: 26966 PGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECII 27025

Query: 991   TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
             T T+++ GNEY FRV + N  G+ E     +  +V+A++  +   P
Sbjct: 27026 TTTKIIKGNEYIFRVRAVNKYGIGEP---LESDSVVAKNAFVTPGP 27068



 Score =  228 bits (581), Expect = 3e-59
 Identities = 172/638 (26%), Positives = 274/638 (42%), Gaps = 44/638 (6%)

Query: 394   EGKKHILIIEGATKADAAEYSVMTTGGQSSAKL-SVDLKPLKILTPLTDQTVNLGKEICL 452
             EGK++   +    +      S +T   +       +DLK L  L  L  +  N   +I +
Sbjct: 19947 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 20006

Query: 453   KCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTL 512
             K + + ++   W K   P+    R+ V        L++ +    D G Y         T 
Sbjct: 20007 KGKPAPSV--SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 20064

Query: 513   PA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                  + V+  P I    +  D  VT  A       + +   PP     S     I+E  
Sbjct: 20065 EGTISIKVVGKPGIPTGPIKFDE-VTAEA-------MTLKWAPPKDDGGSEITNYILEKR 20116

Query: 571   GRIRTE-----SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV-----DFP 620
               +  +     S    +T  +          + ++ +N+ G         +V     D P
Sbjct: 20117 DSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 20176

Query: 621   DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE 680
             D P  P + +V  D   + W  P   GGSPI GY +E K++ S  W R N    +   F+
Sbjct: 20177 DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFK 20236

Query: 681   PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRP 740
                + EG+ YE R+ A+N  G+ KPS+PS P V L    PP    V ++T  +VT+ W  
Sbjct: 20237 VTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTE 20296

Query: 741   PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
             P + G   L GY++E                    DLP++ W+ AN   + +  FT+T L
Sbjct: 20297 PKYDGGHKLTGYIVE------------------KRDLPSKSWMKANHVNVPECAFTVTDL 20338

Query: 801   PTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 859
                 K   R++A N AGA S P   ++ I+ K+  E P I +   +K     + G+ + L
Sbjct: 20339 VEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVL 20398

Query: 860   -VIPFQGKPRPELTWKKDGAEIDKNQI-NIRNSETDTIIFIRKAERSHSGKYDLQVKVDK 917
               I   GKP P+ +W K G +I  + I  I ++ T +++ I+ A R  +G+Y +      
Sbjct: 20399 NAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPF 20458

Query: 918   FVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
               +   + + ++D PGPP  V+I +V  E   LTWTPP +DG + I  Y ++K +   + 
Sbjct: 20459 GTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLL 20518

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V E         T+L+ GNEY FRV + N  G  E
Sbjct: 20519 WTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE 20556



 Score =  227 bits (579), Expect = 4e-59
 Identities = 156/571 (27%), Positives = 260/571 (45%), Gaps = 50/571 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF--APDAYNVTLPAKVHVIDP 521
             W K+G  ++E+ R+ V     +  L I  A  ED G Y    +  A ++T+P  + V+D 
Sbjct: 25428 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 25487

Query: 522   P----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             P     I +D +  D+             I IS  PP      +    I+E      T  
Sbjct: 25488 PGPPGPIRIDEVSCDS-------------ITISWNPPEYDGGCQISNYIVEKKETTSTTW 25534

Query: 578   YPDSSTLV---IDIAERDDSGVYHINL-------KNEAGEAHASIKVKVVDFPDPPVAPT 627
             +  S  +    I I        Y   +       K+   E+ A +       P PP  P 
Sbjct: 25535 HIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPK 25594

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             V        ++ W+ P  DGGS ++GY +E K++ S  W + N  L  +T  +   + EG
Sbjct: 25595 VVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEG 25654

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
             + YE R++A N  GI K S    P        PP    V ++T  +V+++W  P + G A
Sbjct: 25655 LMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGA 25714

Query: 748   GLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIF 807
              + GY++E                    +LP   W+  N   I +T F +T L  D +  
Sbjct: 25715 KITGYIVE------------------RRELPDGRWLKCNYTNIQETYFEVTELTEDQRYE 25756

Query: 808   VRVKAVNAA-GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 866
              RV A NAA   SEP   + PI+VK+ +EPP++ +    +   + + GE + +     G+
Sbjct: 25757 FRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGR 25816

Query: 867   PRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASID 925
             P P ++W KDG EI++  +  I +++  T++ ++   R  +G+Y L +K      + +++
Sbjct: 25817 PLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVN 25876

Query: 926   IQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 984
              +++D+PGPP   ++I  +  E  +L+W  P++DG A I  Y ++K +   + W      
Sbjct: 25877 CKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGE 25936

Query: 985   YHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
                TS  +T+L+ GNEY FRV   N  G+ E
Sbjct: 25937 LQMTSCKVTKLLKGNEYIFRVTGVNKYGVGE 25967



 Score =  226 bits (575), Expect = 1e-58
 Identities = 154/509 (30%), Positives = 238/509 (46%), Gaps = 33/509 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++PP++ILD   A     +  G+ LRL   I G P PK  W + D+   +   + R +  
Sbjct: 17213 LEPPELILDANMAREQ-HIKVGDTLRLSAIIKGVPFPKVTWKKEDR---DAPTKARIDVT 17268

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
             P  S L I  A  +D G+Y + ++N AG    S+KV V+D P PP    V+E+  D C +
Sbjct: 17269 PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYL 17328

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              W+ P  DGGS I  Y +ER+   S++W  L+    K++ F  K + EG  Y  R+ A N
Sbjct: 17329 TWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAEN 17387

Query: 699   AIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
               G     +   P +   PL    PP  L    V  T V++ W  PD  G + + GY++E
Sbjct: 17388 QYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVE 17447

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
             Y  EG+                  +DWI      +   +  +TGL        RVKA N 
Sbjct: 17448 YQEEGT------------------QDWI--KFKTVTNLECVVTGLQQGKTYRFRVKAENI 17487

Query: 816   AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 875
              G   P   + PI  +E + PP + +   L +  + + G  V      +G P P   W  
Sbjct: 17488 VGLGLPD-TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTT 17546

Query: 876   DGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP 934
             DG+EI  ++   +      +++ I+   R  +G+Y + V      +T ++ + ++D PGP
Sbjct: 17547 DGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGP 17606

Query: 935   PQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATIT 993
             P   + I DV  E++ ++W PPKDDG + +  Y ++K D +   W  V     +T   I 
Sbjct: 17607 PTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIP 17666

Query: 994   ELVIGNEYYFRVFSENMCGLSE--DATMT 1020
              L  G EY FRV +EN  G+    D+T T
Sbjct: 17667 HLQKGCEYVFRVRAENKIGVGPPLDSTPT 17695



 Score =  224 bits (572), Expect = 3e-58
 Identities = 142/494 (28%), Positives = 240/494 (48%), Gaps = 29/494 (5%)

Query: 529   LDAD--NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
             LDA+   T+ V AG  +R+ +PI G P P+  W++ +  +   +    TES+   + L+I
Sbjct: 20778 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESF---TLLII 20834

Query: 587   DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
                 R D+G + + ++N AG+    + V+V+D P P +    T++  D   ++W+ P  D
Sbjct: 20835 PECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLID 20894

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I  Y +E+++     +       C + T++   + EG  Y  R+ A N  GI +P+
Sbjct: 20895 GGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPT 20953

Query: 707   MPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
               + P       SPP  L +  +T +TV++ W  P H G + + GYV+E   +GS     
Sbjct: 20954 ETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGS----- 21008

Query: 767   SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
                          + W   +   +   +  +  L    +   +V AVN+AG S P+  S+
Sbjct: 21009 -------------DQW--THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESR 21052

Query: 827   PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-I 885
             P++VKE    P++ +    ++  I + G+ + + IP  G+P+P +TWKK    + + Q +
Sbjct: 21053 PVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRV 21112

Query: 886   NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVW 944
             N   + T TI+ I +  RS SG Y L  +         I IQ+ D PGPP   +K ++V 
Sbjct: 21113 NFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVS 21172

Query: 945   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFR 1004
              + V  +W PP++DG   I+ Y ++     S  W  +     RT+   T L  G EY FR
Sbjct: 21173 SDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFR 21232

Query: 1005  VFSENMCGLSEDAT 1018
             V ++N  G+    T
Sbjct: 21233 VKAQNRYGVGPGIT 21246



 Score =  224 bits (570), Expect = 5e-58
 Identities = 165/572 (28%), Positives = 264/572 (46%), Gaps = 51/572 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDP 521
             W K+ +P++++ R+          L I +A  ED G YV      A        V V+D 
Sbjct: 22181 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDK 22240

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + +D + AD+             I +S  PP     S  +  I+E      T 
Sbjct: 22241 PGPPTGPVKMDEVTADS-------------ITLSWGPPKYDGGSSINNYIVEKRDTSTTT 22287

Query: 577   SYPDSSTLVIDI--AERDDSGV---YHINLKNEAGEA-HASIKVKVVDF----PDPPVAP 626
                 S+T+      A R  +G    + I  +N  G++ + + +  V  +    P PP  P
Sbjct: 22288 WQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTP 22347

Query: 627   TVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              VT    D   + W  P  DGGS ++GY +ERK++ S  W++LN     +T F+   + E
Sbjct: 22348 VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEE 22407

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGA 746
             GV YE R+ A N +GI KPS  S  +V      PP       VT  +VT++W+ P + G 
Sbjct: 22408 GVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGG 22467

Query: 747   AGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKI 806
             + + GY++E                    +LP   W+ A+   I  T F +TGL  D + 
Sbjct: 22468 SKITGYIVE------------------KKELPEGRWMKASFTNIIDTHFEVTGLVEDHRY 22509

Query: 807   FVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQG 865
               RV A NAAG  SEP   +  I  ++ ++PP+I +    K T +   GE+  +     G
Sbjct: 22510 EFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYG 22569

Query: 866   KPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 924
             KP P + W K   E+    ++ I++++  T + ++ A R  SG Y L+ K      + ++
Sbjct: 22570 KPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTV 22629

Query: 925   DIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 983
             +++++DRPGPP+  V I  V  E   L W PP  DG + I  Y +++ +   + W  V  
Sbjct: 22630 NVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDA 22689

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             +    S  +T+L+ GNEY FR+ + N  G+ E
Sbjct: 22690 NVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGE 22721



 Score =  220 bits (560), Expect = 7e-57
 Identities = 161/544 (29%), Positives = 248/544 (45%), Gaps = 66/544 (12%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
             + P+I LD +     +TV AG K+ L   ++G+P PK  W++ D  I++   RI  E+ P
Sbjct: 13686 EAPEIFLD-VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM-ILKQDKRITIENVP 13743

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
               ST+ I  ++R D+G Y I   N  G A A ++V V+D P PP A  +T+V ++ C++ 
Sbjct: 13744 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLT 13803

Query: 640   WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
             W PP  DGGS I  Y +ER+   S  W +L+    K+T F+  K+I    Y  R+ A N 
Sbjct: 13804 WNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENM 13862

Query: 700   IGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
              G+ +P  + P           PPT L    +T   VT+ W  PD  G + + GY +E  
Sbjct: 13863 YGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVE-- 13920

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                               D   + W+  NK  +  T + + GL    K   RV A N AG
Sbjct: 13921 ----------------RLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAG 13964

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-- 875
               +P   ++PIL+K+ I+PP       +K                  GK    L W K  
Sbjct: 13965 PGKPSKSTEPILIKDPIDPPWPPGKPTVKDV----------------GKTSVRLNWTKPE 14008

Query: 876   --DGAEIDKNQINIRNSETDTIIFIRKAE-----------RSHSGKYDLQVK-VDKFVET 921
                GA+I+   I +  + TD   ++R AE                +Y  +V+ V+K  E+
Sbjct: 14009 HDGGAKIESYVIEMLKTGTDE--WVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGES 14066

Query: 922   ASID-------IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKK 974
                +        + +  P PP+ +++ ++      L WT P+ DG + IT Y ++K D +
Sbjct: 14067 EPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVR 14126

Query: 975   SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
                W TV      T  T+T L  G+ Y FRV +EN  G S+   +  E +V+A+D     
Sbjct: 14127 RKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEI--EDSVLAKDTFTTP 14184

Query: 1035  NPVY 1038
              P Y
Sbjct: 14185 GPPY 14188



 Score =  219 bits (559), Expect = 9e-57
 Identities = 174/636 (27%), Positives = 290/636 (45%), Gaps = 67/636 (10%)

Query: 428   VDLKPLKILTPLTDQTV-NLGKEICLKCEISENIPG--KWTKNGLPVQESDRLKVVHKGR 484
             V+   +K+     D  +   G+   L+ ++S   P   +W+K+G  ++ + +L++     
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 21515

Query: 485   IHKLVIANALTEDEGDYV--------FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                LV  ++   D G Y         FA   +NV       V+D P       +    VT
Sbjct: 21516 STNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVK------VLDRP----GPPEGPLAVT 21565

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAER 591
              +   K  L    S  PP     ++ D  I++     R       S    + L +    +
Sbjct: 21566 EVTSEKCVL----SWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLK 21621

Query: 592   DDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
              +  ++ +   N+ G     E+   + V     PDPP  P VT +  D  ++ W  P  D
Sbjct: 21622 GNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSD 21681

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I+ Y +ER+ K   RW++ N     +  ++   + EG  YE RI A NA GIS PS
Sbjct: 21682 GGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 21741

Query: 707   MPSRPFVPLAVT----SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGST 762
              P+ PF     T     PP    V   + +++++ W  P + G + + GY++E       
Sbjct: 21742 -PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIA----- 21795

Query: 763   SAKQSDENGEAAYDLPAED-W-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                           LP ED W IV     +  T +TITGL  + +  +R+ A+N+ G  E
Sbjct: 21796 --------------LPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGE 21841

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD-GAE 879
             P         ++ + PP+I +   L++    R    + L +P +G+P PE+ W +D G  
Sbjct: 21842 PALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGES 21901

Query: 880   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
             +DK   +I ++ + T++ +    R  SGKY L V+     ++A ++++++D PGPPQ +K
Sbjct: 21902 LDK--ASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK 21959

Query: 940   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 999
             +++V   +V LTW PP  DG + I  Y ++K +     + TV  + H+TS  + +L  G 
Sbjct: 21960 VKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGC 22019

Query: 1000  EYYFRVFSENMCGL---SEDATMTKESAVIARDGKI 1032
              YYFRV +EN  G+   +E A   K S      GKI
Sbjct: 22020 SYYFRVLAENEYGIGLPAETAESVKASERPLPPGKI 22055



 Score =  219 bits (557), Expect = 2e-56
 Identities = 163/601 (27%), Positives = 258/601 (42%), Gaps = 40/601 (6%)

Query: 430   LKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             L P KIL P    T+  GK++ ++  +    +   KW K    V  S  L V        
Sbjct: 18897 LLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI 18955

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPKIILDGLDADNTVTVIAGNK 542
             L+I +   +D G Y    +  + T   K+ V+      PP+   D  D D          
Sbjct: 18956 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC-----S 19010

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
             L   IP+         +      +  G       S   +S  V  +    +  ++ +  +
Sbjct: 19011 LSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEY-IFRVRAE 19069

Query: 603   NEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N  G +      K+V       P  P    VT+V  D   + W+ P  DGGSPI+GY IE
Sbjct: 19070 NRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIE 19129

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK++ S  W++ N  L + T +    ++EG+ Y  RI+A+N  G S PS P+        
Sbjct: 19130 RKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP 19189

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDL 777
               PP    V  VT +TV++ W  P H G + + GY +E C                   L
Sbjct: 19190 VDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEAC------------------KL 19231

Query: 778   PAEDWIVAN--KDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 835
             P + W+  N     I + ++T TGL   A+   R  A  A   S P   S P+ +     
Sbjct: 19232 PGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV 19291

Query: 836   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDT 894
             PP+I +   +K     + G  V L     GKP P ++WKKDG  +   + I +       
Sbjct: 19292 PPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLC 19351

Query: 895   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTP 954
              + +    R  SG Y +  +     ++A+I ++++D+PGPP  VKI  ++ +   L+W P
Sbjct: 19352 TLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEP 19411

Query: 955   PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
             P +DG + IT Y + K +     W  V      TS ++ +L+ G+EY FR+ +EN  G+ 
Sbjct: 19412 PLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVG 19471

Query: 1015  E 1015
             +
Sbjct: 19472 D 19472



 Score =  219 bits (557), Expect = 2e-56
 Identities = 151/565 (26%), Positives = 257/565 (45%), Gaps = 42/565 (7%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+GLP++ES+ ++         L I NA  E  G Y    D     + +P  V  + P
Sbjct: 27597 WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 27656

Query: 522   PK-----IILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      I  D + AD+ +       L  ++P          +S   +   + + ++   
Sbjct: 27657 PSKPKGPIRFDEIKADSVI-------LSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCS 27709

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD-----FPDPPVAPTVTEV 631
             S   ++  V ++  +D    + +  +N  G +   +   +V       P PP  P +  V
Sbjct: 27710 SVARTTFKVPNLV-KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNV 27768

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               D   + W+ P YDGGS + G+ +E+K++ S  W ++N        +    ++EG+ Y+
Sbjct: 27769 TSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQ 27828

Query: 692   VRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDG 751
              R++A N+ G+S PS PS+  + ++   PP       VT  T+T++W PP   G + + G
Sbjct: 27829 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 27888

Query: 752   YVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 811
             Y +E         +Q +E            W+  N   + + ++T+TGL    +   R+ 
Sbjct: 27889 YSIE--------KRQGNER-----------WVRCNFTDVSECQYTVTGLSPGDRYEFRII 27929

Query: 812   AVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPE 870
             A NA G  S P   S  I+ ++   PP +          I + GE++ +    QG+P P 
Sbjct: 27930 ARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPR 27989

Query: 871   LTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
             +TW KDG EI+K   + I +    T +F+R A R H G Y ++ K       A I +++ 
Sbjct: 27990 VTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049

Query: 930   DRPGP-PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT 988
             D PG     ++  ++ GE + L W  P +DG A IT Y I+K +   + W  + +     
Sbjct: 28050 DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQ 28109

Query: 989   SATITELVIGNEYYFRVFSENMCGL 1013
             S T  +L+ GNEY FRV + N  G+
Sbjct: 28110 SYTAIKLINGNEYQFRVSAVNKFGV 28134



 Score =  216 bits (551), Expect = 8e-56
 Identities = 161/592 (27%), Positives = 267/592 (45%), Gaps = 52/592 (8%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHV 518
             +W K    +  + RL++        L + +A+  D G+Y+    A NV    ++   V V
Sbjct: 22576 QWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK--AKNVAGERSVTVNVKV 22633

Query: 519   IDPP-----KIILDGLDADNTVTVIA-----GNKLRLEIPISGEPPPKAMWSRGDKAIME 568
             +D P      +++ G+ A+            G    +   +      + +W+  D  +  
Sbjct: 22634 LDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQT 22693

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              S ++      +  T  I    +   G        E  E+   +       PD P AP V
Sbjct: 22694 LSCKVTKLLEGNEYTFRIMAVNKYGVG--------EPLESEPVVAKNPFVVPDAPKAPEV 22745

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV 688
             T V  D  I+ WE PA DGGS ILGY +E++ K+  RW R +  L  E       +IE  
Sbjct: 22746 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 22805

Query: 689   AYEVRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIG 745
              YE R+ A NA G+S+PS PS   +   P+    PP    V  +T ++V + W  P + G
Sbjct: 22806 DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDG 22865

Query: 746   AAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDL-IDKTKFTITGLPTDA 804
                + GY++E C                  D+   +W +      I+KT   +  L    
Sbjct: 22866 GCEIQGYIVEKC------------------DVSVGEWTMCTPPTGINKTNIEVEKLLEKH 22907

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   R+ A+N AG  E      PI+V+E +E P I +   L++    R G ++ L +P +
Sbjct: 22908 EYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIK 22967

Query: 865   GKPRPELTW-KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 923
             G+P PE+ W K DG   D   I++ +S T  +  +    R  SGKY L ++     ++A 
Sbjct: 22968 GRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLV--LDNVNRYDSGKYTLTLENSSGTKSAF 23025

Query: 924   IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 983
             + ++++D P PP  +K+ ++  ++V++TW PP  DG + I  Y ++K +     +  V+ 
Sbjct: 23026 VTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVT 23085

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGL---SEDATMTKESAVIARDGKI 1032
             + H+ S  I +L  G  YYFRV +EN  G+   ++ A   K + V    GKI
Sbjct: 23086 NCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 23137



 Score =  216 bits (550), Expect = 1e-55
 Identities = 154/518 (29%), Positives = 249/518 (48%), Gaps = 36/518 (6%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   N  + AK  +++ P+I LD +    +V   AG  +++ IP  G PPP   W R D+
Sbjct: 27253 PIEMNEPVQAK-DILEAPEIDLD-VALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDE 27309

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS-IKVKVVDFPDPP 623
               +    R   E+   SS L I    R+D+G Y + ++N  GE  +S + VKV+D P   
Sbjct: 27310 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 27369

Query: 624   VAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
                 V  V      + W+PP  DGGSPI+ Y IE++      W  ++   C  T+F+   
Sbjct: 27370 QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHK-CSSTSFKLID 27428

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             + E   +  R+ A N IGI +P   + P     V +P   L++   T T+V + W  PD 
Sbjct: 27429 LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDF 27488

Query: 744   IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKT-KFTITGLPT 802
              G + +  YV+E   +G                   + W  A    I KT +  ++ L  
Sbjct: 27489 DGGSVITEYVVERKGKGE------------------QTWSHAG---ISKTCEIEVSQLKE 27527

Query: 803   DAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP 862
              + +  RV A N  G S+P     PI VKE+I  P++ +          R+G  V+L +P
Sbjct: 27528 QSVLEFRVFAKNEKGLSDPVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELP 27586

Query: 863   FQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
             ++GKP+P ++W KDG  + +++ +    +E    + I+ A++ H GKY   V +D  V  
Sbjct: 27587 YKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYT--VILDNAVCR 27644

Query: 922   ASIDIQIIDRPGPPQI----VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
              ++ I +I   GPP      ++ +++  ++V L+W  P+D+G   IT Y+I+K +     
Sbjct: 27645 IAVPITVITL-GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTN 27703

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V     RT+  +  LV   EY FRV +EN  G+S+
Sbjct: 27704 WKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQ 27741



 Score =  214 bits (546), Expect = 3e-55
 Identities = 142/494 (28%), Positives = 224/494 (45%), Gaps = 36/494 (7%)

Query: 573   IRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPT 627
             +   S P   T  I         V+ I  +N+ G     ++       +   P  P  PT
Sbjct: 16265 VHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPT 16324

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT----FEPKK 683
             V+ V  +   +NWE P YDGGSP+ GY++E K   S RW R+N D  K  T    ++   
Sbjct: 16325 VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTG 16384

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRP 740
             +IEG  Y+ R++A+NA G+   S+PS P     P+A   PP    V   T ++  + W P
Sbjct: 16385 LIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPP-FPKVTDWTKSSADLEWSP 16443

Query: 741   PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
             P   G + + GY++EY  EG                   E+W       +  TK  +TGL
Sbjct: 16444 PLKDGGSKVTGYIVEYKEEGK------------------EEWEKGKDKEVRGTKLVVTGL 16485

Query: 801   PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
                A    RV+AVN AG  EP   +  I +K+ +  P +++   ++   +   G  + ++
Sbjct: 16486 KEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRII 16545

Query: 861   IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
                 GKP P +TW  +   + + +  I  +   + + I+  +RSH G Y L  K +    
Sbjct: 16546 AYVSGKPPPTVTWNMNERTLPQ-EATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGER 16604

Query: 921   TASIDIQIIDRPGPPQIVKI-EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
               +I + ++D PGP     +  ++  E+  LTW  P+DDG + IT Y I+K +     W 
Sbjct: 16605 KKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWT 16664

Query: 980   TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1039
              V     R +AT+  L+ G  Y+FR+ +EN  G+      T E+ VI     + + P  E
Sbjct: 16665 PVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMG-PFVETSEALVIREPITVPERP--E 16721

Query: 1040  DFDFSEAPMFTQPL 1053
             D +  E    T  L
Sbjct: 16722 DLEVKEVTKNTVTL 16735



 Score =  211 bits (537), Expect = 3e-54
 Identities = 160/553 (28%), Positives = 257/553 (46%), Gaps = 70/553 (12%)

Query: 502   VFAPDAYNVTLPAKV--HVI--DP---PKIILDGLDADNTVTVIAGNKLRLEIPISGEPP 554
             V A +A  V+ P+++  +V+  DP   P I L+  D    + VI G KL + +P    P 
Sbjct: 14360 VRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD----IIVIEGEKLSIPVPFRAVPV 14415

Query: 555   PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
             P   W +  K + + S R+  ++   S+ L +  + R D+G+Y I L+N+ G A ASI V
Sbjct: 14416 PTVSWHKDGKEV-KASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINV 14474

Query: 615   KVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC 674
             KV+  P P      +++    C + WEPP +DGG+PIL Y +ER++     ++ +     
Sbjct: 14475 KVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGEN 14534

Query: 675   KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTD 731
             K  ++  K +I    Y  R+ AVN +G  +      P +   P     PP  + V + T 
Sbjct: 14535 K-LSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTA 14593

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLID 791
               +T+ W+PP + G + + GY++E   +G                   E W   N+ L+ 
Sbjct: 14594 EAMTITWKPPLYDGGSKIMGYIIEKIAKGE------------------ERWKRCNEHLVP 14635

Query: 792   KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 851
                +T  GL    +   RV+A NAAG SEP   + P    + I+ PK+ +   L+   ++
Sbjct: 14636 ILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLE---VK 14692

Query: 852   RVGEAVNLVIPFQGKPRPELTWKKD-----GAEIDK------------------------ 882
             R G+ + L     G P P +TW KD       EI K                        
Sbjct: 14693 R-GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLT 14751

Query: 883   NQINIRNSET-DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
              +++I NS+  ++ + +R + R   G Y ++V+ D  +  A   + ++D PGPP     E
Sbjct: 14752 QRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFE 14811

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGN 999
             D+   +V   W PP DDG + I  YT++K D  K   EW  V         ++T+L+ G 
Sbjct: 14812 DIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGK 14871

Query: 1000  EYYFRVFSENMCG 1012
             EY FRV +EN  G
Sbjct: 14872 EYLFRVRAENRFG 14884



 Score =  210 bits (535), Expect = 5e-54
 Identities = 177/671 (26%), Positives = 293/671 (43%), Gaps = 79/671 (11%)

Query: 380   EIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPL 439
             +++ G K  +RIR +         GA  A +     +    +  A       P  +L P 
Sbjct: 20337 DLVEGGKYEFRIRAKNTA------GAISAPSESTETIICKDEYEA-------PTIVLDPT 20383

Query: 440   TDQ--TVNLGKEICLKCE--ISENIP-GKWTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                  T+  G  I L     + + +P   W+K G  ++ SD  ++        L I  A 
Sbjct: 20384 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 20443

Query: 495   TEDEGDY-VFAPDAYNVTLP-AKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              +D G+Y + A + +   +   KV V+D P     G      ++ ++  K  L    +  
Sbjct: 20444 RKDAGEYTITATNPFGTKVEHVKVTVLDVP-----GPPGPVEISNVSAEKATL----TWT 20494

Query: 553   PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK----NE---- 604
             PP +   S     I+E           ++S L+  +   D     H+  K    NE    
Sbjct: 20495 PPLEDGGSPIKSYILEKR---------ETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFR 20545

Query: 605   --------AGEAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILG 653
                      GE   S  VK+VD    P PP  P V+ V  +   ++W+ P  DGGS I G
Sbjct: 20546 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 20605

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV 713
             Y +ER++K+S RW+R       +   +   + EG  YE R+ A N  GI  PS  S   +
Sbjct: 20606 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 20665

Query: 714   PLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDEN 770
                   PP   +   VTDTT    ++ W  P + G   + GYV+E+   G   A   D  
Sbjct: 20666 MKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGD-EAWIKDTT 20724

Query: 771   GEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 830
             G A                +  T+F +  L T  K   R+ A+N AG  EP       +V
Sbjct: 20725 GTA----------------LRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIV 20768

Query: 831   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 890
             +  + P    +   L++T + R G ++ + +P +G+P PE+TW KD   + KN+ NI N+
Sbjct: 20769 EREMAPD-FELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIENT 20826

Query: 891   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVAL 950
             E+ T++ I +  R  +GK+ + ++     ++  ++++++D PGP   ++  D+  ++V L
Sbjct: 20827 ESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTL 20886

Query: 951   TWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENM 1010
              W  P  DG + IT Y ++K +     + T     H+ +  +T L  G EY+FRV +EN 
Sbjct: 20887 HWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENE 20946

Query: 1011  CGLSEDATMTK 1021
              G+ E    T+
Sbjct: 20947 YGIGEPTETTE 20957



 Score =  207 bits (527), Expect = 5e-53
 Identities = 119/408 (29%), Positives = 212/408 (51%), Gaps = 24/408 (5%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT++  +   + W  P  DGGS I GYF+E++ K+S  W ++  +  ++T  
Sbjct: 27066 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQ 27125

Query: 680   EPKKMIEGVAYEVRIFAVNAIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             +   + E   Y+ R+ AVNA G    S+PS   +   P+    PP  + +   T +++T+
Sbjct: 27126 KVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITL 27185

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWI-VANKDLIDKTKF 795
              W  P + G + + GYV+E         +Q +E          E+W  V+ K  +  T++
Sbjct: 27186 GWSKPVYDGGSAVTGYVVEI--------RQGEE----------EEWTTVSTKGEVRTTEY 27227

Query: 796   TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 855
              ++ L      + RV AVN AG  EP   ++P+  K+I+E P+I +   L+ + I + GE
Sbjct: 27228 VVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGE 27287

Query: 856   AVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVK 914
              V ++IPF+G+P P +TW+KD   +  + + +I N+++ +++ I +  R+ +GKY L ++
Sbjct: 27288 DVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIE 27347

Query: 915   VD-KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                   +++++ ++++D P   Q ++++ V    V L W PP  DG + I  Y I+K D 
Sbjct: 27348 NGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDA 27407

Query: 974   KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
                 W  V      TS  + +L     ++FRV +EN  G+ E    T+
Sbjct: 27408 TKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTE 27455



 Score =  206 bits (525), Expect = 8e-53
 Identities = 160/599 (26%), Positives = 279/599 (46%), Gaps = 50/599 (8%)

Query: 444   VNLGKEICLKCEI-SENIPGK-WTKNGLPVQESD-RLKVVHKGRIHKLVIANALTEDEGD 500
             V+ G+   L+ +I  + IP   W+K+G  ++E+  R+++    +   LV+ + +  D G 
Sbjct: 24719 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 24778

Query: 501   YVFAPDAYNVT--LPAKVHVIDPP-----KIILDGLDAD------NTVTVIAGNKLRLEI 547
             Y+        T  +P  V V+D P      + + G+ A+      N      G  +   I
Sbjct: 24779 YILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYI 24838

Query: 548   PISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE 607
              I      +  W++    +   + ++ T+  P +  +   +A       Y I    E+G 
Sbjct: 24839 -IEKRETSRLSWTQVSTEVQALNYKV-TKLLPGNEYIFRVMAVNK----YGIGEPLESGP 24892

Query: 608   AHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
               A    K    P PP  P V+ +  D  ++ W  P  DGG+ I GY +E++ K+  RW 
Sbjct: 24893 VTACNPYKP---PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 24949

Query: 668   RLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVD 727
             + N     +       + EG +YE R+ A NA G+ +PS PS  +       PP   +  
Sbjct: 24950 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP 25009

Query: 728   SVTDT---TVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIV 784
              VTDT   +V++ W  P + G A + GYV+E                EAA    A++W  
Sbjct: 25010 KVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEV--------------KEAA----ADEWTT 25051

Query: 785   ANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 843
                   +   +FT+T L  + +   R+ A+N+ G  EP      ++ +E IEPP+I +  
Sbjct: 25052 CTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDA 25111

Query: 844   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-DGAEIDKNQINIRNSETDTIIFIRKAE 902
              L++  + R    + L +  +G+P PE+ W+K +G   D+ QI + +S   T++ I    
Sbjct: 25112 DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS--FTMLVIDNVT 25169

Query: 903   RSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAA 962
             R  SG+Y+L ++ +   +TA ++++++D P  P  + I +V  ++V L+W PP  DG A 
Sbjct: 25170 RFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAK 25229

Query: 963   ITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
             IT Y ++K +     + T+  +  +T+  I  L  G  YYFRV + N  G+   A  T+
Sbjct: 25230 ITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTE 25288



 Score =  206 bits (524), Expect = 1e-52
 Identities = 159/616 (25%), Positives = 268/616 (43%), Gaps = 73/616 (11%)

Query: 434   KILTPLTDQTVNLGKEICLKCEISENIPG----------KWTKNGLPVQESDRLKVVHKG 483
             K++ P  +  V L + + +K   +   P           KWT +G  ++  +   V    
Sbjct: 17504 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 17563

Query: 484   RIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVID---PPKIILDGLDADNTVTVI 538
                 L I N L  D G+Y       A + T+   + V+D   PP   ++ LD        
Sbjct: 17564 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPE---- 17619

Query: 539   AGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAERDD 593
                     + IS +PP     S     I+E     +       S    + L I   ++  
Sbjct: 17620 -------HMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 17672

Query: 594   SGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
               V+ +  +N+ G     ++  ++       P PP  P VT++ ++   ++W  P  DGG
Sbjct: 17673 EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGG 17732

Query: 649   SPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             SPI GY++ER++  + +W+R+N     +  F    + EG  YE R+FA N  G+SKPS  
Sbjct: 17733 SPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 17791

Query: 709   SRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
             S P     P+    PP    +   +  T  + W  P   G + + GYV+E C +  T+  
Sbjct: 17792 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVE-CQKPGTA-- 17848

Query: 766   QSDENGEAAYDLPAEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYY 824
                             W   NKD LI +  F + GL    +   R+KA N  G  EP+  
Sbjct: 17849 ---------------QWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPREL 17893

Query: 825   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ 884
             ++ ++ K+I+ PP++ +    +     RVG+ + ++   +G+P P++TW K+G      +
Sbjct: 17894 AESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG------K 17947

Query: 885   INIRNSETDTI-------IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI 937
             + +R    D I       + I++A R+  GKY +  K        S  + ++DRPGP Q 
Sbjct: 17948 VLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQN 18007

Query: 938   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVI 997
             +K+ +V  EN  ++W  P D+G + IT + ++        W  V     +       L+ 
Sbjct: 18008 LKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIK-ANLLA 18066

Query: 998   GNEYYFRVFSENMCGL 1013
              NEYYFRV +EN  G+
Sbjct: 18067 NNEYYFRVCAENKVGV 18082



 Score =  204 bits (520), Expect = 3e-52
 Identities = 127/423 (30%), Positives = 206/423 (48%), Gaps = 36/423 (8%)

Query: 611   SIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
             S KV + D    P PP  P V        +++W PP  +GGSPI GY++E++++ S  W 
Sbjct: 15587 SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWS 15646

Query: 668   RLNFDLC-----KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             R++         K   F   +++EGV Y+ R  A+NA GI  PS PS P V   P+    
Sbjct: 15647 RVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPG 15706

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
             PP+   V   T +++++ W+PP   G + + GY++E   EG+T  K+ +E  +       
Sbjct: 15707 PPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDK------- 15759

Query: 780   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 839
                      LI   +  +  L    K   RVKAVN AG SEP   +  I   +I E P++
Sbjct: 15760 ---------LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEV 15810

Query: 840   RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWK---------KDGAEIDKNQINIRNS 890
              I    +   + + G  + +    +G+P P+ +W+         KDG         +  +
Sbjct: 15811 FIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETA 15870

Query: 891   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVAL 950
             E  ++I I + +RSH+GKY +  K     +TA+  ++++D PGPP+ +K+ D+   +  L
Sbjct: 15871 ENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRL 15930

Query: 951   TWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENM 1010
             +W  P DDG   I GY I+K       W  V      T+  + +L+   +Y+FRV +EN 
Sbjct: 15931 SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENR 15990

Query: 1011  CGL 1013
              G+
Sbjct: 15991 FGI 15993



 Score =  204 bits (518), Expect = 5e-52
 Identities = 146/522 (27%), Positives = 236/522 (45%), Gaps = 39/522 (7%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
             +PP + LD +     + ++AG  LR+   ++G P P  +W++ +  +     R+  ++  
Sbjct: 15100 EPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL--DKDRVVIDNVG 15156

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
               S L+I  A R D G Y I   N  G   A+ +V+V D P P +           C++N
Sbjct: 15157 TKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLN 15216

Query: 640   WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
             W  P  DGGS I G+ IERK  +   W R   +  + +  +   ++EG  Y+ R+ A N 
Sbjct: 15217 WSDPEDDGGSEITGFIIERKDAKMHTW-RQPIE-TERSKCDITGLLEGQEYKFRVIAKNK 15274

Query: 700   IGISKPSM--PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
              G   P    P     PL   + P  LT    T +T+T+ W+ P   G + + GY++E  
Sbjct: 15275 FGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIE-- 15332

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                           +  +D P  D+   NK L   T F +  L        RVKAVN  G
Sbjct: 15333 --------------KRRHDKP--DFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIG 15376

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELTWKKD 876
              SEP      +++++   PP I++   ++   I+ + GE V++     G P P++ W K+
Sbjct: 15377 ESEPS-LPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKN 15435

Query: 877   GAEIDK-------NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
                I+K        +  +  SE  T + I KA R   G Y +           ++ +++ 
Sbjct: 15436 ETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVY 15495

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHR 987
             DRP PP+ + + D+  E+  LTW  P D+G + IT Y I K D  +K  EW  V      
Sbjct: 15496 DRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE 15555

Query: 988   TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
                 I +L+   +Y FRV + N  G+S++    K   V+ +D
Sbjct: 15556 KRYGIWKLIPNGQYEFRVRAVNKYGISDEC---KSDKVVIQD 15594



 Score =  203 bits (516), Expect = 9e-52
 Identities = 164/613 (26%), Positives = 270/613 (44%), Gaps = 62/613 (10%)

Query: 443   TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T+  G ++ L   +      K  WTK    +   +++ + + G+    VI      D G 
Sbjct: 29058 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGK 29117

Query: 501   YVFAPDAYNVT--LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP---- 554
             Y       + T  +   V V+D P     G     TV+ +   K  L   +  E      
Sbjct: 29118 YTLTVKNASGTKAVSVMVKVLDSP-----GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 29172

Query: 555   -----PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                   +   SR +  I+EG     T SY      V+    +++  ++ +   N+ G   
Sbjct: 29173 THYIVERRETSRLNWVIVEGE--CPTLSY------VVTRLIKNNEYIFRVRAVNKYGPGV 29224

Query: 607   --EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
               E+   +       P PP  P     G +  I+ W  P  DGG+ I  Y +++++K+S 
Sbjct: 29225 PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSL 29284

Query: 665   RWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTS 719
             RW R+N D +  +T  +   ++EG  Y+ R+ AVNA G S+PS  S  F+    P     
Sbjct: 29285 RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASN-FISCREPSYTPG 29343

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
             PP+   V   T  ++++ W  P + G   + GYVLE         K +D+          
Sbjct: 29344 PPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEM------QEKDTDQ---------- 29387

Query: 780   EDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
               W  V     I  T+FT+  L    K   RV AVN  G SE       I   E IE P 
Sbjct: 29388 --WYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD 29445

Query: 839   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFI 898
             + +   LK+T   R G ++ L++   G+P P +TW K G ++    I I  +E+ +++ +
Sbjct: 29446 LELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSLLIV 29504

Query: 899   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 958
              K  R  +GKY ++ +     ++A++ +++ D PGP   VK+++V  ++V +TW  P  D
Sbjct: 29505 DKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTID 29564

Query: 959   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE--- 1015
             G A +  Y ++K +     + TV     +T   I+ LV G  YYFRV  EN+ G+ E   
Sbjct: 29565 GGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE 29624

Query: 1016  --DATMTKESAVI 1026
               DA +  E  ++
Sbjct: 29625 TSDAVLVSEVPLV 29637



 Score =  201 bits (512), Expect = 3e-51
 Identities = 157/613 (25%), Positives = 280/613 (45%), Gaps = 46/613 (7%)

Query: 420   GQSSAKLSVDLKPLKILTPLTDQ-TVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDR 476
             G  +AK  V+L  + +     D   VN G+   L+ ++  + +P  +W +    ++ES R
Sbjct: 23612 GPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESAR 23671

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNT 534
              ++ +      L++ +A+  D G Y+      A + + P  V V+D P       +    
Sbjct: 23672 CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQ 23727

Query: 535   VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIA 589
             VT +   K  L    +  PP +   S     ++E     R       S   +++L +   
Sbjct: 23728 VTGVTSEKCSL----TWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKL 23783

Query: 590   ERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPA 644
                +  V+ I   N+   GE   S  V + +    P PP +  VT +  D   + W  P 
Sbjct: 23784 LEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPD 23843

Query: 645   YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
              DGGS I+GY +E++ +   RW++ N     +       + E   YE R+ A NA G+ +
Sbjct: 23844 SDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGE 23903

Query: 705   PSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             PS  +   +   P+    PPT   +   T  ++T+ W  P + G + + GYV+E C    
Sbjct: 23904 PSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEIC---- 23959

Query: 762   TSAKQSDENGEAAYDLPAEDW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                 ++DE          E+W IV  +  +  T+F I+ L    +  +RV A+N  G  E
Sbjct: 23960 ----KADE----------EEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGE 24005

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
                    +  ++ +E P++ +   L++  + R G +  + IPF+G+P PE+TW ++  E 
Sbjct: 24006 ATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEF 24065

Query: 881   DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKI 940
               +++ I      T + I   +R+ +GKY L+++     ++A + ++++D PGPPQ + +
Sbjct: 24066 T-DKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAV 24124

Query: 941   EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 1000
             ++V  ++  L W PP  DG A +  Y I K +     +  V     +TS  +  L  G  
Sbjct: 24125 KEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAI 24184

Query: 1001  YYFRVFSENMCGL 1013
             YYFRV +EN  G+
Sbjct: 24185 YYFRVMAENEFGV 24197



 Score =  201 bits (510), Expect = 4e-51
 Identities = 139/497 (27%), Positives = 230/497 (46%), Gaps = 32/497 (6%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P  P  P V  V  +   + WE P +DGGS I+GY++E+K++ +  W++ N   C E  +
Sbjct: 28841 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 28900

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   ++EG+ Y+ R +A+NA G+SK S  SRP +       P    V  VT +TV++ W 
Sbjct: 28901 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 28960

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P + G + + GY++E         K   E G+         W+  N  ++    FT+T 
Sbjct: 28961 APAYDGGSKVVGYIIE--------RKPVSEVGDGR-------WLKCNYTIVSDNFFTVTA 29005

Query: 800   LPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAV 857
             L        RV A NAAG  S+    + P+  ++   PPK  +   L    +  R G  +
Sbjct: 29006 LSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDL 29065

Query: 858   NLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVD 916
              L     GKP P++ W K   E+D   +++++ +       I+  +RS SGKY L VK  
Sbjct: 29066 VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 29125

Query: 917   KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                +  S+ ++++D PGP   + +  V  E   L W+ P++DG A IT Y +++ +   +
Sbjct: 29126 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 29185

Query: 977   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
              W  V       S  +T L+  NEY FRV + N  G        +   ++AR+     +P
Sbjct: 29186 NWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYG---PGVPVESEPIVARNSFTIPSP 29242

Query: 1037  --VYEDFDFSEAPM---FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDD 1090
               + E+    +  +   +T+P  +     G N   N  V    K  + W + NK  +V D
Sbjct: 29243 PGIPEEVGTGKEHIIIQWTKPESD-----GGNEISNYLVDKREKKSLRWTRVNKDYVVYD 29297

Query: 1091  PRYRMFSNQGVCTLEIR 1107
              R ++ S    C  + R
Sbjct: 29298 TRLKVTSLMEGCDYQFR 29314



 Score =  196 bits (497), Expect = 1e-49
 Identities = 219/924 (23%), Positives = 366/924 (39%), Gaps = 131/924 (14%)

Query: 263   QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             +V +   V F  E+     + KW++N + I  S+KYI   K     L I +  + D + Y
Sbjct: 12650 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 12709

Query: 323   YVTAGDE-----KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKN 377
              V+  +      K +  L V E  + + + L+D      + V   C+V+  +  +KW KN
Sbjct: 12710 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 12769

Query: 378   GEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILT 437
             GEE+    +  YR  V+  KH+L I+     D  EY V     +S A+L +   P + + 
Sbjct: 12770 GEEVPFDNRVSYR--VDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 12827

Query: 438   PLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTE 496
              L DQTV    +    C++S E    KW +NG  ++E  + K    G IH+L+I +   +
Sbjct: 12828 HLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLD 12887

Query: 497   DEGDYVFAPD-----AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISG 551
             DE +Y    +     A        V +I PP+ IL+   AD  V +   NK ++E+    
Sbjct: 12888 DECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD-VVFLAELNKDKVEV---- 12942

Query: 552   EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                    W R +  +++G               + DI  RD  G Y    K++  EA A 
Sbjct: 12943 ------QWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQ-GEYRFIAKDK--EARAK 12993

Query: 612   IKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF-IERKKKQSSRWMRLN 670
             +++          AP +     D  +        D G P+      +   K  + W + N
Sbjct: 12994 LELAA--------APKIKTADQDLVV--------DVGKPLTMVVPYDAYPKAEAEWFKEN 13037

Query: 671   FDL--------CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPT 722
               L         ++T+F   +  +G     +I   N  G ++  +  +    + V  P  
Sbjct: 13038 EPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV---IDVPGPVR 13094

Query: 723   LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDW 782
              L V    D  V++ W  P   G + + GYV+E                    D+  + W
Sbjct: 13095 NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVE------------------RRDIKRKTW 13136

Query: 783   IVANKDLIDKTKFTITGLPTDAKIFV-RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRI 841
             ++A  D  +  +FT+TGL      ++ RV A N  G  EP     P+  +   + P    
Sbjct: 13137 VLAT-DRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP---- 13191

Query: 842   PRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD----GAEIDKNQINIRNSET---DT 894
                         G  +N+ I    +    LTW+      GAEI    I +R+  +   DT
Sbjct: 13192 ------------GPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDT 13239

Query: 895   IIFIRKAERS-------HSGKYDLQVKVDKFV-----ETASIDIQI---IDRPGPPQIVK 939
              + +R  + S          +Y  +V+    +       A+  +++   I+RP PP  + 
Sbjct: 13240 AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLT 13299

Query: 940   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIG 998
               D    +V L W PP  DG + I GY I++ ++    W    ++     +  +T L  G
Sbjct: 13300 SSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKG 13359

Query: 999   NEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYA 1058
             N+Y +RV +EN  G+S+ + +                P+  D  F E  M      +   
Sbjct: 13360 NKYLYRVSAENKAGVSDPSEIL--------------GPLTADDAFVEPTMDLSAFKDGLE 13405

Query: 1059  IAGYNA-TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
             +   N  T+     G P+P  TW      +    R +M +      L I      D G Y
Sbjct: 13406 VIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIY 13465

Query: 1118  CCKAVNDLGTVEIECKLEVKVIAQ 1141
               K  N + T+  E  ++V VIA+
Sbjct: 13466 TLKLENRVKTISGE--IDVNVIAR 13487



 Score =  195 bits (496), Expect = 2e-49
 Identities = 141/519 (27%), Positives = 228/519 (43%), Gaps = 38/519 (7%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP++ LD +   + +TV  G  +R+   + G P P   W++  K ++      R + 
Sbjct: 17902 ILHPPEVELD-VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK---RVDL 17957

Query: 578   YPDSSTLVIDIAE--RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
               D   + + I E  R D G Y I+ KN +G A  S  V V+D P P     VT V  + 
Sbjct: 17958 IQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKEN 18017

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++WE P  +GGS I  + +E +K     W  +  D+ K        ++    Y  R+ 
Sbjct: 18018 CTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYFRVC 18075

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             A N +G+        P +   P+     P  L +     T V ++WR PD+ G +    Y
Sbjct: 18076 AENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSY 18135

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
              +E   +GS                  +DW   +K  I +T + +     +     RV+ 
Sbjct: 18136 HVERRLKGS------------------DDWERVHKGSIKETHYMVDRCVENQIYEFRVQT 18177

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
              N  G S+    ++ ++VKE ++ P + +   L      + G+ + L    +GKP PE+ 
Sbjct: 18178 KNEGGESD-WVKTEEVVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVA 18234

Query: 873   WKKDGAEIDKNQ---INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
             W KD    D  +   + I      +   + KA+RS  GKY +          A   + ++
Sbjct: 18235 WTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVL 18294

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             D+PGP + +KI DV  +   + W PP+DDG   I  Y ++K + K M W T         
Sbjct: 18295 DKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPG 18354

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIAR 1028
              T+T L+ GNEY FRV +EN  G       T+   VIA+
Sbjct: 18355 TTVTRLIEGNEYIFRVRAENKIGTGPP---TESKPVIAK 18390



 Score =  195 bits (495), Expect = 2e-49
 Identities = 123/422 (29%), Positives = 206/422 (48%), Gaps = 28/422 (6%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP A  V +V      + WEPP  DGG PI  Y IE+K++  +RW++       +  F
Sbjct: 14184 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 14243

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTM 736
                 +IEG   + ++ A N  G+  PS P+       P +  SPP  L V       + +
Sbjct: 14244 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 14303

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFT 796
              W+PP+  G + + GY +E C  G+                  E W+  N   I   KF 
Sbjct: 14304 AWKPPEKNGGSPIIGYHVEMCPVGT------------------EKWMRVNSRPIKDLKFK 14345

Query: 797   IT-GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 855
             +  G+  D +  +RV+AVNA G SEP   S+ ++ K+    P I +  H     I   GE
Sbjct: 14346 VEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGE 14402

Query: 856   AVNLVIPFQGKPRPELTWKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDLQVK 914
              +++ +PF+  P P ++W KDG E+   +++ ++N      + + K+ R+ +G Y + ++
Sbjct: 14403 KLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLE 14462

Query: 915   VDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKK 974
                   TASI++++I  PGP + +K  D+   +  LTW PP+ DG   I  Y +++ +  
Sbjct: 14463 NKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAG 14522

Query: 975   SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
                +  V+   ++ S T+ +L+   EY+FRV + N  G  E   +  ++ VIA+D K   
Sbjct: 14523 RRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIEL--KNPVIAQDPKQPP 14580

Query: 1035  NP 1036
             +P
Sbjct: 14581 DP 14582



 Score =  194 bits (493), Expect = 4e-49
 Identities = 148/575 (25%), Positives = 258/575 (44%), Gaps = 49/575 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVI 519
             W K+G+ +++   +++        L + +A  +  G  V+  +A N +  AK    V V 
Sbjct: 27992 WFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG--VYTVEAKNASGSAKAEIKVKVQ 28049

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRL--EIPISGEPPP-------KAMWSRGDKAIMEGS 570
             D P  ++  +   N    I G K+ L  + P++    P       K   SR   A++E  
Sbjct: 28050 DTPGKVVGPIRFTN----ITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIED- 28104

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGV--YHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              +   +SY     +  +  +   S V  + +    ++    A I+  V   PD P  P  
Sbjct: 28105 -KCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTV---PDAPGIPEP 28160

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR-LNFDLCKETTFEPKKMIEG 687
             + +  +   + W  P  DGGS I  Y +ER++K+S+RW++ ++     ET F+   + EG
Sbjct: 28161 SNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEG 28220

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               YE  + A NA G+   S  SR      P+    PPT++ V   + TTV++ W  P   
Sbjct: 28221 NEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFD 28280

Query: 745   GAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDA 804
             G   + GY++E C                       DW   N +   KT++T+T L    
Sbjct: 28281 GGMEIIGYIIEMC------------------KADLGDWHKVNAEACVKTRYTVTDLQAGE 28322

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   RV A+N AG  +    +  I   + +  P++ I  + KQT++ R G ++ L I +Q
Sbjct: 28323 EYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQ 28382

Query: 865   GKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 924
             G+P P   W K  + +   + +I  +++ + + +    R+ +GKY L V+ +   ++ + 
Sbjct: 28383 GRPTPTAVWSKPDSNLSL-RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITF 28441

Query: 925   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 984
              ++++D PGPP  +  +DV   +  L W  P  DG A I  Y ++K +     W  + E 
Sbjct: 28442 TVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEK 28501

Query: 985   YHRTSATITELVIGNEYYFRVFSENMCGLSEDATM 1019
               R    + +L  G  YYFRV + N  G+ E   M
Sbjct: 28502 CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEM 28536



 Score =  185 bits (470), Expect = 2e-46
 Identities = 172/692 (24%), Positives = 288/692 (41%), Gaps = 92/692 (13%)

Query: 373   KWFKNGEEIIP-----------GPKSRYRIRVEGKKHILIIEGATKA-------DAAEYS 414
             +W +  E ++P           G + ++R+R E    I     AT         DA +  
Sbjct: 14625 RWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI 14684

Query: 415   VMTT-----GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC---------EISENI 460
             + T+     G + +   S+   P   +T + D+ V + +EI  +          E+ E  
Sbjct: 14685 LRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEE 14744

Query: 461   PGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN--VTLPAKVHV 518
             P       LP+ +   +    KG   +L + ++L  D G Y+   +  +     P  V V
Sbjct: 14745 PFV-----LPLTQRLSIDNSKKGE-SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +D P   ++ +  D   T +             EPP       G   I+  +   + ++ 
Sbjct: 14799 LDTPGPPINFVFEDIRKTSVL---------CKWEPP----LDDGGSEIINYTLEKKDKTK 14845

Query: 579   PDSSTLVIDIAERD-----------DSGVYHINLKNEAGEAHASIKVKVVDF-----PDP 622
             PDS  +V+    R               ++ +  +N  G     +   +V       PD 
Sbjct: 14846 PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDA 14905

Query: 623   PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPK 682
             P  P V +V  +  ++ W  P  D GSPILGY++E+++  S+ W R+N  L         
Sbjct: 14906 PDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVD 14964

Query: 683   KMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP--PTLLTVDSVTDTTVTMRWRP 740
              ++EG+ Y  R+ A NA G  K S PS P       SP  P +  V   + TT+ + W P
Sbjct: 14965 GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEP 15024

Query: 741   PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
             P   G   + GY ++    G+                   +W    + +I   ++T+  +
Sbjct: 15025 PAFNGGGEIVGYFVDKQLVGT------------------NEWSRCTEKMIKVRQYTVKEI 15066

Query: 801   PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
                A   +RV AVNAAG   P   +QP+ V E  EPP + +   +K       G+ + + 
Sbjct: 15067 REGADYKLRVSAVNAAGEGPPG-ETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIP 15125

Query: 861   IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
                 G+P P   W K+  E+DK+++ I N  T + + I+ A R   G+Y +        +
Sbjct: 15126 AVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSK 15185

Query: 921   TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 980
              A+  +++ D PGP   +K      +   L W+ P+DDG + ITG+ I++ D K   W  
Sbjct: 15186 FAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ 15245

Query: 981   VIEHYHRTSATITELVIGNEYYFRVFSENMCG 1012
              IE   R+   IT L+ G EY FRV ++N  G
Sbjct: 15246 PIE-TERSKCDITGLLEGQEYKFRVIAKNKFG 15276



 Score =  184 bits (467), Expect = 4e-46
 Identities = 177/720 (24%), Positives = 313/720 (43%), Gaps = 79/720 (10%)

Query: 344   VTKQLEDTTAYCGERVELECE-VSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
             + K+++D T   GE  +L C+ V     ++KW++ G+E+I   K  Y++  +G+ H L +
Sbjct: 30535 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRK--YKMSSDGRTHTLTV 30592

Query: 403   EGATKADAAEYSVMTTGG----QSSAKLSVDLKP-LKILTPLTDQTVN-LGKEICLKCE- 455
                 + D   Y+ + T      ++S+KL +   P      PL ++    +G  + L    
Sbjct: 30593 MTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMY 30652

Query: 456   ISENIPGK-WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
             I   +P   W      +Q S+ + + +      LV+ N   +           Y V L  
Sbjct: 30653 IGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAG------KYKVQLSN 30706

Query: 515   KVHVIDPPKIILDGLDADN----TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME-- 568
                 +D    ILD    D     T  ++    L+    IS +PP     S     ++E  
Sbjct: 30707 VFGTVDA---ILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKC 30763

Query: 569   -----GSGRIRTESYPDSSTLVIDIAERDDSGVY-HINLKNEAG-----EAHASIKVKV- 616
                     ++ + +   ++  ++++ E  ++G Y  ++ +N  G     E  + + +K  
Sbjct: 30764 EAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 30821

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
              + P  P  PT+T V  D C++ W+PPA DGG+ I  Y++E+++K+ ++W+ +  +  +E
Sbjct: 30822 FEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 30881

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             T F  K +IEG+ YE R+   N  G S+ S  S P  P +          + + +  V  
Sbjct: 30882 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRY 30941

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEG----STSAKQSDENGEAAYDLPAEDWIVANKDLIDK 792
             +          G    ++++  +G    +   K   +  +  Y                 
Sbjct: 30942 QSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYH---------------- 30985

Query: 793   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 852
              +  I  +  D     +V+A N  G+             E+  P KI +P+ L+      
Sbjct: 30986 -QLIIASVTDDDATVYQVRATNQGGSVSGT------ASLEVEVPAKIHLPKTLEGMGAVH 31038

Query: 853   V--GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSG 907
                GE V++ IPF GKP P +TW+K    ID N   Q+ +  S T +++F    ER  +G
Sbjct: 31039 ALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFT-SLVFPNGVERKDAG 31097

Query: 908   KYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYT 967
              Y +  K    ++  ++++ + D P PP+ VK+ DV  ++V LTWT P  DG + IT Y 
Sbjct: 31098 FYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYI 31157

Query: 968   IQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKE 1022
             ++K    +  W  V      T  T+  L     Y FRV +EN  GLS+     + T+TKE
Sbjct: 31158 VEKCATTAERWLRV-GQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 31216



 Score =  179 bits (455), Expect = 1e-44
 Identities = 207/904 (22%), Positives = 363/904 (40%), Gaps = 97/904 (10%)

Query: 270  VRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDE 329
            + F V +    +  KW KNG EI+ + K     K     L I N    D ++Y   AG  
Sbjct: 2986 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 3045

Query: 330  KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRY 389
              +  L+V    I   K ++D      +R   ECEVSE D  V+W K+ +E+      R 
Sbjct: 3046 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRI 3103

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
            +I+ E   H L+I     +DA +Y+V+  G  S+AKL V+ + ++I +   +  V   + 
Sbjct: 3104 KIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3163

Query: 450  ICLKCEISE-NIPGKWTKNGLPV--QESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD 506
              ++ E++E ++   W K+G+ +  Q  +R K V + RIH++ I+     D G+Y F   
Sbjct: 3164 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3223

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                ++   V+  +PP++    L     VTV +G   R    ISG P PK  W + ++ +
Sbjct: 3224 RNRSSVTLYVNAPEPPQV----LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL 3279

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG----EAHASIKVKVVDFPD- 621
              G  + +        TL++  A  +D+ VY    KN+ G     A  S++V  V  PD 
Sbjct: 3280 STGF-KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3338

Query: 622  --PPVAPTVTEVGDDWCIMNWEPPAY----DGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
              P   P +     D      +P  +     G    + ++ + KK + SR+ R+      
Sbjct: 3339 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM------ 3392

Query: 676  ETTFEPKKMIE-GVAY-----EVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSV 729
             T FE    +E   AY          A NA+G    +        L++ +P ++L     
Sbjct: 3393 -TQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSST------ANLSLEAPESILHERIE 3445

Query: 730  TDTTVTMRWRPPDHIGAAGLD---GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVAN 786
             +  + M+  P        L+   G++ ++     T   QS  N           W  A 
Sbjct: 3446 QEIEMEMKAAPVIKRKIEPLEVALGHLAKF-----TCEIQSAPNVRF-------QWFKAG 3493

Query: 787  KDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ--------PILVKEIIEPPK 838
            +++ +  K +I      + + +    V   G    K  ++         + V E   P  
Sbjct: 3494 REIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTF 3553

Query: 839  IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIF 897
            +  P+ L       VG+A   +    G P  E  W+KDGA +  +    I ++E   I+ 
Sbjct: 3554 LSRPKSLTTF----VGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILE 3609

Query: 898  IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-PPQIVKIEDVWGENVALTWTPPK 956
            +        G Y  +       +    ++ IID+P    ++  ++    + V L     +
Sbjct: 3610 LSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDE 3669

Query: 957  DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSED 1016
            D               K ++ W          S    +L  G +Y    F + +  L   
Sbjct: 3670 D--------------RKVTVTW----------SKDGQKLPPGKDYKI-CFEDKIATLEIP 3704

Query: 1017 ATMTKESA--VIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTY-AIAGYNATLNCSVRGN 1073
                K+S   V     +   +         E P F + +  +Y  + G +A L+C ++G+
Sbjct: 3705 LAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGS 3764

Query: 1074 PKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECK 1133
            P  ++TW KN   + +    RM+       L+I      D G+Y C+AVND+G+     +
Sbjct: 3765 PVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTE 3824

Query: 1134 LEVK 1137
            + +K
Sbjct: 3825 IVIK 3828



 Score =  169 bits (427), Expect = 2e-41
 Identities = 165/704 (23%), Positives = 284/704 (40%), Gaps = 93/704 (13%)

Query: 350   DTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
             D    CGE V E + EV+  +   KW+             YR++   +      +GA+K 
Sbjct: 13632 DKWVACGEPVAETKMEVTGLEEG-KWYA------------YRVKALNR------QGASKP 13672

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTK 466
                   +     Q + ++ +D+K L  LT      V  G +I L   ++     K  WTK
Sbjct: 13673 SRPTEEIQAVDTQEAPEIFLDVKLLAGLT------VKAGTKIELPATVTGKPEPKITWTK 13726

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHVIDP- 521
               + +++  R+ + +  +   + I ++   D G Y+   +A NV    T   +V+V+D  
Sbjct: 13727 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII--EAVNVCGRATAVVEVNVLDKP 13784

Query: 522   -PKIILDGLDADNTVTVIAGNKLR-------LEIPISGEPPPKAMWSRGDKAIMEGSGRI 573
              P    D  D  N   ++  N  R           +        +W +    + + + + 
Sbjct: 13785 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFK- 13843

Query: 574   RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
              T+  P+   +    AE     +Y +    +A    A  +    D P PP     +++  
Sbjct: 13844 ATKLIPNKEYIFRVAAE----NMYGVGEPVQASPITAKYQ---FDPPGPPTRLEPSDITK 13896

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             D   + W  P  DGGSPI GY++ER    + +W+R N    K+TT+  K +     Y  R
Sbjct: 13897 DAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFR 13956

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + A N  G  KPS  + P +   P+    PP   TV  V  T+V + W  P+H G A ++
Sbjct: 13957 VLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE 14016

Query: 751   GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 810
              YV+E    G+                  ++W+   +  +  T+  + GL    +   RV
Sbjct: 14017 SYVIEMLKTGT------------------DEWVRVAEG-VPTTQHLLPGLMEGQEYSFRV 14057

Query: 811   KAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP- 869
             +AVN AG SEP   S P+L +E + PP    PR L+   I +    +   +P +    P 
Sbjct: 14058 RAVNKAGESEPSEPSDPVLCREKLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPI 14115

Query: 870   -----------ELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 918
                           W+     +   +  +      ++   R A  +  G+ D        
Sbjct: 14116 TNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTE----- 14170

Query: 919   VETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEW 978
             +E + +       PGPP  + + DV   +V L W PPK+DG   I  Y I+K ++    W
Sbjct: 14171 IEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRW 14230

Query: 979   FTVIEHY-HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
                 +      +  +T+++ G E  F+V +EN  G+   +  T+
Sbjct: 14231 VKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTE 14274



 Score =  167 bits (423), Expect = 5e-41
 Identities = 128/513 (24%), Positives = 216/513 (42%), Gaps = 72/513 (14%)

Query: 28   AGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLL 87
            AG+   K    ++  P    A + A     + F+ +PQ   V      TFIAKV  + + 
Sbjct: 8424 AGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPI- 8482

Query: 88   RKPTIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYK 147
              P +KW KGKW  L       +        H +    +++I       +G YRC    +
Sbjct: 8483 --PNVKWTKGKWRQLNQGGRVFI--------HQKGDEAKLEIRDTTKTDSGLYRCVAFNE 8532

Query: 148  DKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREV--KQQEEE 205
                  + +L+V E                    +++  E D   +LK+  +  K   EE
Sbjct: 8533 HGEIESNVNLQVDERK------------------KQEKIEGDLRAMLKKTPILKKGAGEE 8574

Query: 206  PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLK-------------------RLKRMRR 246
             ++D+ ELLKN  P EYEK A  YGITD RG+L+                    ++R  R
Sbjct: 8575 EEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIERSER 8634

Query: 247  EEKKSAAFAKIL-------DPAYQV----------DKGGRVRFVVELADPKLEVKWYKNG 289
            +EK+       +       +P   +          D        +++  P++++ WYK  
Sbjct: 8635 DEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGT 8694

Query: 290  QEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLE 349
            +++ PS K+     G +  L + NCQ+ D   Y +  G    S +L V EP     + L+
Sbjct: 8695 EKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEP--AWERHLQ 8752

Query: 350  DTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKAD 409
            D T   G+   + C+ S  +   +WF+NG   I  P+ R++  VE K H L I      D
Sbjct: 8753 DVTLKEGQTCTMTCQFSVPNVKSEWFRNGR--ILKPQGRHKTEVEHKVHKLTIADVRAED 8810

Query: 410  AAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNG 468
              +Y+      ++SA+L ++ +P++    + +  V+  +    +CE+S ++    W K  
Sbjct: 8811 QGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGP 8870

Query: 469  LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
              + ES +    + GR H + I N   +DEG Y
Sbjct: 8871 TELTESQKYNFRNDGRCHYMTIHNVTPDDEGVY 8903



 Score =  162 bits (411), Expect = 1e-39
 Identities = 110/364 (30%), Positives = 175/364 (48%), Gaps = 16/364 (4%)

Query: 264   VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
             V  G    F  EL+   + V+WY  G+++ PS K +   +G    L + + ++ D  E  
Sbjct: 12207 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 12266

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
             +TA D K    LFV+EPP+  TK LED T   G    LECEVS ++A VKWFKNG EI+ 
Sbjct: 12267 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 12326

Query: 384   GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
               K  Y I  +G+   L+I   T  D   Y+      ++S  L+V    ++ L PLTD  
Sbjct: 12327 SKK--YEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ 12384

Query: 444   VNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
             V   +    +CE+S EN   KW K+G  +++  +  ++ KG +  LVI   L +DE +Y 
Sbjct: 12385 VREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY- 12443

Query: 503   FAPDAYNVTLPAKVHVIDPPKII---LDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
              + +         + V++   +    L  ++   T T+    KL  E+    +P  + +W
Sbjct: 12444 -SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTI----KLVCEV---SKPGAEVIW 12495

Query: 560   SRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
              +GD+ I+E +GR    +      LVI  A  +D+G Y+  L +   +    +     +F
Sbjct: 12496 YKGDEEIIE-TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEF 12554

Query: 620   PDPP 623
                P
Sbjct: 12555 ISKP 12558



 Score =  152 bits (383), Expect = 2e-36
 Identities = 107/326 (32%), Positives = 162/326 (49%), Gaps = 37/326 (11%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +DPP+I +D    D T+ V AG   +++  I G+P P   W +GD+ +   + R+  +S 
Sbjct: 22538 VDPPRISMDPKYKD-TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKST 22595

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV-TEVGDDWCI 637
               +++L +  A R DSG Y +  KN AGE   ++ VKV+D P PP  P V + V  + C 
Sbjct: 22596 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCT 22655

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL----CKETTFEPKKMIEGVAYEVR 693
             + W+PP  DGGS I+ Y +ER++     W  ++ ++    CK T     K++EG  Y  R
Sbjct: 22656 LAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVT-----KLLEGNEYTFR 22710

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             I AVN  G+ +P + S P V   P  V   P    V +VT  ++ + W  P   G + + 
Sbjct: 22711 IMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEIL 22769

Query: 751   GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 810
             GYVLE          + D+ G          W   +K LI + +  +TGL  +     RV
Sbjct: 22770 GYVLE----------KRDKEGIR--------WTRCHKRLIGELRLRVTGLIENHDYEFRV 22811

Query: 811   KAVNAAGASEPKYYSQPILVKEIIEP 836
              A NAAG SEP   S P   ++  +P
Sbjct: 22812 SAENAAGLSEP---SPPSAYQKACDP 22834



 Score =  150 bits (380), Expect = 5e-36
 Identities = 213/914 (23%), Positives = 352/914 (38%), Gaps = 109/914 (11%)

Query: 254  FAKILDPAYQVDKGGRVRFVVELA-DPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFIN 312
            F K L+P+  V +    R+  ++   P+++V WYK+  EI+ S+K+         +L ++
Sbjct: 7307 FIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMH 7366

Query: 313  NCQMTDDSEY----YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SE 367
            N  + D  +Y    +  AG    ST L V+EPPI   K+        G  V LECE+   
Sbjct: 7367 NLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIF-RKKPHPIETLKGADVHLECELQGT 7425

Query: 368  DDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG--GQSSAK 425
               +V W+K+  E+  G K  Y+I  E     + I     AD  EY    T   G  +  
Sbjct: 7426 PPFHVSWYKDKRELRSGKK--YKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCV 7483

Query: 426  LSVDLK-PLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKN-GLPVQESDRLKVVH 481
             S+ LK P + +  L+D +  +GKE+ L+  I  +E I   W K+ G  V+ESD + + +
Sbjct: 7484 GSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISY 7543

Query: 482  KGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIA 539
               I  L  +     + G Y      DA      A + V++P  I+    +   ++ V  
Sbjct: 7544 SENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIV----EKPESIKVTT 7599

Query: 540  GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            G+   LE  ++G P     W +  K  +    + +   +   S L I      DSGVY  
Sbjct: 7600 GDTCTLECTVAGTPELSTKWFKDGKE-LTSDNKYKISFFNKVSGLKIINVAPSDSGVYSF 7658

Query: 600  NLKNEAGEAHASIKVKVVDFPDPP--VAPTVTEVGDDWCIMNWEPPAYDGGSPI-LGYFI 656
             ++N  G+   +  ++V D   PP          G     +  E   Y G  PI + +F 
Sbjct: 7659 EVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVY-GSPPISVSWFH 7717

Query: 657  ERKKKQSSRWMR--LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVP 714
            E  +  S R  +  L  + C  T      + E  + +    A N  G  + S       P
Sbjct: 7718 EGNEISSGRKYQTTLTDNTCALTV---NMLEESDSGDYTCIATNMAGSDECS------AP 7768

Query: 715  LAVTSPPTLL----TVDSVTDTTVT----MRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
            L V  PP+ +     +D +T T VT    ++  PP  +             F+GS+    
Sbjct: 7769 LTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVS-----------WFKGSSELVP 7817

Query: 767  SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
             D    +  D       VA  +L D      T    +    V  +A  A+  +     + 
Sbjct: 7818 GDRCNVSLED------SVAELELFD----VDTSQSGEYTCIVSNEAGKASCTTHLYIKAP 7867

Query: 827  PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-I 885
               VK +               Y    G+ + L   F G P   +TWKK+G  +  +Q  
Sbjct: 7868 AKFVKRL-------------NDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRC 7914

Query: 886  NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-----PPQIVKI 940
            NI  +E   I+ I  +    +G+Y+  ++     ++ S  I I++ P       P  V +
Sbjct: 7915 NITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSV 7974

Query: 941  EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 1000
             D       L  TP          G +  K D K     T   H+    AT+        
Sbjct: 7975 GDSASLQCQLAGTPE--------IGVSWYKGDTKLRPTTTYKMHFRNNVATL-------- 8018

Query: 1001 YYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIA 1060
                VF++     S +     E++V    G++  +      +    P F++ L +     
Sbjct: 8019 ----VFNQVDINDSGEYICKAENSV----GEVSASTFLTVQEQKLPPSFSRQLRDVQETV 8070

Query: 1061 GYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1120
            G     +C++ G+    ++W K+   + D P  +        TL I K      G Y C 
Sbjct: 8071 GLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCT 8130

Query: 1121 AVNDLGTVEIECKL 1134
            A N +G+     +L
Sbjct: 8131 ATNPIGSASSSARL 8144



 Score =  150 bits (379), Expect = 7e-36
 Identities = 100/328 (30%), Positives = 160/328 (48%), Gaps = 26/328 (7%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P++ L G+     V   AG+ +++EIP+ G P P   W +GD+ I++ + R+  E+   S
Sbjct: 21063 PELDLRGI-YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQ-ILKQTQRVNFETTATS 21120

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             + L I+   R DSG Y +  +N  GE    I ++V D P PP  P    EV  D+   +W
Sbjct: 21121 TILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSW 21180

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGG PI  Y +E ++  S+ W+ L   + + TT++  ++  G+ Y+ R+ A N  
Sbjct: 21181 DPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRY 21239

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+  P + S   V   P  V  PP    V +VT  ++T+ W  P   G + + GY +E  
Sbjct: 21240 GVG-PGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVE-- 21296

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                     + + NG          W   +K L+    F  +GL        RV A N AG
Sbjct: 21297 --------RKERNGIL--------WQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAG 21340

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHL 845
              S+P   S+P+L  + I+PP   +P ++
Sbjct: 21341 KSKPSKPSEPMLALDPIDPPGKPVPLNI 21368



 Score =  150 bits (379), Expect = 7e-36
 Identities = 103/337 (30%), Positives = 165/337 (48%), Gaps = 25/337 (7%)

Query: 506   DAYNVTLPAKV-HVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D   + LP  +   ++PP+I +    + +TV V AG+ L+++IPISG+P PK   SR D 
Sbjct: 26457 DPRELLLPVLIKEQLEPPEIDMKNFPS-HTVYVRAGSNLKVDIPISGKPLPKVTLSR-DG 26514

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R  TE   ++ T+ +  +   D+G Y I   N +G   A I + V+D P PP 
Sbjct: 26515 VPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPT 26574

Query: 625   APTV-TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P V +++ ++   + WEPP YDGGS +  Y + +++  ++ W  ++  + + T  +  K
Sbjct: 26575 GPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVAR-TMMKVMK 26633

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  GIS    S      +P     PP+   V +VT  ++T+ W  P
Sbjct: 26634 LTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 26693

Query: 742   DHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
                G + + GY LE            D N           W  ANK +I  T F +T + 
Sbjct: 26694 VSNGGSAVVGYHLE----------MKDRNSIL--------WQKANKLVIRTTHFKVTTIS 26735

Query: 802   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
                    RV A NAAG  +P + S+P+L  +  EPP+
Sbjct: 26736 AGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPR 26772



 Score =  149 bits (377), Expect = 1e-35
 Identities = 148/568 (26%), Positives = 234/568 (41%), Gaps = 60/568 (10%)

Query: 360   ELEC-EVSEDDANVKWFK----NGEEII-----------PGPKSRYRIRVEGKKHILIIE 403
             ELE   +S+D   ++W K     G+EI+              K   + R++ K+    I 
Sbjct: 30436 ELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ--FTIG 30493

Query: 404   GATKADAAEYSVMT---TGGQSSAKLSVDLKPLK-------ILTPLTDQTVNLGKEICLK 453
             G  +A   E+ V     TG     + ++ +K          I   + D T  LG+   L 
Sbjct: 30494 GLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLS 30553

Query: 454   CEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYN 509
             C+I    +P  KW + G  + +S + K+   GR H L +     EDEG Y  +   +   
Sbjct: 30554 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 30613

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             V   +K+ +   P+    G           G+ LRL +   G P P   W  G K +++ 
Sbjct: 30614 VETSSKLLLQATPQFH-PGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK-LLQN 30671

Query: 570   SGRIRTESYPDSSTLVI-DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
             S  I  E+    + LV+ ++  +  +G Y + L N  G   A + V++ D PD P  P V
Sbjct: 30672 SENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV 30731

Query: 629   TE-VGDDWCIMNWEPPAYDGGSPILGYFIER-KKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              E +  +  +++W+PPA DGGS I  Y +E+ + K+ + W +L       TT     + E
Sbjct: 30732 IEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEW-QLVSSAISVTTCRIVNLTE 30790

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
                Y  R+ A N  GIS P   S   +   P      P   T+ +VT  +  + W+PP  
Sbjct: 30791 NAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPAS 30850

Query: 744   IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTD 803
              G A +  Y LE         ++  +N           WI    + I +T F++  L   
Sbjct: 30851 DGGAKIRNYYLE--------KREKKQN----------KWISVTTEEIRETVFSVKNLIEG 30892

Query: 804   AKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPF 863
              +   RVK  N  G SE    S+PI  K  +          L+   +R    A  LV   
Sbjct: 30893 LEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNA-TLVCKV 30951

Query: 864   QGKPRPELTWKKDGAEIDKNQINIRNSE 891
              G P+P + W + G EI  + +  R  E
Sbjct: 30952 TGHPKPIVKWYRQGKEIIADGLKYRIQE 30979



 Score =  148 bits (373), Expect = 3e-35
 Identities = 104/358 (29%), Positives = 163/358 (45%), Gaps = 33/358 (9%)

Query: 491   ANALTEDEGDYVFAPDAYNVT---LPAKVHVIDPPKIILDGLDA----DNTVTVIAGNKL 543
             A  LTE + +Y F   A N      P+++ V+    ++   LD     D        +  
Sbjct: 19942 AKDLTEGK-EYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF 20000

Query: 544   RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN 603
             RL+IPI G+P P   W +G+  +   + R+  ES   ++TL++   ++ D+G Y I LKN
Sbjct: 20001 RLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKN 20059

Query: 604   EAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
              AG    +I +KVV  P  P  P    EV  +   + W PP  DGGS I  Y +E++   
Sbjct: 20060 VAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSV 20119

Query: 663   SSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             +++W+       ++TTF   ++ EG+ Y  R+ A N  G+ +  + S P V   P  V  
Sbjct: 20120 NNKWVTCA-SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPD 20177

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
              P    +  V   +V++ W  P   G + + GY LE+    S                  
Sbjct: 20178 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL---------------- 20221

Query: 780   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 837
               W  ANK  I    F +TGL    +   RV A+N AG  +P   S+P++  + I+PP
Sbjct: 20222 --WKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 20277



 Score =  145 bits (365), Expect = 3e-34
 Identities = 110/374 (29%), Positives = 173/374 (46%), Gaps = 19/374 (5%)

Query: 263   QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             QV +    RF  EL+    +VKW+K+G EI+   KY    KG  RIL IN C + D++EY
Sbjct: 12384 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 12443

Query: 323   YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII 382
                    + S  L V E   + TK L +      + ++L CEVS+  A V W+K  EEII
Sbjct: 12444 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 12503

Query: 383   PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 442
                  RY I  EG+K IL+I+ A   DA  Y+      ++  K+ V     + ++   + 
Sbjct: 12504 --ETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL 12561

Query: 443   TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
              +  G++    C IS E+ P +W ++   ++  D+  V+  G+   LV+ +A  +D G Y
Sbjct: 12562 EILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTY 12621

Query: 502   VF----APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKA 557
             V     A  A ++T+  K+ ++ P K        D  V          E+   G    KA
Sbjct: 12622 VVMVGAARAAAHLTVIEKLRIVVPLK--------DTRVKEQQEVVFNCEVNTEG---AKA 12670

Query: 558   MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV 617
              W R ++AI + S  I  +      TL I  A  DD   Y+++L N  GE   S    +V
Sbjct: 12671 KWFRNEEAIFDSSKYIILQK-DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV 12729

Query: 618   DFPDPPVAPTVTEV 631
             +  D  +   + ++
Sbjct: 12730 EEEDLRIVEPLKDI 12743



 Score =  144 bits (364), Expect = 4e-34
 Identities = 208/930 (22%), Positives = 366/930 (39%), Gaps = 128/930 (13%)

Query: 249  KKSAAFAKILDPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
            ++  +F K +DP+Y +  G   R   +L   P ++V W+KN +E+  S          + 
Sbjct: 3734 REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEA 3793

Query: 308  ILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
            IL I + ++ D   Y   A    G + CSTE+ ++EPP  + K LE      G    L+C
Sbjct: 3794 ILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFI-KTLEPADIVRGTNALLQC 3852

Query: 364  EVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE--GATKADAAEYSVMTTG- 419
            EVS      + WFK+ ++I    +S  + R+  +K ++ +E      AD  EY  +    
Sbjct: 3853 EVSGTGPFEISWFKDKKQI----RSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANE 3908

Query: 420  -GQSSAKLSVDLKPLKILTPLTDQTVNLGKE-ICLKCEI--SENIPGKWTKNGLPVQESD 475
             G+     +  LK         D  + LG + + L+  +  SE I   W K    ++E  
Sbjct: 3909 VGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDG 3968

Query: 476  RLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADN 533
            ++K+     +  L+I +      G Y    +  A + T   ++ V +P KII    +   
Sbjct: 3969 KIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKII----ERAE 4024

Query: 534  TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
             + V AG+   LE  ++G P  K  W +  + ++  S + R     + + L    AE  D
Sbjct: 4025 LIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLV-ASKKYRISFKNNVAQLKFYSAELHD 4083

Query: 594  SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAP----TVTEVGDDWCIMNWEPPAYDGGS 649
            SG Y   + NE G +       V+D    P        V  V +  C ++ +     G  
Sbjct: 4084 SGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCK---IAGSL 4140

Query: 650  PI-LGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
            P+ + +F + K+  +S   R+ F +    + E  ++    A      A N++G SK S  
Sbjct: 4141 PMRVSWFKDGKEIAASDRYRIAF-VEGTASLEIIRVDMNDAGNFTCRATNSVG-SKDSSG 4198

Query: 709  SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSD 768
            +     L V  PP+ +T     D             G+A      L+  F+GST      
Sbjct: 4199 A-----LIVQEPPSFVTKPGSKDVLP----------GSA----VCLKSTFQGSTPLTIR- 4238

Query: 769  ENGEAAYDLPAEDWIVANKDLIDKTKFTIT--GLPTDAKIFV---------RVKAVNAAG 817
                         W   NK+L+      IT   L +  ++++           K  N AG
Sbjct: 4239 -------------WFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAG 4285

Query: 818  ASEPK---YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWK 874
              E     +  +P    E +EP ++     LK+      G+A  L     G P  ++TW 
Sbjct: 4286 GVECSANLFVKEPATFVEKLEPSQL-----LKK------GDATQLACKVTGTPPIKITWF 4334

Query: 875  KDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP- 932
             +  EI + ++  +   E+  ++ +       SG+Y  + + +   +  S  + + + P 
Sbjct: 4335 ANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPY 4394

Query: 933  -----GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 987
                  P +++K  DV      +  TPP +     IT +      +   ++ T I+  H 
Sbjct: 4395 FTKEFKPIEVLKEYDVM-LLAEVAGTPPFE-----ITWFKDNTILRSGRKYKTFIQD-HL 4447

Query: 988  TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1047
             S  I + V  +        E  C ++ +   +  SA +                  E P
Sbjct: 4448 VSLQILKFVAADA------GEYQCRVTNEVGSSICSARVT---------------LREPP 4486

Query: 1048 MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIR 1107
             F + + +T ++ G  A    +++G+    +TW+K+   I +D   RM     V +L + 
Sbjct: 4487 SFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLS 4546

Query: 1108 KPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
                   G Y C+A ND G       L VK
Sbjct: 4547 GIEVKHDGKYVCQAKNDAGIQRCSALLSVK 4576



 Score =  143 bits (360), Expect = 1e-33
 Identities = 99/322 (30%), Positives = 145/322 (45%), Gaps = 23/322 (7%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ID P   LD    D  + V AG    LE  I G+P P  +WS+  K + E + R+  +S 
Sbjct: 24702 IDAPNASLDPKYKD-VIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 24760

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCI 637
                +TLV+    R D G Y + L N  G     I VKV+D P PP  P  VT V  + C 
Sbjct: 24761 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 24820

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + W PP  DGG+ I  Y IE+++     W +++ ++ +   ++  K++ G  Y  R+ AV
Sbjct: 24821 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAV 24879

Query: 698   NAIGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             N  GI +P  S P     P     PP+   V ++T  ++ + W  P   G   ++GY+LE
Sbjct: 24880 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILE 24939

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
                       + D+ G          W   NK  +   +  +TGL        RV A NA
Sbjct: 24940 ----------KRDKEGVR--------WTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENA 24981

Query: 816   AGASEPKYYSQPILVKEIIEPP 837
             AG  EP   S      + + PP
Sbjct: 24982 AGVGEPSEPSVFYRACDALYPP 25003



 Score =  140 bits (352), Expect = 9e-33
 Identities = 97/357 (27%), Positives = 171/357 (47%), Gaps = 39/357 (10%)

Query: 496   EDEGDYVF---APDAYNVTLPAK----VHVID---PPKIILDGLDADNTVTVIAGNKLRL 545
             E++  Y F   A  A N++ P++    V ++    PP+I L  +   + +TV AG  + L
Sbjct: 19257 EEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS-VAMKSLLTVKAGTNVCL 19315

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
             +  + G+P P   W + D  +++ +  I+     +  TL +    R DSG Y I  +N +
Sbjct: 19316 DATVFGKPMPTVSWKK-DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSS 19374

Query: 606   GEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSR 665
             G   A+IK+KV+D P PP +  + ++  D  +++WEPP  DGGS I  Y +++++     
Sbjct: 19375 GSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPN 19434

Query: 666   WMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGI-----SKPSMPSRPFVPLAVTSP 720
             W +++  +   T+   +K+IEG  Y+ RI A N  G+     ++P++   P+ P     P
Sbjct: 19435 WAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 19493

Query: 721   PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE 780
             P    + ++T   +T+ W+PP   G + + GY+LE                    +  A 
Sbjct: 19494 P---VISNITKDHMTVSWKPPADDGGSPITGYLLE------------------KRETQAV 19532

Query: 781   DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 837
             +W   N+  I +     TGL    +   RV A+N AG  +P   S+    ++   PP
Sbjct: 19533 NWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP 19589



 Score =  137 bits (344), Expect = 8e-32
 Identities = 104/360 (28%), Positives = 172/360 (47%), Gaps = 10/360 (2%)

Query: 272   FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
             F VEL+   + VKW+KN Q +  +     + +G    +   +  + D S+  V A     
Sbjct: 11948 FTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSS 12007

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
               +L V E     T +L+D T    + V L+CE+S+ DA VKWFK+G+EI P   +   I
Sbjct: 12008 EAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNA--VI 12065

Query: 392   RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             + +GKK +LI++ A K+D  +Y+      ++S KL ++ + +K++ PL    V   +   
Sbjct: 12066 KADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETAR 12125

Query: 452   LKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
              + EISE +I   W   G  + ++   ++  +G+IH LV+ N   +  G   F   A NV
Sbjct: 12126 FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANV 12183

Query: 511   TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                A + V   P++I   L     VTV AG     +  +S E  P   + +G K  +E S
Sbjct: 12184 KSSAHLRV--KPRVI-GLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKK--LEPS 12238

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
              ++   S     TL +   + +D+G   +  K+    A+  +K   V+F  P    TV E
Sbjct: 12239 DKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEE 12298



 Score =  137 bits (344), Expect = 8e-32
 Identities = 134/554 (24%), Positives = 209/554 (37%), Gaps = 88/554 (15%)

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
             +D P PP  PTV +VG     +NW  P +DGG+ I  Y IE  K  +  W+R+   +   
Sbjct: 13981 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTT 14040

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTT 733
                 P  M EG  Y  R+ AVN  G S+PS PS P +    L   SPP  L V ++T  T
Sbjct: 14041 QHLLPGLM-EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 14099

Query: 734   VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKT 793
               ++W  P+  G + +  Y++E                    D+  + W   +  + D T
Sbjct: 14100 ADLKWTVPEKDGGSPITNYIVE------------------KRDVRRKGWQTVDTTVKD-T 14140

Query: 794   KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 853
             K T+T L   +    RV A NA G S+       +L K+    P                
Sbjct: 14141 KCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTP---------------- 14184

Query: 854   GEAVNLVIPFQGKPRPELTW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYD 910
             G    L +    K   +L W   K DG    +  +  +     T    R  +   +   D
Sbjct: 14185 GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGT----RWVKAGKTAGPD 14240

Query: 911   LQVKVDKFVETASIDIQI-----------------------IDRPGPPQIVKIEDVWGEN 947
                +V   +E   +  Q+                          P PP  + + D   ++
Sbjct: 14241 CNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKH 14300

Query: 948   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE--LVIGNEYYFRV 1005
             +A+ W PP+ +G + I GY ++     + +W  V     +      E  +V   EY  RV
Sbjct: 14301 IAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRV 14360

Query: 1006  FSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT 1065
              + N  G+SE + +++   V+A+D         E  D                I G   +
Sbjct: 14361 RAVNAIGVSEPSEISEN--VVAKDPDCKPTIDLETHDI-------------IVIEGEKLS 14405

Query: 1066  LNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDL 1125
             +    R  P P ++W K+   +    R  M ++     LE+ K    D G Y     N L
Sbjct: 14406 IPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKL 14465

Query: 1126  GTVEIECKLEVKVI 1139
             G+      + VKVI
Sbjct: 14466 GSA--TASINVKVI 14477



 Score =  136 bits (343), Expect = 1e-31
 Identities = 105/376 (27%), Positives = 169/376 (44%), Gaps = 13/376 (3%)

Query: 247  EEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQ 306
            + K+   F + L      +K     F  E ++P ++VKWYK+G E+    KY        
Sbjct: 2169 QAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKV 2228

Query: 307  RILFINNCQMTDDSEY-YVTAGDE--KCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
              L I     +D  +Y  V   DE  K + +L V    +   K+L+D         ELEC
Sbjct: 2229 HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC 2288

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS 423
             VS ++   KW+ N  E+      +Y I     +  L ++  TK D  EYS +  G +++
Sbjct: 2289 IVSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT 2346

Query: 424  AKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHK 482
             KL +  +P+ IL  L+DQ V  G  + L+ ++S E++ G W K+G  VQ SDR+ +V  
Sbjct: 2347 CKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID 2406

Query: 483  GRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNK 542
             + H L+I +   ED G+Y F   A  ++   +V V       +D +     V VI G K
Sbjct: 2407 KQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-----VDVITPLKDVNVIEGTK 2461

Query: 543  LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
              LE  +S        W   D+ I +   R++         LVI+     D G Y + + 
Sbjct: 2462 AVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2520

Query: 603  NEAGEAHASI-KVKVV 617
                  + S+ K+K++
Sbjct: 2521 RVETNCNLSVEKIKII 2536



 Score =  133 bits (335), Expect = 8e-31
 Identities = 197/836 (23%), Positives = 326/836 (38%), Gaps = 110/836 (13%)

Query: 337   VREPPIMVTKQLEDTTAY-CGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
             V  P I V  + +DT     GE   LE +VS      ++W K+G+E+     ++  I++ 
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL--EGTAKLEIKIA 21513

Query: 395   GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC 454
                  L+ + +T+ D+  Y++  T     AK   ++K L    P  +  + + +    KC
Sbjct: 21514 DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP-PEGPLAVTEVTSEKC 21572

Query: 455   EISENIP-----GKWTKNGLPVQESDRL---KVVHKGRIHKLVIANALTEDEGDY-VFAP 505
              +S   P      K     +  +E+ RL    V  + ++ KL +   L  +E  + V A 
Sbjct: 21573 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV 21632

Query: 506   DAYNVTLPAKVHVI---------DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             + Y V  P +   +         DPPK        +  VT I  + +   +   G P   
Sbjct: 21633 NKYGVGEPLESEPVLAVNPYGPPDPPK--------NPEVTTITKDSM---VVCWGHPDSD 21681

Query: 557   A-------MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                     +  R DKA      +   ++  D    V  + E  +   + I  +N AG   
Sbjct: 21682 GGSEIINYIVERRDKAGQRWI-KCNKKTLTDLRYKVSGLTEGHEYE-FRIMAENAAGISA 21739

Query: 607   EAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQS 663
              +  S   K  D    P PP  P V +       + W  P YDGGS I GY +E    + 
Sbjct: 21740 PSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEE 21799

Query: 664   SRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM-PSRPFVPLAVTSPP 721
               W  +      K T++    + E   Y++RI+A+N+ G+ +P++ P  P     +  P 
Sbjct: 21800 DEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPE 21859

Query: 722   TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAED 781
               L  D     T+         +   G     +++  +   S  ++     ++Y L    
Sbjct: 21860 IELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTL---- 21915

Query: 782   WIVANKDLIDKTKF--TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII----- 834
              IV N +  D  K+  T+         FV V+ ++  G        Q + VKE+      
Sbjct: 21916 LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPP------QDLKVKEVTKTSVT 21969

Query: 835   ---EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSE 891
                +PP +     +K  YI    E+             + +WK D  +           E
Sbjct: 21970 LTWDPPLLDGGSKIKN-YIVEKRESTRKAYSTVATNCHKTSWKVDQLQ-----------E 22017

Query: 892   TDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALT 951
               +  F   AE  +         +    ETA   ++  +RP PP  + + DV   +V+L+
Sbjct: 22018 GCSYYFRVLAENEYG--------IGLPAETAE-SVKASERPLPPGKITLMDVTRNSVSLS 22068

Query: 952   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMC 1011
             W  P+ DG + I GY ++   K S +W T       T ATIT L+ G EY FRV ++N  
Sbjct: 22069 WEKPEHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFRVSAQNEK 22127

Query: 1012  GLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSV 1070
             G+S+   ++    VIA+D  I              P   + L NT+ + AG +  ++   
Sbjct: 22128 GISDPRQLSVP--VIAKDLVI--------------PPAFKLLFNTFTVLAGEDLKVDVPF 22171

Query: 1071  RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
              G P P +TW K+ V +    R    S +    L I+     D G Y  K  N  G
Sbjct: 22172 IGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG 22227



 Score =  133 bits (335), Expect = 8e-31
 Identities = 89/320 (27%), Positives = 152/320 (47%), Gaps = 26/320 (8%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P   L G+  +  +T  AG+   +++PISG P PK  W   +  + E + R+   +  D 
Sbjct: 28645 PTADLTGI-TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE-TDRVSITTTKDR 28702

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             +TL +  + R DSG Y + L+N AG    S+ V V+  P P   P  V+ V  + C+++W
Sbjct: 28703 TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSW 28762

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P   GG+ I  Y +E+++  ++ W  +N  + K T  +   + + + Y  R+ + N  
Sbjct: 28763 GEPKDGGGTEITNYIVEKRESGTTAWQLVNSSV-KRTQIKVTHLTKYMEYSFRVSSENRF 28821

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+SKP + S P +   P    S PT   V  V+   +++RW  P H G + + GY +E  
Sbjct: 28822 GVSKP-LESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVE-- 28878

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                     + + N           W+  NK    +  + +TGL    +   R  A+NAAG
Sbjct: 28879 --------KKERNTIL--------WVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAG 28922

Query: 818   ASEPKYYSQPILVKEIIEPP 837
              S+    S+PI+ +  ++ P
Sbjct: 28923 VSKASEASRPIMAQNPVDAP 28942



 Score =  132 bits (331), Expect = 2e-30
 Identities = 210/913 (23%), Positives = 358/913 (39%), Gaps = 101/913 (11%)

Query: 254  FAKILDPAYQVDKGGRVRFVVELA-DPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFIN 312
            F K L+ +  V  G   R   ++A  P++ V W++N  E+  S KY         ++ +N
Sbjct: 5425 FVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMN 5484

Query: 313  NCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            N    D  ++   A    G   CST++ V+EPP+  +      T    E V LECE+S  
Sbjct: 5485 NLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAE-VSLECELSGT 5543

Query: 369  DA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG--GQSSAK 425
                V W+K+  ++    K  Y+I  +     + I     +D  EY        G  +  
Sbjct: 5544 PPFEVVWYKDKRQLRSSKK--YKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCV 5601

Query: 426  LSVDLK-PLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPV-QESDRLKVVH 481
             +V LK P + ++ L   TV  G+   L+  I  ++ I  +W K    V +ES+ +++  
Sbjct: 5602 CTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITF 5661

Query: 482  KGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIA 539
               +  L  A A   + G Y+     D       A + V++P  I+    +    +TV  
Sbjct: 5662 VENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIV----EKAGPMTVTV 5717

Query: 540  GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            G    LE  ++G P     W +  K ++  S + +   Y   S+L I   ER D+G Y  
Sbjct: 5718 GETCTLECKVAGTPELSVEWYKDGK-LLTSSQKHKFSFYNKISSLRILSVERQDAGTYTF 5776

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-------VGDDWCIMNWEPPAYDGGSPI- 651
             ++N  G++  +    VVD  D  V P+ T        V    CI+  +     G SPI 
Sbjct: 5777 QVQNNVGKSSCT---AVVDVSDRAVPPSFTRRLKNTGGVLGASCILECK---VAGSSPIS 5830

Query: 652  LGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
            + +F E+ K  S    +  F  ++C   T +   +           A N  G  +     
Sbjct: 5831 VAWFHEKTKIVSGAKYQTTFSDNVC---TLQLNSLDSSDMGNYTCVAANVAGSDECRAVL 5887

Query: 710  RPFVPLAVTSPPTLLTV---DSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
                P +    P  L V    +VT T+V +R  PP  +             F G+    +
Sbjct: 5888 TVQEPPSFVKEPEPLEVLPGKNVTFTSV-IRGTPPFKVN-----------WFRGARELVK 5935

Query: 767  SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
             D       D  AE   + N D+    ++T             V + NA  AS     + 
Sbjct: 5936 GDRCNIYFEDTVAE-LELFNIDISQSGEYTC------------VVSNNAGQAS----CTT 5978

Query: 827  PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-I 885
             + VKE     K R+  H  +      G+++ L   + G     +TWKKDG  I  ++  
Sbjct: 5979 RLFVKEPAAFLK-RLSDHSVEP-----GKSIILESTYTGTLPISVTWKKDGFNITTSEKC 6032

Query: 886  NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP-GPPQIVKIEDVW 944
            NI  +E   I+ I  + +  +G+Y  +++ +   +     +  ++ P    ++  +E   
Sbjct: 6033 NIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAV 6092

Query: 945  GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFR 1004
            G++V+L     +  G   IT  +  K D K         ++    AT+            
Sbjct: 6093 GDSVSLQC---QVAGTPEIT-VSWYKGDTKLRPTPEYRTYFTNNVATL------------ 6136

Query: 1005 VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNA 1064
            VF++     S + T   E+++    G      V+   +    P F + L +     G   
Sbjct: 6137 VFNKVNINDSGEYTCKAENSI----GTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPV 6192

Query: 1065 TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1124
            TL C + G+   ++ W ++ V + DD   +      V TL+I +      G Y C A N 
Sbjct: 6193 TLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNP 6252

Query: 1125 LGTVEIECKLEVK 1137
            LGT     +L  +
Sbjct: 6253 LGTASSSARLTAR 6265



 Score =  131 bits (329), Expect = 4e-30
 Identities = 159/630 (25%), Positives = 262/630 (41%), Gaps = 95/630 (15%)

Query: 267   GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
             GG +R  V +   P  EVKW K   EIR +   I +       L ++N    D  +Y +T
Sbjct: 22957 GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFTSLVLDNVNRYDSGKYTLT 23014

Query: 326   AGDEKCSTELFVR-------EPPI--MVTKQLEDTTAYCGERVELECE-------VSEDD 369
               +   +   FV         PP+   VT+  +D+ +   E   L+         V + +
Sbjct: 23015 LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKRE 23074

Query: 370   ANVKWF--------KNG---EEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
             A  K +        KN    +++  G    +R+  E +  I        A  A+   +  
Sbjct: 23075 ATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI-----GLPAQTADPIKVAE 23129

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESD 475
               Q   K++VD         +T  +V+L     E     +I + I     K+     E  
Sbjct: 23130 VPQPPGKITVD--------DVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA 23181

Query: 476   RLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN-----------VTLPAKVHVIDPPKI 524
             R+K +      + VI N LT+ E +Y+F   A N           V + AK  VI+P   
Sbjct: 23182 RVKSL------QAVITN-LTQGE-EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP--- 23230

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTL 584
               D   A ++ +V  G  L++E+PISG P P   W++ D   ++ + RI      D +TL
Sbjct: 23231 --DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTK-DGLPLKQTTRINVTDSLDLTTL 23287

Query: 585   VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPP 643
              I    +DD G Y I + N  G+  ASI++  +D PDPP  P    +V  +   ++W PP
Sbjct: 23288 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPP 23347

Query: 644   AYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
              Y GG  I  Y ++++   ++ W  ++  + + TT +  K+  G  Y+ RIFA N  G S
Sbjct: 23348 LYTGGCQITNYIVQKRDTTTTVWDVVSATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQS 23406

Query: 704   KPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
               ++ S P V   P     PP      +++  ++ ++W  P + G + + GY LE     
Sbjct: 23407 F-ALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLE----- 23460

Query: 761   STSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                  + + N           W   NK +I  T+F    L    +   RV A N  G  +
Sbjct: 23461 -----RKERNSIL--------WTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGK 23507

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYI 850
                 S+  + ++  +PP    P  +K+  I
Sbjct: 23508 ASKNSECYVARDPCDPPGTPEPIMVKRNEI 23537



 Score =  131 bits (329), Expect = 4e-30
 Identities = 92/316 (29%), Positives = 146/316 (46%), Gaps = 25/316 (7%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PPK  LD     + VT+ AG+ L L+  + G+P PK +W++GDK  ++   ++  +    
Sbjct: 29043 PPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKE-LDLCEKVSLQYTGK 29101

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              +T VI   +R DSG Y + +KN +G    S+ VKV+D P P    TV+ V  + C + W
Sbjct: 29102 RATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAW 29161

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGG+ I  Y +ER++     W+ +  + C   ++   ++I+   Y  R+ AVN  
Sbjct: 29162 SLPQEDGGAEITHYIVERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKY 29220

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P + S P V      + SPP +          + ++W  P+  G   +  Y+++  
Sbjct: 29221 GPGVP-VESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKR 29279

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAA 816
              + S                    W   NKD ++  T+  +T L        RV AVNAA
Sbjct: 29280 EKKSLR------------------WTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAA 29321

Query: 817   GASEPKYYSQPILVKE 832
             G SEP   S  I  +E
Sbjct: 29322 GNSEPSEASNFISCRE 29337



 Score =  130 bits (328), Expect = 5e-30
 Identities = 80/234 (34%), Positives = 120/234 (51%), Gaps = 8/234 (3%)

Query: 272  FVVELADPKLE-VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            F VEL  P ++ V+W KNG  +  + KY    KG    L I NC + D+S Y    G   
Sbjct: 2726 FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2785

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S  L V    + + K+ +D TA     V  E  VS D   VKWF    EI P  K  +R
Sbjct: 2786 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK--HR 2841

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            +  E K H L+++  + +DA EY+ +   GQ   K  + ++ L I   + +  V   K  
Sbjct: 2842 LVSERKVHKLMLQNISPSDAGEYTAVV--GQLECKAKLFVETLHITKTMKNIEVPETKTA 2899

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              +CE+S  N+P  W KNG+ ++ S++ K+V +G++H+L+I N  TED  +Y F
Sbjct: 2900 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF 2953



 Score =  130 bits (328), Expect = 5e-30
 Identities = 197/914 (21%), Positives = 341/914 (37%), Gaps = 88/914 (9%)

Query: 249  KKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
            K+ A F + L+P+  + KG   +   ++   P +++ W+ N +EI+ S+K+         
Sbjct: 4296 KEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTA 4355

Query: 308  ILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
            +L + +  + D  EY   A    G + CS+ + V+E P   TK+ +         V L  
Sbjct: 4356 VLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYF-TKEFKPIEVLKEYDVMLLA 4414

Query: 364  EVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG--G 420
            EV+      + WFK+   +  G K  Y+  ++     L I     ADA EY    T   G
Sbjct: 4415 EVAGTPPFEITWFKDNTILRSGRK--YKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVG 4472

Query: 421  QSSAKLSVDLKPLKILTPLTDQTVNL-GKEICLKCEISENIP--GKWTKNGLPVQESDRL 477
             S     V L+         + T +L G     +  +  ++P    W K+   + E D +
Sbjct: 4473 SSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNI 4532

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKVHVIDPPKIILDGLDADNTV 535
            ++  +  +  L ++    + +G YV     DA      A + V +P  I  + +  D   
Sbjct: 4533 RMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSID--- 4589

Query: 536  TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSG 595
             V  G+   L++  SG     A W +  + +  GS + +       S L I   E+ DSG
Sbjct: 4590 -VTQGDPATLQVKFSGTKEITAKWFKDGQELTLGS-KYKISVTDTVSILKIISTEKKDSG 4647

Query: 596  VYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF 655
             Y   ++N+ G +    ++ V+D   PP      +  D       +      GS  +   
Sbjct: 4648 EYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQ 4707

Query: 656  IERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV-AYEVRIFAVNAIGISKPSMPSRPFVP 714
              +  ++ S   +  F     T F     +EG  +      A N  G ++ S        
Sbjct: 4708 WFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCS------GH 4761

Query: 715  LAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAA 774
            L V  PP  +      D     R +    +G                 + K   +N E  
Sbjct: 4762 LTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGT------------APMTIKWFKDNKELH 4809

Query: 775  YDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 834
                   W    KD    +        TD+  ++  +  N  G +  K     + VKE  
Sbjct: 4810 SGAARSVW----KDDTSTSLELFAAKATDSGTYI-CQLSNDVGTATSK---ATLFVKE-- 4859

Query: 835  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN-IRNSETD 893
             P  I+ P       + R G++        G P+  ++W  DG EI   Q + I   +  
Sbjct: 4860 PPQFIKKP---SPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGL 4916

Query: 894  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP------GPPQIVKIEDVWGEN 947
                I  A   +SG Y  + + D    + SI++++ + P       P ++VK  DV  E 
Sbjct: 4917 ATFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELE- 4975

Query: 948  VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 1007
              +T TPP +        +     + +S + +T+ +     +  IT+    +        
Sbjct: 4976 CEVTGTPPFE------VTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDT------G 5023

Query: 1008 ENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLN 1067
            E  C +S +      S  +A                 E P F + + NT  +   +AT  
Sbjct: 5024 EYQCIVSNEGGSCSCSTRVA---------------LKEPPSFIKKIENTTTVLKSSATFQ 5068

Query: 1068 CSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGT 1127
             +V G+P   ITW+K+   + +D    +     V TL+IR       G Y C+A N+ G 
Sbjct: 5069 STVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGV 5128

Query: 1128 VEIECKLEVKVIAQ 1141
                  L V+  AQ
Sbjct: 5129 ERCYAFLLVQEPAQ 5142



 Score =  130 bits (328), Expect = 5e-30
 Identities = 91/320 (28%), Positives = 147/320 (45%), Gaps = 24/320 (7%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P I+  G +  + + + +G  LR++  + G P P+  W + D   +E    +       S
Sbjct: 27955 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGS 28013

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             ++L +  A RD  GVY +  KN +G A A IKVKV D P   V P   T +  +   + W
Sbjct: 28014 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWW 28073

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             + P  DG +PI  Y IE+++     W  +  D C+  ++   K+I G  Y+ R+ AVN  
Sbjct: 28074 DAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNEYQFRVSAVNKF 28132

Query: 701   GISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
             G+ +P  S P    +   V   P +    ++T  ++T+ W  P+  G + +  Y+LE   
Sbjct: 28133 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERRE 28192

Query: 759   EGSTSAKQSDENGEAAYDLPAEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
             + ST                   W+ V +K  I +T+F +TGL    +    V A NAAG
Sbjct: 28193 KKSTR------------------WVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 28234

Query: 818   ASEPKYYSQPILVKEIIEPP 837
                    S+ I  +E + PP
Sbjct: 28235 VGPASGISRLIKCREPVNPP 28254



 Score =  128 bits (322), Expect = 3e-29
 Identities = 101/352 (28%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 264   VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
             V +G    FV EL+  K+ V W+KN  ++  S   +   +G    L +    + D S+  
Sbjct: 11585 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 11644

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
                 +   + +L V E     T +L D TA   + + L+CEVS+ D  VKWFK+GEEI+P
Sbjct: 11645 AQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWFKDGEEIVP 11703

Query: 384   GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
              PK  Y I+ +G + IL I+ A   D  EY       ++ A ++V+ + +K+  PL    
Sbjct: 11704 SPK--YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVE 11761

Query: 444   VNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
             V +G+    + E+SE ++ G+W   G P+  S   +++  G+ H L++ N      G+  
Sbjct: 11762 VFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVS 11821

Query: 503   FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
             F   A N    A + V + P I +  L   + V V   ++ + E  +S E P    W +G
Sbjct: 11822 F--QAANAKSAANLKVKELPLIFITPL---SDVKVFEKDEAKFECEVSRE-PKTFRWLKG 11875

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
              + I  G  R          ++VI  A  +D   Y      EA + H S K+
Sbjct: 11876 TQEI-TGDDRFELIKDGTKHSMVIKSAAFEDEAKYMF----EAEDKHTSGKL 11922



 Score =  127 bits (319), Expect = 6e-29
 Identities = 199/857 (23%), Positives = 322/857 (37%), Gaps = 121/857 (14%)

Query: 319   DSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAY-CGERVELECEV-SEDDANVKWFK 376
             DS   +TA DE       V  P I +  +  DT     GE   LE +V  +    ++W +
Sbjct: 23609 DSTGPITAKDE-------VELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 23661

Query: 377   NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL 436
               +EI     +R  I+    K +LI++ A + D  +Y +  +    S    V++K L   
Sbjct: 23662 GDKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 23719

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKL-------- 488
              P  +  V +      KC ++ + P +    G  +       VV K    +L        
Sbjct: 23720 GP-PEGPVQVTGVTSEKCSLTWSPPLQ--DGGSDISHY----VVEKRETSRLAWTVVASE 23772

Query: 489   VIANALTEDE----GDYVF---APDAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAG 540
             V+ N+L   +     +YVF   A + Y V  P +   V+     +L G      VT IA 
Sbjct: 23773 VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAK 23832

Query: 541   NKLRLEIPISGEPPPKAMWSRGDKA--------IMEGSGRIRTESYPDSSTLVIDIAER- 591
             + + +             W+R D          I+E   R        +   + D+  R 
Sbjct: 23833 DSMTV------------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 23880

Query: 592   -----DDSGVYHINLKNEAGEAH---ASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNW 640
                  D    + ++ +N AG      A++  K  D    P PP    + +   +   + W
Sbjct: 23881 TGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 23940

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNA 699
               P YDGGS ILGY +E  K     W  +      + T FE  K+ E   Y++R+ A+N 
Sbjct: 23941 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 24000

Query: 700   IGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             +G+ + +       P      P L  +DS     + +R        A G     + +   
Sbjct: 24001 VGLGEATSVPGTVKPEDKLEAPEL-DLDSELRKGIVVR--------AGGSARIHIPFKGR 24051

Query: 760   GSTSAKQSDENGEAAYDLPAEDWI------VANKDLIDKTKFTIT--GLPTDAKIFVRVK 811
              +     S E GE    +  E  +      + N D  D  K+ +           FV VK
Sbjct: 24052 PTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVK 24111

Query: 812   AVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 871
              ++  G        Q + VKE+ +     +    +   I    +  N VI  +   R   
Sbjct: 24112 VLDTPGPP------QNLAVKEVRKDSAFLV---WEPPIIDGGAKVKNYVIDKRESTRK-- 24160

Query: 872   TWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
              +    ++  K    + N     I + R    +  G       V   VET    ++  + 
Sbjct: 24161 AYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFG-------VGVPVETVDA-VKAAEP 24212

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
             P PP  V + DV   + +L W  P+ DG + + GY ++   K + +W  V E     +A 
Sbjct: 24213 PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAV 24271

Query: 992   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQ 1051
             +T L  G EY FRV + N  G S+   +     VIA+D  I              P    
Sbjct: 24272 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVP--VIAKDLTIQ-------------PSLKL 24316

Query: 1052  PLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPS 1110
             P  NTY+I AG +  +   V G P+P I+W+K+   +    R  +        L I++ +
Sbjct: 24317 PF-NTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGN 24375

Query: 1111  PYDGGTYCCKAVNDLGT 1127
               D G Y   A N  GT
Sbjct: 24376 KDDFGKYTVTATNSAGT 24392



 Score =  126 bits (316), Expect = 1e-28
 Identities = 125/552 (22%), Positives = 221/552 (40%), Gaps = 66/552 (11%)

Query: 597   YHINLKNEAG---EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             Y +  +N AG    +  S  ++  D    P PP  P + + G     + W  P +DGG+P
Sbjct: 26055 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 26114

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
             I GY +E KK   + W + +    + T +    +  G  Y  R+ +VN +G S PS  S 
Sbjct: 26115 ITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 26173

Query: 711   PFVPLAVTSPP----------TLLTVDSVTDT-TVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             P +       P          TL+     + T TV  R RP  ++  +  D  +    + 
Sbjct: 26174 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYV 26233

Query: 760   GSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 819
              +T ++ S         L  E+   AN++   K   TI  + + A + + VK ++  G  
Sbjct: 26234 DTTDSRTS---------LTIEN---ANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPP 26281

Query: 820   EPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE 879
                     I V+++ +   +     L        G A       + +   +  W      
Sbjct: 26282 TN------ITVQDVTKESAV-----LSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNN 26330

Query: 880   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
              ++    + N +   I + R      SG+ +  V +    ET    ++I ++P PP+ + 
Sbjct: 26331 CNRLSYKVTNLQEGAIYYFRV-----SGENEFGVGIP--AETKE-GVKITEKPSPPEKLG 26382

Query: 940   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF--TVIEHYHRTSATITELVI 997
             +  +  ++V+LTW  P+ DG + I  Y ++  +K    W    V +  H   + + E   
Sbjct: 26383 VTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRE--- 26439

Query: 998   GNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTY 1057
              +EY+FRVF+EN  GLS+   +            +    + E  +  E  M   P    Y
Sbjct: 26440 NSEYFFRVFAENQAGLSDPREL------------LLPVLIKEQLEPPEIDMKNFPSHTVY 26487

Query: 1058  AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
               AG N  ++  + G P PK+T  ++ V +    R+         T+ +++    D G Y
Sbjct: 26488 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRY 26547

Query: 1118  CCKAVNDLGTVE 1129
                A N  GT +
Sbjct: 26548 EITAANSSGTTK 26559



 Score =  125 bits (315), Expect = 2e-28
 Identities = 87/266 (32%), Positives = 123/266 (46%), Gaps = 11/266 (4%)

Query: 247   EEKKSAAFAKIL--DPAYQV---DKGGRVRFVVEL---ADPKLEVKWYKNGQEIRPSTKY 298
             +E  S A  K+L  DP + V   DK    +  + L       + VKW+K+G+EI PS KY
Sbjct: 11648 KELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKY 11707

Query: 299   IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGER 358
               +  G +RIL I    + D  EY    G +K    + V    I V K L     + GE 
Sbjct: 11708 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGET 11767

Query: 359   VELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
                E E+SE D + +W   G+ +   P     I  +GKKHILI+         E S    
Sbjct: 11768 AHFEIELSEPDVHGQWKLKGQPLTASPDC--EIIEDGKKHILILHNCQLGMTGEVSFQAA 11825

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
               +S+A L V   PL  +TPL+D  V    E   +CE+S E    +W K    +   DR 
Sbjct: 11826 NAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRF 11885

Query: 478   KVVHKGRIHKLVIANALTEDEGDYVF 503
             +++  G  H +VI +A  EDE  Y+F
Sbjct: 11886 ELIKDGTKHSMVIKSAAFEDEAKYMF 11911



 Score =  124 bits (312), Expect = 4e-28
 Identities = 135/548 (24%), Positives = 203/548 (37%), Gaps = 95/548 (17%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETT 678
             P PP  P V +       ++W  PAYDGGSPI+GY +E K+  S  W+R N     ++T 
Sbjct: 19589 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 19648

Query: 679   FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPP----------TLLTVDS 728
             FE   ++E   Y+ R++AVN IG S PS       P  +  PP          TL+    
Sbjct: 19649 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 19708

Query: 729   VTDTT-VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANK 787
             VT    V ++ RPP                                    P   W   N 
Sbjct: 19709 VTMRLYVPVKGRPP------------------------------------PKITWSKPNV 19732

Query: 788   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE----------PKYYSQPILVKEIIEPP 837
             +L D+    I    TD   F+R + VN   A +           K Y+  + V +   PP
Sbjct: 19733 NLRDRIGLDIKS--TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPP 19790

Query: 838   -KIRIPRHLKQT--------YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIR 888
               + +    K +         I      +N V+  Q +     +W     E  K    + 
Sbjct: 19791 VNVTVKEISKDSAYVTWEPPIIDGGSPIINYVV--QKRDAERKSWSTVTTECSKTSFRVA 19848

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENV 948
             N E     F R    +  G  D     D         ++    PGP   +K+  V   + 
Sbjct: 19849 NLEEGKSYFFRVFAENEYGIGDPGETRDA--------VKASQTPGPVVDLKVRSVSKSSC 19900

Query: 949   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 1008
             ++ W  P  DG + I GY +    +++ +W  V++       +  +L  G EY FRV +E
Sbjct: 19901 SIGWKKPHSDGGSRIIGYVVDFLTEEN-KWQRVMKSLS-LQYSAKDLTEGKEYTFRVSAE 19958

Query: 1009  NMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNC 1068
             N  G    + +T    V+ARD     + V  D D    P          A    N  L  
Sbjct: 19959 NENGEGTPSEIT----VVARD-----DVVAPDLDLKGLPDLCY-----LAKENSNFRLKI 20004

Query: 1069  SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTV 1128
              ++G P P ++W K +  +  D R  + S+    TL +      D G Y     N  GT 
Sbjct: 20005 PIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 20064

Query: 1129  EIECKLEV 1136
             E    ++V
Sbjct: 20065 EGTISIKV 20072



 Score =  124 bits (310), Expect = 7e-28
 Identities = 201/896 (22%), Positives = 341/896 (38%), Gaps = 98/896 (10%)

Query: 279  PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTE 334
            P + V W+  G EI    KY          L +N  + +D  +Y   A    G ++CS  
Sbjct: 7709 PPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAP 7768

Query: 335  LFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRV 393
            L VREPP  V K  +      G  V     V      +V WFK   E++PG   R  + +
Sbjct: 7769 LTVREPPSFVQKP-DPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPG--DRCNVSL 7825

Query: 394  EGKKHILIIEGATKADAAEYS--VMTTGGQSSAKLSVDLK-PLKILTPLTDQTVNLGKEI 450
            E     L +     + + EY+  V    G++S    + +K P K +  L D ++  GK +
Sbjct: 7826 EDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPL 7885

Query: 451  CLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDA 507
             L+   +   P    W KNG+ V  S R  +    +   L I ++  ED G Y  +  +A
Sbjct: 7886 ILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENA 7945

Query: 508  YNV-TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                +  A++ +++PP  +         V V  G+   L+  ++G P     W +GD  +
Sbjct: 7946 SGKDSCSAQILILEPPYFVKQL----EPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKL 8001

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPP-VA 625
               +   +     + +TLV +  + +DSG Y    +N  GE  AS  + V +   PP  +
Sbjct: 8002 RPTT-TYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFS 8060

Query: 626  PTVTEVGDDWCIMNWEPPAYDGGSPI-LGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
              + +V +   +      A  G  PI + ++ + K  + S  ++ +F L    T    K 
Sbjct: 8061 RQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSF-LDNTATLNIFKT 8119

Query: 685  IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               +A +    A N IG              + +S   L+  +        +R  P D +
Sbjct: 8120 DRSLAGQYSCTATNPIG--------------SASSSARLILTEGKNPPFFDIRLAPVDAV 8165

Query: 745  GAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDA 804
                 D    E    G+   K S              W   ++++    K+ I+ L   A
Sbjct: 8166 VGESAD---FECHVTGTQPIKVS--------------WAKDSREIRSGGKYQISYLENSA 8208

Query: 805  KIFV-----------RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 853
             + V              AVN  G       +  + +KE + PP     + L +T     
Sbjct: 8209 HLTVLKVDKGDSGQYTCYAVNEVGKDS---CTAQLNIKERLIPPSFT--KRLSETVEETE 8263

Query: 854  GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYD 910
            G +  L     G     + W K+  EI      +I  +N+    ++ +RKA  + +G Y 
Sbjct: 8264 GNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTL--VLQVRKAGMNDAGLYT 8321

Query: 911  LQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPK-DDGNAAITGYTIQ 969
             +V  D      +  I I +   PP       V+ +++    TP    +G        +Q
Sbjct: 8322 CKVSNDAGSALCTSSIVIKEPKKPP-------VFDQHL----TPVTVSEGEYVQLSCHVQ 8370

Query: 970  KADKKSMEWFTV---IEHYHRTS---ATITELVIGNEYYFRVFSENMCGLSEDA-TMTKE 1022
             ++   ++W      I+   R S   A+ T ++   +       + +C  S  A + T +
Sbjct: 8371 GSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTK 8430

Query: 1023 SAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK 1082
            S V  +D K    P  +         F     +   +    AT    V G+P P + W K
Sbjct: 8431 SKVTIKD-KPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTK 8489

Query: 1083 NKVAIVDDPRYRMFSNQ--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             K   ++    R+F +Q      LEIR  +  D G Y C A N+ G +E    L+V
Sbjct: 8490 GKWRQLNQGG-RVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQV 8544



 Score =  121 bits (304), Expect = 3e-27
 Identities = 203/910 (22%), Positives = 347/910 (38%), Gaps = 118/910 (12%)

Query: 254  FAKILDPAYQ-VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFIN 312
            F K L+P    ++K   +   V+  D K+ V W K+GQ++ P   Y    +     L I 
Sbjct: 3646 FIKELEPVQSAINKKVHLECQVD-EDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIP 3704

Query: 313  NCQMTDDSEYYVTAGDE----KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
              ++ D   Y  TA +E     CS  + VREPP  V K         GE   L C++   
Sbjct: 3705 LAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGS 3764

Query: 369  DA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYS---VMTTGGQSSA 424
                V WFKN +E+     +  R+     + IL I      D+  YS   V   G  S +
Sbjct: 3765 PVIQVTWFKNNKEL--SESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCS 3822

Query: 425  KLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHK 482
               V  +P   +  L    +  G    L+CE+S   P +  W K+   ++ S + ++  +
Sbjct: 3823 TEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQ 3882

Query: 483  GRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG 540
              +  L I +  + D G+Y  V A +       A  H++  P   +  +D    +  + G
Sbjct: 3883 KSLVCLEIFSFNSADVGEYECVVANEVGKCGCMA-THLLKEPPTFVKKVD---DLIALGG 3938

Query: 541  NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN 600
              + L+  + G  P    W +G + I E  G+I+       + L+I   +    G Y   
Sbjct: 3939 QTVTLQAAVRGSEPISVTWMKGQEVIRE-DGKIKMSFSNGVAVLIIPDVQISFGGKYTCL 3997

Query: 601  LKNEAGEAHASIKVKVVDFPDPPV--APTVTEVGDDWCIMNW--------EPPAYDGGSP 650
             +NEAG +  S+   +V  P   +  A  +     D   + +        +P  Y  G P
Sbjct: 3998 AENEAG-SQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRP 4056

Query: 651  ILGYFIERKKKQSSRWMRLNF-DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKP---- 705
            ++          +S+  R++F +   +  F   ++ +   Y   I   N +G S      
Sbjct: 4057 LV----------ASKKYRISFKNNVAQLKFYSAELHDSGQYTFEIS--NEVGSSSCETTF 4104

Query: 706  SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
            ++  R   P   T P  L  VDSV + T  +  +       AG     + +  +G   A 
Sbjct: 4105 TVLDRDIAPF-FTKP--LRNVDSVVNGTCRLDCK------IAGSLPMRVSWFKDGKEIA- 4154

Query: 766  QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
             + +    A+        +   D+ D   FT              +A N+ G+ +    S
Sbjct: 4155 -ASDRYRIAFVEGTASLEIIRVDMNDAGNFTC-------------RATNSVGSKDS---S 4197

Query: 826  QPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE-IDKNQ 884
              ++V+E   PP        K       G AV L   FQG     + W K   E +    
Sbjct: 4198 GALIVQE---PPSFVTKPGSKDVL---PGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGS 4251

Query: 885  INIRNSETDTIIFIRKAERSHSGKYDLQVK-VDKFVE-TASIDIQ----IIDRPGPPQIV 938
              I     ++ + +   + S SG Y  +V  V   VE +A++ ++     +++  P Q++
Sbjct: 4252 CYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLL 4311

Query: 939  KIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIG 998
            K  D       +T TPP       IT +   +  K+S +        HR S   +  V+ 
Sbjct: 4312 KKGDATQLACKVTGTPP-----IKITWFANDREIKESSK--------HRMSFVESTAVLR 4358

Query: 999  -NEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTY 1057
              +       E MC    +A     S+++                  E+P FT+      
Sbjct: 4359 LTDVGIEDSGEYMCEAQNEAGSDHCSSIVI---------------VKESPYFTKEFKPIE 4403

Query: 1058 AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
             +  Y+  L   V G P  +ITW K+   +    +Y+ F    + +L+I K    D G Y
Sbjct: 4404 VLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEY 4463

Query: 1118 CCKAVNDLGT 1127
             C+  N++G+
Sbjct: 4464 QCRVTNEVGS 4473



 Score =  120 bits (301), Expect = 7e-27
 Identities = 130/513 (25%), Positives = 208/513 (40%), Gaps = 41/513 (7%)

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KG+W+    + GKHL L       S  +   + I   K +  G Y    TYK      S 
Sbjct: 2649 KGEWL----RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSA 2700

Query: 156  DLEVH--ESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWEL 213
             L+V   +   T  N+ +          +     +     +K   V +  E+  + V   
Sbjct: 2701 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV--- 2757

Query: 214  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVD--KGGRVR 271
                K + Y        I D      RL R+    +      KI+     V   +   V 
Sbjct: 2758 ----KGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVA 2813

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F V ++   + VKW+    EI+PS K+    +     L + N   +D  EY    G  +C
Sbjct: 2814 FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLEC 2873

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +LFV    + +TK +++      +    ECEVS  +    W KNG EI    K  ++I
Sbjct: 2874 KAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK--FKI 2929

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             V+GK H LII   +  D+AEY+ +    Q SA L+V   P+ I + L D  +N  ++  
Sbjct: 2930 VVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMITSMLKD--INAEEKDT 2985

Query: 452  LKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD-- 506
            +  E++ N  G   KW KNG+ ++ +D+ ++  K   H L I N    D  DY F     
Sbjct: 2986 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 3045

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                TL  +   I+  K I D       + V+   +   E  +S EP     W + D+  
Sbjct: 3046 TSTATLYVEARHIEFRKHIKD-------IKVLEKKRAMFECEVS-EPDITVQWMKDDQE- 3096

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            ++ + RI+ +       L+I      D+G Y +
Sbjct: 3097 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3129



 Score =  120 bits (301), Expect = 7e-27
 Identities = 89/317 (28%), Positives = 143/317 (45%), Gaps = 11/317 (3%)

Query: 256   KILDPAYQVD--KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINN 313
             K++ P + V+  +    RF  E+++  +   W   G+ +  +     + +G    L ++N
Sbjct: 12108 KLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHN 12167

Query: 314   CQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVK 373
             C++         A + K S  L V+   I + + L+D T   GE    +CE+S +D  V+
Sbjct: 12168 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 12227

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL 433
             W+  G+++ P  K     R EGK H L +      DA E  +     ++ A L V   P+
Sbjct: 12228 WYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPV 12285

Query: 434   KILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
             +   PL DQTV  G    L+CE+S EN   KW KNG  + +S + ++V  GR+ KLVI +
Sbjct: 12286 EFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 12345

Query: 493   ALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
                ED   Y    DA +      ++V+ P    L  L     + V      R E  +S E
Sbjct: 12346 CTPEDIKTYTC--DAKDFKTSCNLNVVPPHVEFLRPL---TDLQVREKEMARFECELSRE 12400

Query: 553   PPPKAMWSRGDKAIMEG 569
                K  W +    I +G
Sbjct: 12401 -NAKVKWFKDGAEIKKG 12416



 Score =  120 bits (301), Expect = 7e-27
 Identities = 124/479 (25%), Positives = 201/479 (41%), Gaps = 76/479 (15%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVID 520
             KWTK G  +  S R  +       +LVI  A   D G Y  V         +  KV VI 
Sbjct: 30169 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIG 30226

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP------------------PKAMWSRG 562
              P      L+ D+             + +S  PP                  PKA W   
Sbjct: 30227 SPNSPEGPLEYDDIQV--------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTI 30278

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKV- 616
             D        R+R       ++LV+   + +    + ++ +N+ G     ++   +  K  
Sbjct: 30279 DS-------RVR------GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP 30325

Query: 617   VDFPDPPV-APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
             ++ P+PP   P V +V      ++W  P  DGGS + GY+IERK+  + +W+R N     
Sbjct: 30326 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 30385

Query: 676   ETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDT 732
              T +    ++    Y+ RI A N +G+S+ S  S P V   P    S P  L + S++  
Sbjct: 30386 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 30445

Query: 733   TVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDK 792
             +VT++W  P+  G   + GY +EY            ++G++A       W  +NK+ I  
Sbjct: 30446 SVTLQWEKPECDGGKEILGYWVEY-----------RQSGDSA-------WKKSNKERIKD 30487

Query: 793   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII-EPPKIRIPRHLKQTYIR 851
              +FTI GL    +   RV A N  G S P+  +  I  K    E P IR  + +K     
Sbjct: 30488 KQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIR--KEMKDV-TT 30544

Query: 852   RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT-IIFIRKAERSHSGKY 909
             ++GEA  L     G+P P++ W + G E+ +++    +S+  T  + +   E+   G Y
Sbjct: 30545 KLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 30603



 Score =  118 bits (295), Expect = 4e-26
 Identities = 143/575 (24%), Positives = 215/575 (37%), Gaps = 93/575 (16%)

Query: 597   YHINLKNEAGEAHASIKVKVVDF------PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + ++ +NE G    S   K V        P PPV P   +   +   + W+PP +DGGS 
Sbjct: 17084 FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSK 17143

Query: 651   ILGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             ILGY +E +K     W R N   + C ET ++   + +G  Y+ R+ AVNA G S P+  
Sbjct: 17144 ILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHV 17203

Query: 709   SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSD 768
               P +      PP L     + D  +        HI     D   L    +G        
Sbjct: 17204 PEPVLVKDRLEPPEL-----ILDANMARE----QHIKVG--DTLRLSAIIKG-------- 17244

Query: 769   ENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG----ASEPKYY 824
                      P   W   ++D   K +  +T  P  +K+ +R  A    G      E    
Sbjct: 17245 ------VPFPKVTWKKEDRDAPTKARIDVT--PVGSKLEIRNAAHEDGGIYSLTVENPAG 17296

Query: 825   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK---DGAEID 881
             S+ + VK ++   K   PR L+ + IR              K    LTWK+   DG  + 
Sbjct: 17297 SKTVSVKVLVLD-KPGPPRDLEVSEIR--------------KDSCYLTWKEPLDDGGSVI 17341

Query: 882   KNQINIRNSETD---TIIFIRKAERSHSGKY-------------DLQVKVDKFVETASID 925
              N +  R        + +     ++SH  K+             + Q     FVET    
Sbjct: 17342 TNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPK-P 17400

Query: 926   IQIIDR---PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVI 982
             I+ +D    PGPP+ +   DV    V+L W  P  DG + ITGY ++  ++ + +W    
Sbjct: 17401 IKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-F 17459

Query: 983   EHYHRTSATITELVIGNEYYFRVFSENMCGLS-EDATMTKESAVIARDGKIYKNPVYEDF 1041
             +        +T L  G  Y FRV +EN+ GL   D T+  E        K+    V  D 
Sbjct: 17460 KTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIEC-----QEKLVPPSVELDV 17514

Query: 1042  DFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGV 1101
                E  +           AG        +RG P P   W  +   I  D  Y + ++   
Sbjct: 17515 KLIEGLVVK---------AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 17565

Query: 1102  CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               L I+     D G Y     N  G+  +   L V
Sbjct: 17566 SVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 17600



 Score =  116 bits (290), Expect = 1e-25
 Identities = 185/884 (20%), Positives = 323/884 (36%), Gaps = 156/884 (17%)

Query: 313   NCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDA 370
             N     DS   +TA DE       +  P   +  + +D    + GE   LE ++  +   
Sbjct: 24685 NFSEPSDSSGAITARDE-------IDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIP 24737

Query: 371   NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSV 428
             +V W K+G+E+     +R  I+   +K  L+++   + D  +Y   +   GG  S  ++V
Sbjct: 24738 DVVWSKDGKEL-EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITV 24796

Query: 429   DLK--------PLKIL------------TPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
              +         PLK+              PL D   N+   I  K E S      WT+  
Sbjct: 24797 KVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL---SWTQVS 24853

Query: 469   LPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVHVID----- 520
               VQ  +        ++ KL+  N       +Y+F   A + Y +  P +   +      
Sbjct: 24854 TEVQALNY-------KVTKLLPGN-------EYIFRVMAVNKYGIGEPLESGPVTACNPY 24899

Query: 521   -----PPKIILDGLDADNTVTVIA------GNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
                  P    +  +  D+ V   A      G ++   I +         W++ +K  +  
Sbjct: 24900 KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI-LEKRDKEGVRWTKCNKKTLTD 24958

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE-AHASIKVKVVDF---PDPPVA 625
               R+R     +  +    +A  + +GV         GE +  S+  +  D    P PP  
Sbjct: 24959 L-RLRVTGLTEGHSYEFRVAAENAAGV---------GEPSEPSVFYRACDALYPPGPPSN 25008

Query: 626   PTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT------F 679
             P VT+       + W  P YDGG+P+ GY +E K+  +  W       C   T      F
Sbjct: 25009 PKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-----CTPPTGLQGKQF 25063

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTL-----------LTVDS 728
                K+ E   Y  RI A+N+ G+ +P+      V      PP +           L   +
Sbjct: 25064 TVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASA 25123

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
                  VT++ RP   +     +G + +      TS+                  ++ N  
Sbjct: 25124 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTM--------------LVIDNVT 25169

Query: 789   LIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLK 846
               D  ++ +T          FV V+ +++  A        P+ +  I E  K  +    +
Sbjct: 25170 RFDSGRYNLTLENNSGSKTAFVNVRVLDSPSA--------PVNLT-IREVKKDSVTLSWE 25220

Query: 847   QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHS 906
                I    +  N ++  +   R       +     K    I N +     + R      S
Sbjct: 25221 PPLIDGGAKITNYIVEKRETTRKAYATITNNCT--KTTFRIENLQEGCSYYFRVLA---S 25275

Query: 907   GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 966
              +Y + +  +      +  +++ + P PP  V + DV      + W  P+ DG + ITGY
Sbjct: 25276 NEYGIGLPAE-----TTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGY 25330

Query: 967   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1026
              ++   K S +W T  +      ATI+ L  G EY FRV + N  G S+   +     VI
Sbjct: 25331 VVEMQTKGSEKWSTCTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP--VI 25387

Query: 1027  ARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVA 1086
             ARD +I              P    P       A     ++   +G P+  + W K+   
Sbjct: 25388 ARDIEI-------------KPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQT 25434

Query: 1087  IVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1130
             + +  R  + S++ V +L I++ S  D GTY     N  G++ +
Sbjct: 25435 LKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITV 25478



 Score =  115 bits (288), Expect = 2e-25
 Identities = 180/802 (22%), Positives = 307/802 (38%), Gaps = 107/802 (13%)

Query: 373   KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKP 432
             KW  +G EI       Y +  +    +L I+   + D  EY +  +    S  ++V L  
Sbjct: 17543 KWTTDGSEI--KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 17600

Query: 433   LKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESDRLK----VVHKGRI 485
             L +  P T     L    + + +  +  ++  G    N + V++ D  K    VV  G  
Sbjct: 17601 LDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYI-VEKQDTRKDTWGVVSSGSS 17659

Query: 486   H-KLVIANALTEDEGDYVFAPDAYNV---------TLPAKVHVIDPPKIILDGLDADNTV 535
               KL I +   +   +YVF   A N          T     H   PP            V
Sbjct: 17660 KTKLKIPHL--QKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP-----PGKPVV 17712

Query: 536   TVIAGNKLRLE--IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERD- 592
             T I  N   +   +P S    P   +    + +     R+      D    V  + E + 
Sbjct: 17713 TDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNT 17772

Query: 593   -DSGVYHINLKNEAGEAHASIKVKV---VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
              +  V+  NL   +  + +S  +K    +  P PP+ P + +   +   + W  P  DGG
Sbjct: 17773 YEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGG 17832

Query: 649   SPILGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM 707
             SPILGY +E +K  +++W R+N D L ++  F    +IEG  Y  RI A N +G  +P  
Sbjct: 17833 SPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRE 17892

Query: 708   PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA--GLDGYVLEYCFEGSTSAK 765
              +   +   +  PP +  +D      +T+R      I A   G     + +  EG    +
Sbjct: 17893 LAESVIAKDILHPPEV-ELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVR 17951

Query: 766   QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
             +  +  +   DLP  +  +      D  K+ I+             A N++G      ++
Sbjct: 17952 E--KRVDLIQDLPRVELQIKEAVRADHGKYIIS-------------AKNSSG------HA 17990

Query: 826   QPILVKEIIEPPKIRIPRHLKQTYIRRVG--------------EAVNLVIPFQGKPRPEL 871
             Q   +  +++ P     ++LK T + +                E  N ++ ++ KP  + 
Sbjct: 17991 QGSAIVNVLDRPGPC--QNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR-KPNQK- 18046

Query: 872   TWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--IDIQII 929
              W    +++ K  I       +   F   AE         +V V   +ET +  + I  I
Sbjct: 18047 GWSIVASDVTKRLIKANLLANNEYYFRVCAEN--------KVGVGPTIETKTPILAINPI 18098

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             DRPG P+ + I D     V L W  P  DG +    Y +++  K S +W  V +   + +
Sbjct: 18099 DRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET 18158

Query: 990   ATITELVIGNEYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPM 1048
               + +  + N+ Y FRV ++N  G S+   +  E  V+  D               + P+
Sbjct: 18159 HYMVDRCVENQIYEFRVQTKNEGGESD--WVKTEEVVVKED--------------LQKPV 18202

Query: 1049  FTQPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVA--IVDDPRYRMFSNQGVCTLE 1105
                 L     + AG    L   VRG P P++ W K+K A  +   PR ++ +        
Sbjct: 18203 LDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFS 18262

Query: 1106  IRKPSPYDGGTYCCKAVNDLGT 1127
             + K    DGG Y   A N  G+
Sbjct: 18263 LTKAKRSDGGKYVVTATNTAGS 18284



 Score =  115 bits (288), Expect = 2e-25
 Identities = 190/873 (21%), Positives = 328/873 (37%), Gaps = 153/873 (17%)

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDANVKWFKNGEEI 381
             +TA DE       V  P I +  + +DT   + GE  +++ ++  +    ++W K  +E+
Sbjct: 22532 ITARDE-------VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 22584

Query: 382   IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
                  +R  I+       L ++ A + D+  Y +          ++V++K L    P   
Sbjct: 22585 --SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 22642

Query: 442   QTVNLGKEICLKCEISENIPGKWTKNGLPVQE--SDRLKVVHKGR-----IHKLVIANAL 494
               V  G     KC ++      W     P+Q+  SD +  + + R     +  +V AN  
Sbjct: 22643 PVVISGVT-AEKCTLA------WKP---PLQDGGSDIINYIVERRETSRLVWTVVDANVQ 22692

Query: 495   TED-------EG-DYVF---APDAYNVTLPAKVH--VIDPPKIILDGLDADNTVTVIAGN 541
             T         EG +Y F   A + Y V  P +    V   P ++ D   A    TV   +
Sbjct: 22693 TLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDS 22752

Query: 542   KLRL-EIPISG------------EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDI 588
              + + E P S                    W+R  K ++ G  R+R          V  +
Sbjct: 22753 MIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLI-GELRLR----------VTGL 22801

Query: 589   AERDDSGVYHINLKNEAGEAHAS---IKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEP 642
              E  D   + ++ +N AG +  S      K  D    P PP  P V ++      ++W  
Sbjct: 22802 IENHDYE-FRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSK 22860

Query: 643   PAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIG 701
             P YDGG  I GY +E+       W          +T  E +K++E   Y  RI A+N  G
Sbjct: 22861 PIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAG 22920

Query: 702   ISKPSMPSRPFVPLAVTSPPTL-----------LTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + + +    P +       P +           +         V ++ RP   +    +D
Sbjct: 22921 VGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVD 22980

Query: 751   GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTIT--GLPTDAKIFV 808
             G + +      TS+  S               ++ N +  D  K+T+T          FV
Sbjct: 22981 GEIRDAAIIDVTSSFTS--------------LVLDNVNRYDSGKYTLTLENSSGTKSAFV 23026

Query: 809   RVKAVNAAGASEPKYYSQPILVKEII----EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
              V+ ++    S P       + K+ +    EPP +     +K   + +            
Sbjct: 23027 TVRVLDTP--SPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK------------ 23072

Query: 865   GKPRPELTWKKDGAEID---KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
                  E T K   A +    KN   I   +     + R    +  G       +    +T
Sbjct: 23073 ----REATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYG-------IGLPAQT 23121

Query: 922   ASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 981
             A   I++ + P PP  + ++DV   +V+L+WT P+ DG + I  Y ++   K S +W + 
Sbjct: 23122 AD-PIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW-SE 23179

Query: 982   IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDF 1041
                     A IT L  G EY FRV + N  G S+  ++     ++A+D  I  +      
Sbjct: 23180 CARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP--IVAKDLVIEPD------ 23231

Query: 1042  DFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1100
                      +P  ++Y++  G +  +   + G PKP ITW K+ + +    R  +  +  
Sbjct: 23232 --------VKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLD 23283

Query: 1101  VCTLEIRKPSPYDGGTYCCKAVNDLG--TVEIE 1131
             + TL I++    DGG Y     N +G  T  IE
Sbjct: 23284 LTTLSIKETHKDDGGQYGITVANVVGQKTASIE 23316



 Score =  115 bits (287), Expect = 3e-25
 Identities = 101/370 (27%), Positives = 158/370 (42%), Gaps = 34/370 (9%)

Query: 266  KGGRVRFVVELAD-----------------PKLEVKWYKNGQEIRPSTKYIFEHKGCQRI 308
            +G  V FV EL D                   +E KWY N  E++ + KY    +  ++ 
Sbjct: 2263 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2322

Query: 309  LFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            L + +    D  EY      +K + +L ++  PI + + L D     G+ V+LE +VS +
Sbjct: 2323 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE 2382

Query: 369  DANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
                 W K+G+E+   P  R  I ++ + H+L+IE  TK DA  YS        S    V
Sbjct: 2383 SVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV 2440

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIH 486
             +  + ++TPL D  V  G +  L+C++S  +    KW  N   ++  DR++ + KG   
Sbjct: 2441 SVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ 2500

Query: 487  KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLE 546
            +LVI      DEG Y              V  I     I+ GL  D T T        +E
Sbjct: 2501 RLVINRTHASDEGPYKLIVGRVETNCNLSVEKIK----IIRGL-RDLTCTETQNVVFEVE 2555

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            +  SG      +W+  DK I + S + + E++     L +    +DD G Y       AG
Sbjct: 2556 LSHSG---IDVLWNFKDKEI-KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAG 2607

Query: 607  EAHASIKVKV 616
            E   S K+ V
Sbjct: 2608 ENMTSGKLTV 2617



 Score =  115 bits (287), Expect = 3e-25
 Identities = 246/1161 (21%), Positives = 410/1161 (35%), Gaps = 182/1161 (15%)

Query: 44   GEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLA 103
            G ++ +     Q    F+++P+   V  G+++TF + ++     +   + WF+G   +L 
Sbjct: 5879 GSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFK---VNWFRGA-RELV 5934

Query: 104  SKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHEST 163
                 ++  ++T          E+++     + +G Y C V+      SC+  L V E  
Sbjct: 5935 KGDRCNIYFEDTVA--------ELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPA 5986

Query: 164  GTTPNIDIRSAFKRSGEGQEDA--GELDFSGLLKRREVKQQEEEP-------QVDVWELL 214
                 +   S         E    G L  S   K+        E        +  + E+L
Sbjct: 5987 AFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEIL 6046

Query: 215  KNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA--AFAKILDPAYQVDK------ 266
             + K     + A QY              +  E  +    A    L+P Y V +      
Sbjct: 6047 NSTK-----RDAGQYSC-----------EIENEAGRDVCGALVSTLEPPYFVTELEPLEA 6090

Query: 267  --GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
              G  V    ++A  P++ V WYK   ++RP+ +Y          L  N   + D  EY 
Sbjct: 6091 AVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYT 6150

Query: 324  VTA------GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFK 376
              A         K    +  R+ P    +QL+D     G  V L C ++      V W++
Sbjct: 6151 CKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYR 6210

Query: 377  NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTG----GQSSAKLSV---- 428
            +G  ++   ++     V+    + I++    + + +YS   +       SSA+L+     
Sbjct: 6211 DG-VLLRDDENLQTSFVDNVATLKILQ-TDLSHSGQYSCSASNPLGTASSSARLTAREPK 6268

Query: 429  -----DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVH 481
                 D+KP+ I        V  G+    +C ++   P +  W+K+   ++      +  
Sbjct: 6269 KSPFFDIKPVSI-------DVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITC 6321

Query: 482  KGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIA 539
             G    L I      D G Y      D       A++ V +PPK +   L+A        
Sbjct: 6322 VGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFV-KKLEASKVAK--Q 6378

Query: 540  GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            G  ++LE  ISG P  K  W R D  + E S +         + L I+ A  +DSG Y  
Sbjct: 6379 GESIQLECKISGSPEIKVSWFRNDSELHE-SWKYNMSFINSVALLTINEASAEDSGDYIC 6437

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPV-----APTVTEVGDD---WCIMNWEPPAYDGGSPI 651
               N  G+A  S  + V     PPV     +P     G D    C ++  PP        
Sbjct: 6438 EAHNGVGDASCSTALTV---KAPPVFTQKPSPVGALKGSDVILQCEISGTPPFE------ 6488

Query: 652  LGYFIERKKKQSSRWMRL---NFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
            + +  +RK+ ++S+  ++   +FD    T+     +      E    A N +G    S  
Sbjct: 6489 VVWVKDRKQVRNSKKFKITSKHFD----TSLHILNLEASDVGEYHCKATNEVGSDTCS-- 6542

Query: 709  SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG--STSAKQ 766
                  +    PP  +   S T T +               D   L    EG    S   
Sbjct: 6543 ----CSVKFKEPPRFVKKLSDTSTLIG--------------DAVELRAIVEGFQPISVVW 6584

Query: 767  SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
              + GE   +  +E+  ++  D I   +          K   ++K  N AG  E      
Sbjct: 6585 LKDRGEVIRE--SENTRISFIDNIATLQLGSPEASNSGKYICQIK--NDAGMRECS---- 6636

Query: 827  PILVKEIIEPPK-IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI---DK 882
               V  ++EP + I  P  +  T     G    L     G P     W KDG E+    K
Sbjct: 6637 --AVLTVLEPARIIEKPEPMTVT----TGNPFALECVVTGTPELSAKWFKDGRELSADSK 6690

Query: 883  NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV-KIE 941
            + I   N      + I  AE S  G Y  +VK        ++ + + DR  PP  + K++
Sbjct: 6691 HHITFINKVAS--LKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLK 6748

Query: 942  DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 1001
            DV   N  L        G + +    +  +   S+ WF              E+V G + 
Sbjct: 6749 DV---NAIL--------GASVVLECRVSGSAPISVGWF----------QDGNEIVSGPKC 6787

Query: 1002 YFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYED-----FDFSEAPMFTQPLVNT 1056
                FSEN+C L+       ++ +      +  N    D         E P F Q   + 
Sbjct: 6788 Q-SSFSENVCTLNLSLLEPSDTGIYT---CVAANVAGSDECSAVLTVQEPPSFEQTPDSV 6843

Query: 1057 YAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGT 1116
              + G + T    +RG P  K+ W K    +V      +     V  LE+ +  P + G 
Sbjct: 6844 EVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGD 6903

Query: 1117 YCCKAVNDLGTVEIECKLEVK 1137
            Y C   ND G+      L VK
Sbjct: 6904 YSCLVTNDAGSASCTTHLFVK 6924



 Score =  114 bits (286), Expect = 4e-25
 Identities = 235/1151 (20%), Positives = 410/1151 (35%), Gaps = 186/1151 (16%)

Query: 60   FIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERH 119
            F + P    V  G  +TF + ++     +   +KWFKG   +L      ++ L++     
Sbjct: 6836 FEQTPDSVEVLPGMSLTFTSVIRGTPPFK---VKWFKGS-RELVPGESCNISLED----- 6886

Query: 120  SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSG 179
               +  E+++ + +   +G+Y C VT      SC+  L V E           +  KR  
Sbjct: 6887 ---FVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPA---------TFVKRLA 6934

Query: 180  EGQEDAG-----ELDFSGL-------LKRREVKQQEEEPQVDVWE--LLKNAKPSEYEKI 225
            +   + G     E  ++G        +K   +  Q E   + + E   +     S  E  
Sbjct: 6935 DFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDY 6994

Query: 226  AFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVEL--------- 276
            A QY           L      +    A   +L+P Y ++    V  V+           
Sbjct: 6995 A-QYSC---------LIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVD 7044

Query: 277  ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
              P++ + WYK   ++R +  Y  + K     L IN    +D  EY   A    G    S
Sbjct: 7045 GTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASS 7104

Query: 333  TELFV--REPPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRY 389
              L +  R+ P    ++L+D     G  V  EC ++  +   V W+K+G  ++    +  
Sbjct: 7105 AVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDG--VLLKDDANL 7162

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTG----GQSSAKLSV---------DLKPLKIL 436
            +         L I    ++   +Y+   +       SSAKL +         DLKP+ + 
Sbjct: 7163 QTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSV- 7221

Query: 437  TPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                   + LG+    KC ++   P K  W K+   ++     K+        L +    
Sbjct: 7222 ------DLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVG 7275

Query: 495  TEDEGDYV-FAPD-AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              D G Y  +A + A   +  A++ V +PP+ I      + +  V      R E  I G 
Sbjct: 7276 KGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFI---KKLEPSRIVKQDEFTRYECKIGGS 7332

Query: 553  PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASI 612
            P  K +W + +  I E S + R       + L +     +DSG Y     N AG A +S 
Sbjct: 7333 PEIKVLWYKDETEIQE-SSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSST 7391

Query: 613  KVKVVDFPDPPV-----APTVTEVGDD---WCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
             +KV    +PP+      P  T  G D    C +   PP +      + ++ ++++ +S 
Sbjct: 7392 SLKV---KEPPIFRKKPHPIETLKGADVHLECELQGTPPFH------VSWYKDKRELRSG 7442

Query: 665  RWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV-------PLAV 717
            +              + K M E     + I  V+A  I +    +   V        +A+
Sbjct: 7443 K--------------KYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIAL 7488

Query: 718  TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGS--TSAKQSDENGEAAY 775
             +PP  +   S   T V    +              L+   EG+   S     + GE   
Sbjct: 7489 KAPPRFVKKLSDISTVVGKEVQ--------------LQTTIEGAEPISVVWFKDKGEIVR 7534

Query: 776  DLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 835
            +  +++  ++  + I   +F+        K   ++K  N AG  E            ++E
Sbjct: 7535 E--SDNIWISYSENIATLQFSRVEPANAGKYTCQIK--NDAGMQE------CFATLSVLE 7584

Query: 836  PPKI-RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETD 893
            P  I   P  +K T     G+   L     G P     W KDG E+   N+  I      
Sbjct: 7585 PATIVEKPESIKVT----TGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKV 7640

Query: 894  TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIV-KIEDVWGENVALTW 952
            + + I     S SG Y  +V+     ++ +  +Q+ DR  PP    K+++  G +     
Sbjct: 7641 SGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLS----- 7695

Query: 953  TPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCG 1012
                  G++ +    +  +   S+ WF      H  +    E+  G +Y     ++N C 
Sbjct: 7696 ------GSSVVMECKVYGSPPISVSWF------HEGN----EISSGRKYQ-TTLTDNTCA 7738

Query: 1013 LSEDATMTKESA--VIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSV 1070
            L+ +     +S             +         E P F Q       + G N T    V
Sbjct: 7739 LTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIV 7798

Query: 1071 RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1130
            +G P   ++W K    +V   R  +     V  LE+        G Y C   N+ G    
Sbjct: 7799 KGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASC 7858

Query: 1131 ECKLEVKVIAQ 1141
               L +K  A+
Sbjct: 7859 TTHLYIKAPAK 7869



 Score =  110 bits (276), Expect = 6e-24
 Identities = 178/830 (21%), Positives = 319/830 (38%), Gaps = 108/830 (13%)

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
             T   G  + L+  V  + +  + W K  +E+    K    ++  GK+   +I+   ++D+
Sbjct: 29058 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK--VSLQYTGKRATAVIKFCDRSDS 29115

Query: 411   AEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIP-----GKWT 465
              +Y++       +  +SV +K L    P    TV+   +   KC ++ ++P      + T
Sbjct: 29116 GKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQE--KCTLAWSLPQEDGGAEIT 29173

Query: 466   KNGLPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH---- 517
                +  +E+ RL  V+ +G    L           +Y+F   A + Y   +P +      
Sbjct: 29174 HYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA 29233

Query: 518   ----VIDPPKIILDGLDADNTVTVI--------AGNKLRLEIPISGEPPPKAMWSRGDKA 565
                  I  P  I + +       +I         GN++   + +         W+R +K 
Sbjct: 29234 RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYL-VDKREKKSLRWTRVNKD 29292

Query: 566   IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF-PDPPV 624
              +    R++  S  +       +   + +G       +E  EA   I  +   + P PP 
Sbjct: 29293 YVVYDTRLKVTSLMEGCDYQFRVTAVNAAG------NSEPSEASNFISCREPSYTPGPPS 29346

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC-KETTFEPKK 683
             AP V +       + W  P YDGG+ I+GY +E ++K + +W R++ +   + T F    
Sbjct: 29347 APRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPD 29406

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             +  G  Y  R+ AVN  G+S+ S       P+     P L   D +  T VT+R      
Sbjct: 29407 LKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKT-VTIRAGASLR 29465

Query: 744   --IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
               +  +G    V+ +  +G   A ++  +   +Y L     IV   +  D  K+TI    
Sbjct: 29466 LMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL----LIVDKVNRYDAGKYTI---- 29517

Query: 802   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTY-----IRRV 853
                      +A N +G       S  +LVK    P   P +++    + +      I  +
Sbjct: 29518 ---------EAENQSGKK-----SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTI 29563

Query: 854   --GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDL 911
               G  VN  I  + +      +K    +  K    I      T+ + R    +  G    
Sbjct: 29564 DGGAPVNNYI-VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYG---- 29618

Query: 912   QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 971
                + +  ET+   + + + P  P  +++ DV    V L W  P  DG + +TGY ++  
Sbjct: 29619 ---IGEPCETSDA-VLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEAC 29674

Query: 972   DKKSMEWF-------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1024
                +  W        TV+EH      T+T L  G +Y FR+ ++N  G+SE       +A
Sbjct: 29675 KAGTERWMKVVTLKPTVLEH------TVTSLNEGEQYLFRIRAQNEKGVSEPRETV--TA 29726

Query: 1025  VIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNK 1084
             V  +D ++         D S     T P    +  AG    L   + G P P  +W    
Sbjct: 29727 VTVQDLRVLPT-----IDLS-----TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAG 29776

Query: 1085  VAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
               + +  R  + ++  V  L IR+ +  D G Y  +  N  GT     K+
Sbjct: 29777 SKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKV 29826



 Score =  109 bits (273), Expect = 1e-23
 Identities = 204/910 (22%), Positives = 339/910 (37%), Gaps = 110/910 (12%)

Query: 249  KKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
            K+   F + L P  +V K   V    E+   P  EV W KN +EIR S KY    +    
Sbjct: 4952 KEPPTFIRELKPV-EVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVF 5010

Query: 308  ILFINNCQMTDDSEYYVTAGDE----KCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
             L I  C  +D  EY     +E     CST + ++EPP  + K++E+TT         + 
Sbjct: 5011 NLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFI-KKIENTTTVLKSSATFQS 5069

Query: 364  EVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMT---TG 419
             V+     ++ W K+ ++I+    + Y I        L I       +  Y+      +G
Sbjct: 5070 TVAGSPPISITWLKD-DQILDEDDNVY-ISFVDSVATLQIRSVDNGHSGRYTCQAKNESG 5127

Query: 420  GQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRL 477
             +      +  +P +I+       V     + L+C +  +  +  KW K+G  +  S   
Sbjct: 5128 VERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYF 5187

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVF--APDAYNVTLPAKVHVID---PPKIILDGLDAD 532
             +  +  +    I + + +D G Y F    D  + +  A + V+D   PP         D
Sbjct: 5188 SMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMD 5247

Query: 533  NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERD 592
                 + G+ + +E  +SG  P  A W +  K I   S + R   +  S +L ++  E +
Sbjct: 5248 K----VLGSSIHMECKVSGSLPISAQWFKDGKEI-STSAKYRLVCHERSVSLEVNNLELE 5302

Query: 593  DSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPIL 652
            D+  Y   + N AG+   S  + V + P   V P   +   D  +   E  A   G+P  
Sbjct: 5303 DTANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQAIPDSTV---EFKAILKGTPPF 5359

Query: 653  GYFIERKKKQSSRWMRLNFDLCKETTFEPKKMI--EGVAYEVRIFAVNAIGISKPSMPSR 710
                        +W + + +L       PK  I  EG    + +++V+A   SK      
Sbjct: 5360 ----------KIKWFKDDVELVS----GPKCFIGLEGSTSFLNLYSVDA---SKTGQ--- 5399

Query: 711  PFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP--------DHIGAAGLDGYVLEYCFEGST 762
                  VT+      V S + TT+ +   PP          I  AG D   LE    GS 
Sbjct: 5400 --YTCHVTN-----DVGSDSCTTMLLVTEPPKFVKKLEASKIVKAG-DSSRLECKIAGSP 5451

Query: 763  SAKQSDENGEAAYDLPAEDWIVANKDLIDKTK-FTITGLPTDAKIFVRVKAVNAAGASEP 821
              +      E  ++LPA D        ID      +  L T+       +A N AG++  
Sbjct: 5452 EIRVVWFRNE--HELPASD--KYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTS- 5506

Query: 822  KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI- 880
               S  ++VK   EPP       + +T        V+L     G P  E+ W KD  ++ 
Sbjct: 5507 --CSTKVIVK---EPPVFSSFPPIVETL---KNAEVSLECELSGTPPFEVVWYKDKRQLR 5558

Query: 881  DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKI 940
               +  I +    T I I   + S  G+Y  + + +   +T    +++ +   PP+ V  
Sbjct: 5559 SSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKE---PPRFV-- 5613

Query: 941  EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 1000
                 +  +LT       G  A    +I+ A    ++W    E   R S  I        
Sbjct: 5614 ----SKLNSLTVVA----GEPAELQASIEGAQPIFVQWLKEKEEVIRESENIR------- 5658

Query: 1001 YYFRVFSENMCGL----SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
                 F EN+  L    +E A   K    I  DG + +N         E  +  +     
Sbjct: 5659 ---ITFVENVATLQFAKAEPANAGKYICQIKNDGGMREN--MATLMVLEPAVIVEKAGPM 5713

Query: 1057 YAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGT 1116
                G   TL C V G P+  + W K+   +    +++      + +L I      D GT
Sbjct: 5714 TVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGT 5773

Query: 1117 YCCKAVNDLG 1126
            Y  +  N++G
Sbjct: 5774 YTFQVQNNVG 5783



 Score =  109 bits (272), Expect = 2e-23
 Identities = 92/363 (25%), Positives = 161/363 (44%), Gaps = 18/363 (4%)

Query: 269  RVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGD 328
            R  F  E+++P + V+W K+ QE++ + +   + +     L I + +M+D  +Y V AG 
Sbjct: 3074 RAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG 3133

Query: 329  EKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               + +LFV    + +    ++      +R  +E EV+EDD +  W+K+G EI    + R
Sbjct: 3134 NVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER 3193

Query: 389  YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL-KPLKILTPLTDQTVNLG 447
            ++  VE + H + I    ++DA EY+ +    +SS  L V+  +P ++L  L   TV  G
Sbjct: 3194 HKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSG 3253

Query: 448  KEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF-A 504
            K       IS     K  W K    +    + K +H G+ + L++  A  ED   Y   A
Sbjct: 3254 KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEA 3313

Query: 505  PDAYNVTLPAKVHVIDPPKIILDGLD-----------ADNTVTVIAGNKLRLEIPISGEP 553
             + Y V   +    ++ P+++    +             +TVT   G   R +  +SG  
Sbjct: 3314 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVT-SEGQPARFQCRVSG-T 3371

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
              K  W   DK I + S   R   + D+  L I  A  +D G Y     N  G+  ++  
Sbjct: 3372 DLKVSWYSKDKKI-KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3430

Query: 614  VKV 616
            + +
Sbjct: 3431 LSL 3433



 Score =  108 bits (270), Expect = 3e-23
 Identities = 103/437 (23%), Positives = 169/437 (38%), Gaps = 53/437 (12%)

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLP 778
             SP   L  D +   +V + WRPP   G A + GY+LE                    ++P
Sbjct: 30230 SPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILE------------------RREVP 30271

Query: 779   AEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
                W   +   +  T   + GL  + +   RV A N  G S+P    +P+  K  + PP+
Sbjct: 30272 KAAWYTIDSR-VRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPE 30330

Query: 839   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN----IRNSETD- 893
                P       +     +V+L      +P+ +   +  G  I++ + +    +R+++T  
Sbjct: 30331 ---PPSNPPEVLDVTKSSVSLS---WSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQI 30384

Query: 894   TIIFIRKAERSHSGKYDLQVKVDKFV---ETASIDIQII-----DRPGPPQIVKIEDVWG 945
             T             +Y  ++     V   ET+     ++     D+P  P  ++I  +  
Sbjct: 30385 TTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISK 30444

Query: 946   ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-TVIEHYHRTSATITELVIGNEYYFR 1004
             ++V L W  P+ DG   I GY ++        W  +  E       TI  L+   EY FR
Sbjct: 30445 DSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFR 30504

Query: 1005  VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNA 1064
             VF+EN  GLS               G              EAP   + + +     G  A
Sbjct: 30505 VFAENETGLSRPRRTAMSIKTKLTSG--------------EAPGIRKEMKDVTTKLGEAA 30550

Query: 1065  TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1124
              L+C + G P P I W +    ++   +Y+M S+    TL +      D G Y C A N+
Sbjct: 30551 QLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE 30610

Query: 1125  LGTVEIECKLEVKVIAQ 1141
             +G VE   KL ++   Q
Sbjct: 30611 VGEVETSSKLLLQATPQ 30627



 Score =  107 bits (268), Expect = 5e-23
 Identities = 123/468 (26%), Positives = 198/468 (42%), Gaps = 56/468 (11%)

Query: 196  RREVKQQEEE---PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA 252
            R + K++ EE     +   EL    K   YE++  +        +L   K +  EEKK+ 
Sbjct: 1998 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRK----TKDELLHWTKELTEEEKKAL 2053

Query: 253  AF-AKILDPAYQVDK-----------------------GGRVRFVVELAD-PKLEVKWYK 287
            A   KI  P ++ DK                       G    F V +   P  E +WYK
Sbjct: 2054 AEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYK 2113

Query: 288  NGQEIRPSTK---YIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTELFVREP 340
            NG +I  S +   Y  E   C+  L I +    D +   V     AG+      L V+  
Sbjct: 2114 NGVKIERSDRIYWYWPEDNVCE--LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2171

Query: 341  PIMV-TKQLEDTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             ++  T++L+D  A   + +   ECE SE    VKW+K+G E+  G K  YR+  + K H
Sbjct: 2172 QLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK--YRMHSDRKVH 2229

Query: 399  ILIIEGATKADAAEYS---VMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
             L I     +DA +YS   V     +++AKL V+   ++ +  L D  V       L+C 
Sbjct: 2230 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2289

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S ENI GKW  N + ++ + +  +  +     L + +   ED+G+Y F  D    T   
Sbjct: 2290 VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT--C 2347

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR 574
            K+ +   P  IL GL       V  G+ ++LE+ +S E   + +W + D   ++ S R+ 
Sbjct: 2348 KLKMKPRPIAILQGLSDQK---VCEGDIVQLEVKVSLE-SVEGVWMK-DGQEVQPSDRVH 2402

Query: 575  TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                  S  L+I+   ++D+G Y   +          + V  VD   P
Sbjct: 2403 IVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITP 2450



 Score =  107 bits (268), Expect = 5e-23
 Identities = 208/939 (22%), Positives = 343/939 (36%), Gaps = 124/939 (13%)

Query: 239  KRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTK 297
            +R+++    E K+A   K      +V  G   +F  E+   P +  +W+K G+EI  S K
Sbjct: 3442 ERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDK 3501

Query: 298  YIFEHKGCQRILFINNCQMTDDSEYYVTAGDE----KCSTELFVRE--PPIMVTKQLEDT 351
                       L I   Q+ D  EY   A +E     C+  L V E  PP  +++  +  
Sbjct: 3502 CSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRP-KSL 3560

Query: 352  TAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
            T + G+  +  C V+        W K+G  + P P   +RI     KHIL +   T  D 
Sbjct: 3561 TTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSP--NWRISDAENKHILELSNLTIQDR 3618

Query: 411  AEYSVMTTGGQSS----AKLSVDLKP--LKILTPLTDQTVNLGKEICLKCEISEN--IPG 462
              YS   +    +    A+L +  KP  +K L P+      + K++ L+C++ E+  +  
Sbjct: 3619 GVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSA---INKKVHLECQVDEDRKVTV 3675

Query: 463  KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVID 520
             W+K+G  +      K+  + +I  L I  A  +D G YV   + +A + +  A V V +
Sbjct: 3676 TWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVRE 3735

Query: 521  PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
            PP  +      D +  ++ G   RL   + G P  +  W + +K + E S  +R      
Sbjct: 3736 PPSFV---KKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSE-SNTVRMYFVNS 3791

Query: 581  SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD----DWC 636
             + L I   + +DSG Y     N+ G    S ++ +    +PP      E  D       
Sbjct: 3792 EAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVI---KEPPSFIKTLEPADIVRGTNA 3848

Query: 637  IMNWEPPAYDGGSPI-LGYFIERKKKQSSRWMRLNFD---LCKETTFEPKKMIEGVAYEV 692
            ++  E     G  P  + +F ++K+ +SS+  RL      +C E  F       G    V
Sbjct: 3849 LLQCE---VSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLE-IFSFNSADVGEYECV 3904

Query: 693  RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
                V   G     +   P  P  V     L+ +   T  T+    R  + I    + G 
Sbjct: 3905 VANEVGKCGCMATHLLKEP--PTFVKKVDDLIALGGQT-VTLQAAVRGSEPISVTWMKG- 3960

Query: 753  VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
              +         K S  NG A         I+ +  +    K+T               A
Sbjct: 3961 --QEVIREDGKIKMSFSNGVAVL-------IIPDVQISFGGKYTCL-------------A 3998

Query: 813  VNAAGASEPKYYSQPILVKEII--EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPE 870
             N AG+           V E+I  EP KI     L Q      G+   L     G P  +
Sbjct: 3999 ENEAGSQTS--------VGELIVKEPAKIIERAELIQV---TAGDPATLEYTVAGTPELK 4047

Query: 871  LTWKKDGAEI---DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQ 927
              W KDG  +    K +I+ +N+      +   AE   SG+Y  ++  +    +      
Sbjct: 4048 PKWYKDGRPLVASKKYRISFKNNVAQLKFY--SAELHDSGQYTFEISNEVGSSSCETTFT 4105

Query: 928  IIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHR 987
            ++DR               ++A  +T P  + ++ + G    + D K      +   + +
Sbjct: 4106 VLDR---------------DIAPFFTKPLRNVDSVVNGTC--RLDCKIAGSLPMRVSWFK 4148

Query: 988  TSATITELVIGNEYYFRVFSENMCGLS------EDA---TMTKESAVIARDGKIYKNPVY 1038
                I      ++ Y   F E    L        DA   T    ++V ++D         
Sbjct: 4149 DGKEIA----ASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSS------- 4197

Query: 1039 EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1098
                  E P F     +   + G    L  + +G+    I W K    +V      +   
Sbjct: 4198 GALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKE 4257

Query: 1099 QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
                +LE+      D GTY CK  N  G VE    L VK
Sbjct: 4258 ALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVK 4296



 Score =  107 bits (266), Expect = 8e-23
 Identities = 190/903 (21%), Positives = 337/903 (37%), Gaps = 138/903 (15%)

Query: 281  LEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY--YVT--AGDEKCSTELF 336
            +++ W K+ +EIRP   Y          L +      D  +Y  Y +  AG + CS +L 
Sbjct: 7241 IKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLG 7300

Query: 337  VREPPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
            V+EPP  + K          E    EC++    +  V W+K+  EI     S++R+    
Sbjct: 7301 VQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEI--QESSKFRMSFVD 7358

Query: 396  KKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLK----PLKILTPLTDQTVNLGKEIC 451
               +L +   +  D+ +Y+        SA  S  LK    P+    P   +T+  G ++ 
Sbjct: 7359 SVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLK-GADVH 7417

Query: 452  LKCEISENIPG--KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DA 507
            L+CE+    P    W K+   ++   + K++ +  +  + I N    D G+Y      D 
Sbjct: 7418 LECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDV 7477

Query: 508  YNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             + T    + +  PP+ +    D    ++ + G +++L+  I G  P   +W +    I+
Sbjct: 7478 GSDTCVGSIALKAPPRFVKKLSD----ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIV 7533

Query: 568  EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--EAHASIKV----KVVDFPD 621
              S  I      + +TL     E  ++G Y   +KN+AG  E  A++ V     +V+ P+
Sbjct: 7534 RESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPE 7593

Query: 622  PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
                 ++     D C +         G+P L          S++W +   +L  +  ++ 
Sbjct: 7594 -----SIKVTTGDTCTLE----CTVAGTPEL----------STKWFKDGKELTSDNKYK- 7633

Query: 682  KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
                  +++  ++  +  I ++        F         +      V+D TV     PP
Sbjct: 7634 ------ISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTV-----PP 7682

Query: 742  DHI----GAAGLDG--YVLEYCFEGS--TSAKQSDENGEAAYDLPAEDWIVANKDLIDKT 793
                      GL G   V+E    GS   S     E  E +     +  +  N       
Sbjct: 7683 SFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDN-----TC 7737

Query: 794  KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 853
              T+  L           A N AG+ E    S P+ V+E   P  ++ P  +        
Sbjct: 7738 ALTVNMLEESDSGDYTCIATNMAGSDE---CSAPLTVRE--PPSFVQKPDPMDVL----T 7788

Query: 854  GEAVNLVIPFQGKPRPELTWKKDGAEI---DKNQINIRNSETDTIIFIRKAERSHSGKYD 910
            G  V      +G P   ++W K  +E+   D+  +++ +S  +  +F    + S SG+Y 
Sbjct: 7789 GTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELF--DVDTSQSGEYT 7846

Query: 911  LQVKVD----------------KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTP 954
              V  +                KFV+  + D  I    G P I++        +++TW  
Sbjct: 7847 CIVSNEAGKASCTTHLYIKAPAKFVKRLN-DYSI--EKGKPLILEGTFTGTPPISVTW-- 7901

Query: 955  PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
             K +G   I     Q+ +  + E   ++E     S+T+ +    N Y      ++ C   
Sbjct: 7902 -KKNG---INVTPSQRCNITTTEKSAILE---IPSSTVEDAGQYNCYIENASGKDSC--- 7951

Query: 1015 EDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNP 1074
                    SA I     +   P Y          F + L       G +A+L C + G P
Sbjct: 7952 --------SAQI-----LILEPPY----------FVKQLEPVKVSVGDSASLQCQLAGTP 7988

Query: 1075 KPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
            +  ++W K    +     Y+M     V TL   +    D G Y CKA N +G V     L
Sbjct: 7989 EIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFL 8048

Query: 1135 EVK 1137
             V+
Sbjct: 8049 TVQ 8051



 Score =  107 bits (266), Expect = 8e-23
 Identities = 171/808 (21%), Positives = 305/808 (37%), Gaps = 106/808 (13%)

Query: 356   GERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHI--LIIEGATKADAAE 412
             G  V+L   +S   A  ++W+K+ +E+    ++   + VE    +  ++I+ A + ++  
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKDDKEL----QTNALVCVENTTDLASILIKDADRLNSGC 26942

Query: 413   YSVMTTGGQSSAKLSVDL----KPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
             Y +       SA  ++ +    KP     P+  +TV   K   L    +++   K T   
Sbjct: 26943 YELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYI 27002

Query: 469   LPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH-VIDPPK 523
             +  +E+ R+   +    + + +I         +Y+F   A + Y +  P +   V+    
Sbjct: 27003 VEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNA 27062

Query: 524   IILDGLDADNTVTVIAGNKLRL----EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
              +  G      VT I  N + +     I   G         + DK  + G  ++  E+  
Sbjct: 27063 FVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSL-GWFKVLKETIR 27121

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGE---AHASIKVKVVDFPDPPVAPTVTEVGDDW- 635
             D+   V  + E  D   Y +   N AG+   +  S   K  D  DPP  P    + D   
Sbjct: 27122 DTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 27180

Query: 636   --CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETTFEPKKMIEGVAYEV 692
                 + W  P YDGGS + GY +E ++ +   W  ++     + T +    +  GV Y  
Sbjct: 27181 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 27240

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R+ AVN  G  +P   + P     +   P +       D  V +R      I  AG D  
Sbjct: 27241 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEI-------DLDVALR---TSVIAKAGEDVQ 27290

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             VL   F+G                 P   W    K+L    +++I    TD+   + +  
Sbjct: 27291 VL-IPFKGRPP--------------PTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQ 27333

Query: 813   VN-----------AAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTYIRRVGE--- 855
             V              G  EPK  S  + VK +  P    K+++ +H+ +  +  + +   
Sbjct: 27334 VTRNDTGKYILTIENGVGEPK--SSTVSVKVLDTPAACQKLQV-KHVSRGTVTLLWDPPL 27390

Query: 856   ------AVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKY 909
                    +N VI  + +   + TW     +       + +    T  F R    +  G  
Sbjct: 27391 IDGGSPIINYVI--EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIG-- 27446

Query: 910   DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
                  + +  ET    ++  + P P + + ++D    +V L+WT P  DG + IT Y ++
Sbjct: 27447 -----IGEPCETTE-PVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVE 27500

Query: 970   KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
             +  K    W +           +++L   +   FRVF++N  GLS+  T+          
Sbjct: 27501 RKGKGEQTW-SHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI---------- 27549

Query: 1030  GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
             G I    V E     E  +   P        G+N  L    +G PKP I+W+K+ + + +
Sbjct: 27550 GPI---TVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 27606

Query: 1090  DPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
                 R    +   TL I+      GG Y
Sbjct: 27607 SEFVRFSKTENKITLSIKNAKKEHGGKY 27634



 Score =  106 bits (265), Expect = 1e-22
 Identities = 182/920 (19%), Positives = 337/920 (36%), Gaps = 142/920 (15%)

Query: 266  KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
            +G   RF   ++   L+V WY   ++I+PS  +          L I      D+  Y   
Sbjct: 3358 EGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFV 3417

Query: 326  A----GDEKCSTELFVREPPI------------------MVTKQLEDTTAYCGERVELEC 363
            A    G    +  L +  P                    ++ +++E      G   +  C
Sbjct: 3418 ASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTC 3477

Query: 364  EV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE--GATKADAAEYSVMTTGG 420
            E+ S  +   +WFK G EI    K   R      K+I  +E       D  EY+   +  
Sbjct: 3478 EIQSAPNVRFQWFKAGREIYESDKCSIR----SSKYISSLEILRTQVVDCGEYTCKASNE 3533

Query: 421  QSSAKLSVDLK-----PLKILTPLTDQTVNLGKEICLKCEISEN--IPGKWTKNGLPVQE 473
              S   +  L      P   L+     T  +GK     C ++    I   W K+G  +  
Sbjct: 3534 YGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSP 3593

Query: 474  SDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYNVTL-PAKVHVIDPPKIILDGLDA 531
            S   ++      H L ++N   +D G Y   A + +   +  A++ +ID P  I +    
Sbjct: 3594 SPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPV 3653

Query: 532  DNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTESYPDSSTLVIDIAE 590
             + +      K+ LE  +  +      WS+  + +  G   +I  E     +TL I +A+
Sbjct: 3654 QSAI----NKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFED--KIATLEIPLAK 3707

Query: 591  RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD---G 647
              DSG Y     NEAG +  S  V V    +PP    V +V   + ++  E         
Sbjct: 3708 LKDSGTYVCTASNEAGSSSCSATVTV---REPP--SFVKKVDPSYLMLPGESARLHCKLK 3762

Query: 648  GSPIL--GYFIERKKKQSSRWMRLNFDLCKETTFE--PKKMIEGVAYEVRIFAVNAIGIS 703
            GSP++   +F   K+   S  +R+ F +  E   +    K+ +  +Y     AVN +G  
Sbjct: 3763 GSPVIQVTWFKNNKELSESNTVRMYF-VNSEAILDITDVKVEDSGSYSCE--AVNDVGSD 3819

Query: 704  KPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTS 763
              S        + +  PP+ +      D                            G+ +
Sbjct: 3820 SCS------TEIVIKEPPSFIKTLEPADIV-------------------------RGTNA 3848

Query: 764  AKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKY 823
              Q + +G   +++    W    K +    K+ +      + + + + + N+A   E   
Sbjct: 3849 LLQCEVSGTGPFEI---SWFKDKKQIRSSKKYRL--FSQKSLVCLEIFSFNSADVGE--- 3900

Query: 824  YSQPILVKEIIEPPKIRIPRHLKQ--TYIRRV-------GEAVNLVIPFQGKPRPELTWK 874
                 +V   +          LK+  T++++V       G+ V L    +G     +TW 
Sbjct: 3901 --YECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWM 3958

Query: 875  KDGAEI--DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRP 932
            K G E+  +  +I +  S    ++ I   + S  GKY    + +   +T+  ++ + +  
Sbjct: 3959 K-GQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE-- 4015

Query: 933  GPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI 992
             P +I++      E + +T       G+ A   YT+    +   +W+             
Sbjct: 4016 -PAKIIE----RAELIQVT------AGDPATLEYTVAGTPELKPKWY-----------KD 4053

Query: 993  TELVIGNEYYFRVFSENMCGLSEDATMTKESA-----VIARDGKIYKNPVYEDFDFSEAP 1047
               ++ ++ Y   F  N+  L   +    +S      +    G       +   D   AP
Sbjct: 4054 GRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAP 4113

Query: 1048 MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIR 1107
             FT+PL N  ++      L+C + G+   +++W K+   I    RYR+   +G  +LEI 
Sbjct: 4114 FFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEII 4173

Query: 1108 KPSPYDGGTYCCKAVNDLGT 1127
            +    D G + C+A N +G+
Sbjct: 4174 RVDMNDAGNFTCRATNSVGS 4193



 Score =  106 bits (265), Expect = 1e-22
 Identities = 117/456 (25%), Positives = 185/456 (40%), Gaps = 83/456 (18%)

Query: 597   YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
             Y +N    +  + AS  +   +  D P  P VT+V      + W  PAYDGGS ++GY I
Sbjct: 28916 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYII 28975

Query: 657   ERK---KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPF 712
             ERK   +    RW++ N+ +  +  F    + EG  YE R+ A NA G ISK S  + P 
Sbjct: 28976 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 29035

Query: 713   VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGE 772
                   +PP       +    VT+R         AG D  VL+    G    K     G+
Sbjct: 29036 TCRDEYAPPKAELDARLHGDLVTIR---------AGSD-LVLDAAVGGKPEPKIIWTKGD 29085

Query: 773   AAYDL----------PAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 822
                DL               ++   D  D  K+T+T               NA+G     
Sbjct: 29086 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLT-------------VKNASGTK--- 29129

Query: 823   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW----KKDGA 878
               +  ++VK +  P                 G    L +    + +  L W    +  GA
Sbjct: 29130 --AVSVMVKVLDSP-----------------GPCGKLTVSRVTQEKCTLAWSLPQEDGGA 29170

Query: 879   EI--------DKNQIN--IRNSETDTIIFIRKAERSHSGKYDLQVK-VDKFVETASIDIQ 927
             EI        + +++N  I   E  T+ ++       + +Y  +V+ V+K+     ++ +
Sbjct: 29171 EITHYIVERRETSRLNWVIVEGECPTLSYV-VTRLIKNNEYIFRVRAVNKYGPGVPVESE 29229

Query: 928   -IIDR-----PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 981
              I+ R     P PP I +      E++ + WT P+ DG   I+ Y + K +KKS+ W  V
Sbjct: 29230 PIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRV 29289

Query: 982   IEHY--HRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              + Y  + T   +T L+ G +Y FRV + N  G SE
Sbjct: 29290 NKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSE 29325



 Score =  106 bits (264), Expect = 1e-22
 Identities = 128/545 (23%), Positives = 211/545 (38%), Gaps = 64/545 (11%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P V +       + W+PPA DGGSPI GY +E +++ ++ W R+N      TT 
Sbjct: 15705 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 15764

Query: 680   E--PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMR 737
             E     + E   Y  R+ AVN  G S+PS  +       +   P +  +D      +  +
Sbjct: 15765 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVF-IDIGAQDCLVCK 15823

Query: 738   WRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTI 797
                   I A        +  +E    AK++ ++G   +D+P +    A  +  + +   I
Sbjct: 15824 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDG--VHDIPED----AQLETAENSSVII 15877

Query: 798   TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAV 857
               +P   +      ++ A   +  K  +  + V ++  PPK      LK + I R    +
Sbjct: 15878 --IPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRL 15930

Query: 858   NLVIP------------FQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR-KAERS 904
             +  +P             + +      W K   +       + +  ++   F R +AE  
Sbjct: 15931 SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAEN- 15989

Query: 905   HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT 964
                ++ +   V+    T + D   I  P PP  +KI  +    V L+W PPK+DG + +T
Sbjct: 15990 ---RFGIGPPVETIQRTTARDP--IYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVT 16044

Query: 965   GYTIQ-----KADKKSMEWFTVIEH-YHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1018
              Y ++         K   W    +        T+ +LV G EY FRV + N  G+S+ + 
Sbjct: 16045 HYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSA 16104

Query: 1019  MTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKI 1078
                       D      P  +  +F E               G N  +   ++G P P +
Sbjct: 16105 TVGPCDCQRPD----MPPSIDLKEFMEVE------------EGTNVNIVAKIKGVPFPTL 16148

Query: 1079  TWMK-------NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIE 1131
             TW K       NK  ++ D           CTL I +    D G Y   AVN+LGT   E
Sbjct: 16149 TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKE 16208

Query: 1132  CKLEV 1136
              +L V
Sbjct: 16209 MRLNV 16213



 Score =  105 bits (263), Expect = 2e-22
 Identities = 101/375 (26%), Positives = 158/375 (42%), Gaps = 21/375 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +G  V+  V+++   +E  W K+GQE++PS +          +L I +    D   Y
Sbjct: 2366 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2425

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDD-ANVKWFKNGEEI 381
              T      ST   V    + V   L+D     G +  LEC+VS  D  +VKW+ N E+I
Sbjct: 2426 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2485

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
               P  R +  V+G K  L+I     +D   Y ++    +++  LSV+   +KI+  L D
Sbjct: 2486 --KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRD 2541

Query: 442  QTVNLGKEICLKCEISEN-IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T    + +  + E+S + I   W      ++ S + K+   G+I+KL + N + +DEG 
Sbjct: 2542 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2601

Query: 501  YVF--APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAM 558
            Y F    +  +  L      I  P         D TV          E+     P  K  
Sbjct: 2602 YTFYAGENMTSGKLTVAGGAISKPL-------TDQTVAESQEAVFECEV---ANPDSKGE 2651

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            W R  K  +  +  IR+ES      L+I   + DD G Y    K    +  A +KV+ V 
Sbjct: 2652 WLRDGKH-LPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVK 2708

Query: 619  FPDPPVAPTVTEVGD 633
                    TVTE  D
Sbjct: 2709 IKKTLKNLTVTETQD 2723



 Score =  103 bits (258), Expect = 7e-22
 Identities = 110/456 (24%), Positives = 174/456 (38%), Gaps = 80/456 (17%)

Query: 702   ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             + KP +P+ P            +  D VT   +T++W PP   G + +  Y+LE      
Sbjct: 20073 VGKPGIPTGP------------IKFDEVTAEAMTLKWAPPKDDGGSEITNYILE------ 20114

Query: 762   TSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA--- 818
                K+   N +         W+      + KT F +T L    +   RV A N  G    
Sbjct: 20115 ---KRDSVNNK---------WVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEG 20161

Query: 819   --SEPKYYSQPILVKEIIEPPKIRIPRH----LKQTYIRRVGEAVNLVIPFQGKPRPELT 872
               SEP     P  V +   PP I   RH    L  T  ++ G +       + K R  L 
Sbjct: 20162 LKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL 20221

Query: 873   WKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------I 924
             WK+     +K  I +R+ +   +        +   +Y+ +V                  +
Sbjct: 20222 WKR----ANKTPIRMRDFKVTGL--------TEGLEYEFRVMAINLAGVGKPSLPSEPVV 20269

Query: 925   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE- 983
              +  ID PG P+++ I      +V L WT PK DG   +TGY ++K D  S  W      
Sbjct: 20270 ALDPIDPPGKPEVINITR---NSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHV 20326

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDF 1043
             +    + T+T+LV G +Y FR+ ++N  G     + + E+ +I +D            ++
Sbjct: 20327 NVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTET-IICKD------------EY 20373

Query: 1044  SEAPMFTQPLVNTYAI--AGYNATLNC-SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1100
                 +   P +       AG    LN  S+ G P PK +W K    I      ++ S   
Sbjct: 20374 EAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPT 20433

Query: 1101  VCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                L I+  +  D G Y   A N  GT     K+ V
Sbjct: 20434 SSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTV 20469



 Score =  102 bits (255), Expect = 2e-21
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 15/389 (3%)

Query: 248   EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK-GCQ 306
             E+    F K L+    V KG  +    EL + + +V W K+G+ +      I     G  
Sbjct: 11208 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 11266

Query: 307   RILFINNCQMTDDSEYYVT---AGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELE 362
             R L IN+   TD   Y VT   A + +CS+ + V E     + K + D            
Sbjct: 11267 RALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFA 11326

Query: 363   CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQS 422
             C++++D  N+KWFK  +EI   P  +  I  +G    L I+ A   D AEY+V   G + 
Sbjct: 11327 CDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRY 11386

Query: 423   SAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVH 481
              AKL++  + +++L P+ D T+   +      EISE +IPG+W   G  ++ S   ++  
Sbjct: 11387 PAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKA 11446

Query: 482   KGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGN 541
             +G    L +     +  G+ ++   A N    A   ++   +I LD       VTV    
Sbjct: 11447 EGGKRFLTLHKVKLDQAGEVLY--QALNAITTA---ILTVKEIELDFAVPLKDVTVPERR 11501

Query: 542   KLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINL 601
             + R E  ++ E     +WS+G   I++ S +    +      LVI+ ++ DD GVY   +
Sbjct: 11502 QARFECVLTRE--ANVIWSKGPD-IIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEV 11558

Query: 602   KNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             + +   A   +    + F  P    TV E
Sbjct: 11559 EGKKTSARLFVTGIRLKFMSPLEDQTVKE 11587



 Score =  102 bits (254), Expect = 2e-21
 Identities = 85/281 (30%), Positives = 121/281 (43%), Gaps = 16/281 (5%)

Query: 283   VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
             V W K    I+ S K+     G + IL IN+ Q  D+  Y      +K S  LFV    +
Sbjct: 11515 VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRL 11574

Query: 343   MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                  LED T   GE     CE+S +  +V WFKN  ++         I  EGK H L +
Sbjct: 11575 KFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL--HTSRTVLISSEGKTHKLEM 11632

Query: 403   EGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG 462
             +  T  D ++         S+A+L V          L D+T     EI LKCE+S+++P 
Sbjct: 11633 KEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPV 11692

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV----FAPDAYNVTLPAKVHV 518
             KW K+G  +  S +  +   G    L I  A  +D+G+YV          NVT+ A++  
Sbjct: 11693 KWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIK 11752

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
             ++ P   L G      V V  G     EI +S EP     W
Sbjct: 11753 VEKP---LYG------VEVFVGETAHFEIELS-EPDVHGQW 11783



 Score =  102 bits (254), Expect = 2e-21
 Identities = 179/762 (23%), Positives = 289/762 (37%), Gaps = 135/762 (17%)

Query: 340   PPIMVTKQLEDTTAYCGERVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             P I++ +Q+   T   G+++ +E  V  +     KW K  +E++    S   +       
Sbjct: 18900 PKILMPEQI---TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTS--SHLAVHKADSSS 18954

Query: 399   ILIIEGATKADAAEYSVMT--TGGQSSAKLSV--------------------DLKPLKIL 436
             ILII+  T+ D+  YS+    + G  + K+ V                    D   L   
Sbjct: 18955 ILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWH 19014

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKW-TKNGLPVQESDRLKVVHKGRIH--------K 487
              PL D   N+   I  KC++S    G W T      + S R+  +  G+ +        +
Sbjct: 19015 IPLEDGGSNITNYIVEKCDVSR---GDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENR 19071

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL--DGLDADNTVTVIAGNKLRL 545
               I+  LT  +    F     +    A+V  ++   I +  D  D+D    +I       
Sbjct: 19072 FGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG------ 19125

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
                I  +     +W + +  +      +R+  YP +   +++  E      + I   N+A
Sbjct: 19126 -YLIERKERNSLLWVKANDTL------VRSTEYPCAG--LVEGLEYS----FRIYALNKA 19172

Query: 606   GEAHASIKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
             G +  S   + V      DPP  P V +V      + W  P +DGGS I+GYF+E  K  
Sbjct: 19173 GSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLP 19232

Query: 663   SSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
               +W+R N       +  +    + E   Y+ R  A  A+ IS PS PS P   LA   P
Sbjct: 19233 GDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVP 19292

Query: 721   P---------TLLTVDSVT----DTTV------TMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             P         +LLTV + T    D TV      T+ W+          DG +L+   EG 
Sbjct: 19293 PRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKK---------DGTLLKPA-EGI 19342

Query: 762   TSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 821
               A Q +           E + V  KD  D T  T           +++K ++  G    
Sbjct: 19343 KMAMQRNL-------CTLELFSVNRKDSGDYT-ITAENSSGSKSATIKLKVLDKPGPPAS 19394

Query: 822   ----KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVG-EAVNLVIPFQGKPRPELTWKKD 876
                 K YS   ++    EPP            +   G E  N ++  +   RP   W + 
Sbjct: 19395 VKINKMYSDRAMLSW--EPP------------LEDGGSEITNYIVDKRETSRPN--WAQV 19438

Query: 877   GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 936
              A +     ++           R    +  G  D       F E A I     D PG   
Sbjct: 19439 SATVPITSCSVEKLIEGHEYQFRICAENKYGVGD-----PVFTEPA-IAKNPYDPPGRCD 19492

Query: 937   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI--TE 994
                I ++  +++ ++W PP DDG + ITGY ++K + +++ W T +        T+  T 
Sbjct: 19493 PPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNW-TKVNRKPIIERTLKATG 19551

Query: 995   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
             L  G EY FRV + N  G  + +  +K  A  ARD +    P
Sbjct: 19552 LQEGTEYEFRVTAINKAGPGKPSDASK--AAYARDPQYPPGP 19591



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 93/361 (25%), Positives = 149/361 (41%), Gaps = 12/361 (3%)

Query: 271   RFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
             +F  E++      +W K  QEI    ++     G +  + I +    D+++Y   A D+ 
Sbjct: 11858 KFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH 11917

Query: 331   CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
              S +L +    +     L+D TA   E      E+S D+  VKWFKN + +         
Sbjct: 11918 TSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL--HTTRSVS 11975

Query: 391   IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
             ++ EGK H +  +  +  D ++  V   G  S AKL+V          L D T     E+
Sbjct: 11976 MQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV 12035

Query: 451   CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN 509
              L+CEIS+ + P KW K+G  ++ S    +   G+   L++  AL  D G Y    D   
Sbjct: 12036 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC--DCGT 12093

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS-RGDKAIME 568
                  K+ + D    ++  L   ++V V+     R E  IS E    A W  +G+  +  
Sbjct: 12094 DKTSGKLDIEDREIKLVRPL---HSVEVMETETARFETEIS-EDDIHANWKLKGEALLQT 12149

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
                 I+ E    S  LV+     D +G       N    AH  +K +V+    P    TV
Sbjct: 12150 PDCEIKEEGKIHS--LVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 12207

Query: 629   T 629
             T
Sbjct: 12208 T 12208



 Score = 97.1 bits (240), Expect = 9e-20
 Identities = 126/568 (22%), Positives = 206/568 (36%), Gaps = 75/568 (13%)

Query: 597   YHINLKNEAGEAHASIKVKVV---DFPDPPVAPTVTEVGDDW---CIMNWEPPAYDGGSP 650
             + +  +NE G    S+  + V   D  +PP  PT   V D       + W  P YDGG+P
Sbjct: 18468 FRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 18527

Query: 651   ILGYFIERKKKQSSR-----WMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             I+GY +E + K +       W R N         F    + E   YE R+ A N +GI +
Sbjct: 18528 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 18587

Query: 705   PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVT-----------MRWRPPDHIG--AAGLDG 751
             P+       P  +  PP +    S+    +            +R RP   +     G+D 
Sbjct: 18588 PAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDN 18647

Query: 752   YVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL-PTDAK-IFVR 809
              V +          Q D     A+       ++ N    D  K+++T + P   K +FV 
Sbjct: 18648 VVRK---------GQVDLVDTMAF------LVIPNSTRDDSGKYSLTLVNPAGEKAVFVN 18692

Query: 810   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 869
             V+ ++  G         P+   ++ +  K     H+        G +       + +   
Sbjct: 18693 VRVLDTPG---------PVSDLKVSDVTKTSC--HVSWAPPENDGGSQVTHYIVEKREAD 18741

Query: 870   ELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
               TW     E+ K   ++ N       + R    +  G       V   V    +    +
Sbjct: 18742 RKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGP-----GVPTDVPKPVLASDPL 18796

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY-TIQKADKKSMEWFTVIEHYHRT 988
               P PP+ +++ ++   +  L W PP  DG A I GY T  + +++  + +T        
Sbjct: 18797 SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDL 18856

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPM 1048
             S  +T L  G +Y FRV + N  G+S           + R+ +     VYE  +    P 
Sbjct: 18857 SLVVTGLKEGKKYKFRVAARNAVGVS-----------LPREAE----GVYEAKEQLLPPK 18901

Query: 1049  FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRK 1108
                P   T   AG    +   V G P P   W K +  +V      +        L I+ 
Sbjct: 18902 ILMPEQITIK-AGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 18960

Query: 1109  PSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              +  D G Y   A N  GT   + K+ V
Sbjct: 18961 VTRKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 147/655 (22%), Positives = 260/655 (39%), Gaps = 108/655 (16%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E+ SK  E   +  K      T   E +A +  +S+  I  +   Q  TV       F  
Sbjct: 32816 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVI--VTGLQDTTVSSDSVAKFAV 32873

Query: 80    KVKAEDLLRKPTIKWFK--------GKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
             K   E    +PT  W K        GK+     K G  L++ +T    S +YT  ++   
Sbjct: 32874 KATGEP---RPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVK--- 32927

Query: 132   AKDNFAGNYR--CEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELD 189
                N AG+    C++T K   D+ +  +   +++  TP        K++   +E + +  
Sbjct: 32928 ---NSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQ-------KKAVVQEEISQKAL 32977

Query: 190   FSGLLKRREVKQQE------EEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKR 243
              S  +K  E K QE      E  +V + E +K +  +  EK      IT           
Sbjct: 32978 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTS-------- 33029

Query: 244   MRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
                EE ++ A  K       +++G R+     +A    +VKW  NG E+  S +Y +   
Sbjct: 33030 QASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVS 33088

Query: 304   GCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYC---- 355
             G  + L I      D+      +    G  KC  +L        ++K+L D  A+     
Sbjct: 33089 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDL-------TLSKELSDAPAFISQPR 33141

Query: 356   ------GERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
                   G+ V   CE+S E    ++WFKN   I     S   I      + L I  A+ +
Sbjct: 33142 SQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI--SISSNVSISRSRNVYSLEIRNASVS 33199

Query: 409   DAAEYSVMTTG--GQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTK 466
             D+ +Y++      GQ SA  S+      ++ PL ++     +E+ L+     ++ G ++ 
Sbjct: 33200 DSGKYTIKAKNFRGQCSATASL------MVLPLVEEP---SREVVLRTSGDTSLQGSFSS 33250

Query: 467   NGLPVQESDR-----------LKVVHKGRIHKLVIANALTEDEGDYVFAPDAY----NVT 511
               + +  S +              + + +   +   +  +  E     +  ++    N+T
Sbjct: 33251 QSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT 33310

Query: 512   ---------LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
                      L A +  I PPKI  + L +D  +++  G  L +    +GEP P+  WS G
Sbjct: 33311 QLESSTSKMLKAGIRGI-PPKI--EALPSD--ISIDEGKVLTVACAFTGEPTPEVTWSCG 33365

Query: 563   DKAI-MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              + I  +  GR   E+  D +TL+I   ++ D G+Y ++L NE G   A++ + +
Sbjct: 33366 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 93/416 (22%), Positives = 158/416 (37%), Gaps = 58/416 (13%)

Query: 728   SVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANK 787
             +VT   +T+ WRPP   G A +  Y++E             E     + + +E       
Sbjct: 26977 TVTAEKITLLWRPPADDGGAKITHYIVE-----------KRETSRVVWSMVSEH------ 27019

Query: 788   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 847
               +++   T T +    +   RV+AVN  G  EP      +     + P    IP   K 
Sbjct: 27020 --LEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKI 27077

Query: 848   T-------YIRRVGEAVNLVIPF--QGKPRPELTW---KKDGAEIDKNQINIRNSETDTI 895
             T       + R + +  + +  +  + + +  L W    K+     + ++      +D  
Sbjct: 27078 TKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ 27137

Query: 896   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 955
               +     +  G +    +  +F + A      ID PGPP  ++I D    ++ L W+ P
Sbjct: 27138 YRVCAVNAAGQGPFS---EPSEFYKAADP----IDPPGPPAKIRIADSTKSSITLGWSKP 27190

Query: 956   KDDGNAAITGYTIQKADKKSMEWFTVIE--HYHRTSATITELVIGNEYYFRVFSENMCGL 1013
               DG +A+TGY ++    +  EW TV        T   ++ L  G  YYFRV + N  G 
Sbjct: 27191 VYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQ 27250

Query: 1014  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV---NTYAIAGYNATLNCSV 1070
              E   M               N   +  D  EAP     +    +  A AG +  +    
Sbjct: 27251 GEPIEM---------------NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPF 27295

Query: 1071  RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
             +G P P +TW K++  +  D RY + +      L I + +  D G Y     N +G
Sbjct: 27296 KGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVG 27351



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 133/594 (22%), Positives = 227/594 (38%), Gaps = 52/594 (8%)

Query: 60   FIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERH 119
            F++KP    V  G ++TF + VK        ++ WFKG   +L      ++ L+++    
Sbjct: 7777 FVQKPDPMDVLTGTNVTFTSIVKGTPPF---SVSWFKGS-SELVPGDRCNVSLEDSVA-- 7830

Query: 120  SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSG 179
                  E+++     + +G Y C V+ +    SC+  L +         ++  S  K   
Sbjct: 7831 ------ELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKP 7884

Query: 180  EGQEDA--GELDFSGLLKRREVKQQEEEPQVDVWELLKNAK---PSEYEKIAFQYGITDL 234
               E    G    S   K+  +     + + ++    K+A    PS   + A QY     
Sbjct: 7885 LILEGTFTGTPPISVTWKKNGINVTPSQ-RCNITTTEKSAILEIPSSTVEDAGQYNCYIE 7943

Query: 235  RGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIR 293
                K     +    +   F K L+P  +V  G       +LA  P++ V WYK   ++R
Sbjct: 7944 NASGKDSCSAQILILEPPYFVKQLEPV-KVSVGDSASLQCQLAGTPEIGVSWYKGDTKLR 8002

Query: 294  PSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREP--PIMVTKQ 347
            P+T Y    +     L  N   + D  EY   A    G+   ST L V+E   P   ++Q
Sbjct: 8003 PTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQ 8062

Query: 348  LEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT 406
            L D     G  V  +C +S  +  +V W+K+G+ +   P    +         L I    
Sbjct: 8063 LRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSP--NVQTSFLDNTATLNIFKTD 8120

Query: 407  KADAAEYSVMTTGGQSSAKLSVDLKPLKILTP------LTDQTVNLGKEICLKCEISENI 460
            ++ A +YS   T    SA  S  L   +   P      L      +G+    +C ++   
Sbjct: 8121 RSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQ 8180

Query: 461  PGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV------FAPDAYNVTL 512
            P K  W K+   ++   + ++ +      L +      D G Y          D+    L
Sbjct: 8181 PIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQL 8240

Query: 513  PAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGR 572
              K  +I PP           TV    GN  +LE  ++G  P    W + +  I   S  
Sbjct: 8241 NIKERLI-PPSFT---KRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTS-- 8294

Query: 573  IRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               E    ++TLV+ +  A  +D+G+Y   + N+AG A  +  + + +   PPV
Sbjct: 8295 -NCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPV 8347



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 18/216 (8%)

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRT 988
             ++PG P    I  V  ++  + W PP  DG A I  Y ++K +KK  +W +V  E    T
Sbjct: 30823 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 30882

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFS-EAP 1047
               ++  L+ G EY FRV  EN+ G SE + +++              P+    D   +AP
Sbjct: 30883 VFSVKNLIEGLEYEFRVKCENLGGESEWSEISE--------------PITPKSDVPIQAP 30928

Query: 1048  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFS-NQGVCTLE 1105
              F + L N       NATL C V G+PKP + W +  K  I D  +YR+     G   L 
Sbjct: 30929 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 30988

Query: 1106  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1141
             I   +  D   Y  +A N  G+V     LEV+V A+
Sbjct: 30989 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAK 31024



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 139/610 (22%), Positives = 235/610 (38%), Gaps = 87/610 (14%)

Query: 63   KPQGGTVKVGEDITFIAKVKAEDLLRKP--------------TIKWFKGKWMDLASKAGK 108
            K   G + V E  +F+ K  ++D+L                 TI+WFKG   +L S    
Sbjct: 4194 KDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGN-KELVSGGSC 4252

Query: 109  HLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPN 168
            ++  KE  E      + E+ ++K  D+  G Y C+V+       CS +L V E       
Sbjct: 4253 YIT-KEALES-----SLELYLVKTSDS--GTYTCKVSNVAGGVECSANLFVKEPATFVEK 4304

Query: 169  IDIRSAFKRSGEGQ-----EDAGELDFSGLLKRREVKQQEEEPQ--VDVWELLKNAKPSE 221
            ++     K+    Q          +  +     RE+K+  +     V+   +L+      
Sbjct: 4305 LEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLR------ 4358

Query: 222  YEKIAFQYGITDLRGMLKRLKRMRREE--------KKSAAFAKILDPAYQVDKGGRVRFV 273
                    GI D    +   +     +        K+S  F K   P  +V K   V  +
Sbjct: 4359 ----LTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKP-IEVLKEYDVMLL 4413

Query: 274  VELA-DPKLEVKWYKNGQEIRPSTKY---IFEHKGCQRIL-FI------NNCQMTDDSEY 322
             E+A  P  E+ W+K+   +R   KY   I +H    +IL F+        C++T++   
Sbjct: 4414 AEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNE--- 4470

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED-DANVKWFKNGEEI 381
                G   CS  + +REPP  + K++E T++  G     +  +       V W K+ +EI
Sbjct: 4471 ---VGSSICSARVTLREPPSFI-KKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEI 4526

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG----QSSAKLSVDLKPLKILT 437
                    R+  E     L + G       +Y           + SA LSV  +P  I  
Sbjct: 4527 T--EDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVK-EPATITE 4583

Query: 438  PLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALT 495
                  V  G    L+ + S  + I  KW K+G  +    + K+     +  L I +   
Sbjct: 4584 EAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEK 4643

Query: 496  EDEGDYVF--APDAYNVTLPAKVHVID---PPKIILDGLDADNTVTVIAGNKLRLEIPIS 550
            +D G+Y F    D    +  A+++V+D   PP         D+    I G+ + LE  ++
Sbjct: 4644 KDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDS----IKGSFIDLECIVA 4699

Query: 551  GEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHA 610
            G  P    W + D+ I   S + +   + +++ L I   E  DSG Y  +  N+AG    
Sbjct: 4700 GSHPISIQWFKDDQEI-SASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQC 4758

Query: 611  SIKVKVVDFP 620
            S  + V + P
Sbjct: 4759 SGHLTVKEPP 4768



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 99/438 (22%), Positives = 170/438 (38%), Gaps = 59/438 (13%)

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
             N+  ++  +  S  +  +D  DPP  P    +      + W  P Y GG  I  Y +E++
Sbjct: 21337 NMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKR 21396

Query: 660   KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVPLAVT 718
                + RW++ NF    E  F    + E  AYE R+ A NA G IS PS PS         
Sbjct: 21397 DLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDV 21456

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGA--AGLDGYVLEYCFEGSTSAKQSDENGEAAYD 776
               P  + VD     TV ++      + A  +G     +E+  +G       +  G A  +
Sbjct: 21457 EAPK-IKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDG------KELEGTAKLE 21509

Query: 777   LPAEDWI--VANKDLI--DKTKFTITGLPTD--AKIFVRVKAVNAAGASEPKYYSQPILV 830
             +   D+   + NKD    D   +T+T       AK    VK ++  G  E      P+ V
Sbjct: 21510 IKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-----GPLAV 21564

Query: 831   KEIIE--------PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK 882
              E+          PP            +   G  ++  I  Q +    L W    +E+  
Sbjct: 21565 TEVTSEKCVLSWFPP------------LDDGGAKIDHYI-VQKRETSRLAWTNVASEVQV 21611

Query: 883   NQINI-RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
              ++ + +  + +  IF   A   +     L+           + +     P PP+  ++ 
Sbjct: 21612 TKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-------SEPVLAVNPYGPPDPPKNPEVT 21664

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-----TVIEHYHRTSATITELV 996
              +  +++ + W  P  DG + I  Y +++ DK    W      T+ +  ++ S     L 
Sbjct: 21665 TITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSG----LT 21720

Query: 997   IGNEYYFRVFSENMCGLS 1014
              G+EY FR+ +EN  G+S
Sbjct: 21721 EGHEYEFRIMAENAAGIS 21738



 Score = 89.0 bits (219), Expect = 2e-17
 Identities = 61/198 (30%), Positives = 88/198 (44%), Gaps = 18/198 (9%)

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
             P PP+ VK  D    ++ LTW PPK+DG + I GY +++  + S +W    E    T   
Sbjct: 13588 PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKME 13647

Query: 992   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP---M 1048
             +T L  G  Y +RV + N  G S+ +  T+E   +               D  EAP   +
Sbjct: 13648 VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAV---------------DTQEAPEIFL 13692

Query: 1049  FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRK 1108
               + L      AG    L  +V G P+PKITW K  + +  D R  + +     T+ I  
Sbjct: 13693 DVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVD 13752

Query: 1109  PSPYDGGTYCCKAVNDLG 1126
                 D GTY  +AVN  G
Sbjct: 13753 SKRSDTGTYIIEAVNVCG 13770



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 112/510 (21%), Positives = 197/510 (38%), Gaps = 70/510 (13%)

Query: 648   GSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             G P+    + R        MR N ++  E  T   K+ +   A    I A N+ G +K  
Sbjct: 26502 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 26561

Query: 707   MPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
             +     V L    PPT  + +  +T+ +VT++W PP + G + +  Y+L    +  TS  
Sbjct: 26562 IN---IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIL---LKRETSTA 26615

Query: 766   QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
                E                    + +T   +  L T  +   R+KA N  G S+    S
Sbjct: 26616 VWTEVSAT----------------VARTMMKVMKLTTGEEYQFRIKAENRFGISD-HIDS 26658

Query: 826   QPILVK---EIIEPPKIRIPRHLKQTYI-----RRVGEAVNLVIPF--QGKPRPELTWKK 875
               + VK       PP      ++ +  I       V    + V+ +  + K R  + W+K
Sbjct: 26659 ACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK 26718

Query: 876   DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETA-----SIDIQIID 930
                    N++ IR +        +    S    Y+ +V  +           S  +  ID
Sbjct: 26719 ------ANKLVIRTTH------FKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAID 26766

Query: 931   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTS 989
                PP+ V+I D+   +V+L+W  P  DG + ITGY +++ D     W      +   T 
Sbjct: 26767 ACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQ 26826

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1049
               I+ L   ++Y FRVF+ N  G     +++  S V+         P+    D    P+ 
Sbjct: 26827 FIISGLTQNSQYEFRVFARNAVG-----SISNPSEVVG--------PI-TCIDSYGGPVI 26872

Query: 1050  TQPLVNTYAI---AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
               PL  T  +   AG +  L   + G P P I W K+   +  +    + +   + ++ I
Sbjct: 26873 DLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILI 26932

Query: 1107  RKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             +     + G Y  K  N +G+     ++++
Sbjct: 26933 KDADRLNSGCYELKLRNAMGSASATIRVQI 26962



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 126/561 (22%), Positives = 206/561 (36%), Gaps = 56/561 (9%)

Query: 91   TIKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKF 150
            +I+WFK      AS+       K  F  H      E+  ++  D+  G Y C  T K   
Sbjct: 4705 SIQWFKDDQEISASE-------KYKFSFHDNTAFLEISQLEGTDS--GTYTCSATNKAGH 4755

Query: 151  DSCSFDLEVHE---------STGTTPNIDIRSAFKRSGEGQ------EDAGELDFSGLLK 195
            + CS  L V E         S    PN  ++      G         +D  EL       
Sbjct: 4756 NQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAA-- 4813

Query: 196  RREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFA 255
             R V + +    ++++        +   +++   G    +  L          K+   F 
Sbjct: 4814 -RSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLF--------VKEPPQFI 4864

Query: 256  KILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNC 314
            K   P   +  G    F  ++   PK+ V WY +G EI    K+            I+  
Sbjct: 4865 KKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGA 4924

Query: 315  QMTDDSEYYV----TAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVS-EDD 369
            ++ +   Y       AG   CS EL V+EPP  + ++L+         VELECEV+    
Sbjct: 4925 RVENSGTYVCEARNDAGTASCSIELKVKEPPTFI-RELKPVEVVKYSDVELECEVTGTPP 4983

Query: 370  ANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYS--VMTTGGQSSAKLS 427
              V W KN  EI    K  Y +        L I     +D  EY   V   GG  S    
Sbjct: 4984 FEVTWLKNNREIRSSKK--YTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTR 5041

Query: 428  VDLK-PLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGR 484
            V LK P   +  + + T  L      +  ++ + P    W K+   + E D + +     
Sbjct: 5042 VALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDS 5101

Query: 485  IHKLVIANALTEDEGDYVF-APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKL 543
            +  L I +      G Y   A +   V       ++  P  I   ++   +V V   + +
Sbjct: 5102 VATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQI---VEKAKSVDVTEKDPM 5158

Query: 544  RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STLVIDIAERDDSGVYHINLK 602
             LE  ++G P  K  W +  K I+    R  + S+ ++ ++  I    + DSG Y   ++
Sbjct: 5159 TLECVVAGTPELKVKWLKDGKQIV--PSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVE 5216

Query: 603  NEAGEAHASIKVKVVDFPDPP 623
            N+ G +     ++V+D   PP
Sbjct: 5217 NDFGSSSCDAYLRVLDQNIPP 5237



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 94/359 (26%), Positives = 158/359 (44%), Gaps = 23/359 (6%)

Query: 285   WYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT---AGDEKCST-ELFVREP 340
             W K+G  IR S K+ F   G  R L I + Q++D  EY         EK ST +L V E 
Sbjct: 11151 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 11210

Query: 341   PIMVTKQL-EDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHI 399
             P+   K L E+ T   G+ + L CE+++ + +V W K+G+ ++  P  R    V G    
Sbjct: 11211 PVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKP-GRIVPGVIGLMRA 11268

Query: 400   LIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL-----TPLTDQTVNLGKEICLKC 454
             L I  A   DA  Y+V T    ++ + S  +K ++++      P+ DQ V         C
Sbjct: 11269 LTINDADDTDAGTYTV-TVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 11327

Query: 455   EISENIPG-KWTK--NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 511
             +I+++ P  KW K  + +P + +D+ +++  G    L I NA+ ED  +Y  A +     
Sbjct: 11328 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEY--AVEIEGKR 11385

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              PAK+ + +    +L  ++    VT+        +  IS    P     +G+  ++  S 
Sbjct: 11386 YPAKLTLGEREVELLKPIE---DVTIYEKESASFDAEISEADIPGQWKLKGE--LLRPSP 11440

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                 ++      L +   + D +G       N    A  ++K   +DF  P    TV E
Sbjct: 11441 TCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPE 11499



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 78/292 (26%), Positives = 125/292 (42%), Gaps = 60/292 (20%)

Query: 265   DKGGRVRFV--VELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             ++GG V++V  +E  D   +V WY   +++  S KY   ++    IL++ +    DD  Y
Sbjct: 31580 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 31639

Query: 323   YVTA----GDEKCSTELFVR---------------------------EPPIMVTKQLEDT 351
                     G++    ELFV+                           E P   T  L + 
Sbjct: 31640 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 31699

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK-SRYRIRVEGKKHILIIEGATKAD 409
             TAY GE V     ++   + +V W+K+G++I PG    +Y    +   + L I   T  D
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 31759

Query: 410   AAEYSVMTTG--GQSS--AKLSVDLKPLKILTPLTDQTV-------------NLGKEICL 452
              AEY+V+     G+ S  AKL+V L P     P TD T+               G+ +C 
Sbjct: 31760 DAEYTVVARNKYGEDSCKAKLTVTLHP-----PPTDSTLRPMFKRLLANAECQEGQSVCF 31814

Query: 453   KCEISENIPG--KWTKNGLPVQESDRLKVVHKG-RIHKLVIANALTEDEGDY 501
             +  +S   P   KW K+G P+     ++++H+G   + L I + L ED G Y
Sbjct: 31815 EIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 31866



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 91/401 (22%), Positives = 161/401 (40%), Gaps = 47/401 (11%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEI----RPSTKYIFEHKGCQRILFINNCQMTD 318
            QV +  R     E+ +  ++  WYK+G EI    +   KY+ E +     +FI+  + +D
Sbjct: 3157 QVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR--IHRMFISETRQSD 3214

Query: 319  DSEYYVTAGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFK 376
              EY   AG  + S  L+V  P P  V ++L+  T   G+       +S      + W+K
Sbjct: 3215 AGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYK 3274

Query: 377  NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA--------EYSVMTTGGQSSAKL-- 426
              + +  G K ++    +G+++ L++  A   DAA        +Y V TT    S ++  
Sbjct: 3275 EEQLLSTGFKCKF--LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3332

Query: 427  ------SVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKV 479
                   + + P  I+TPL D   + G+    +C +S  ++   W      ++ S   ++
Sbjct: 3333 VVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3392

Query: 480  VHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDAD----- 532
                  ++L IA A  EDEG Y F        V+  A + +  P  I+ + ++ +     
Sbjct: 3393 TQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEM 3452

Query: 533  ----------NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTESYPDS 581
                        + V  G+  +    I   P  +  W +  + I E     IR+  Y   
Sbjct: 3453 KAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKY--I 3510

Query: 582  STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
            S+L I   +  D G Y     NE G    +  + V +   P
Sbjct: 3511 SSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPP 3551



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 115/472 (24%), Positives = 174/472 (36%), Gaps = 92/472 (19%)

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R  AVN   + KP  P+ P            L ++ +T    ++ W  P   G A +D Y
Sbjct: 25871 RSVAVNCKVLDKPGPPAGP------------LEINGLTAEKCSLSWGRPQEDGGADIDYY 25918

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             ++E             E    A       W +   +L   T   +T L    +   RV  
Sbjct: 25919 IVE-----------KRETSHLA-------WTICEGEL-QMTSCKVTKLLKGNEYIFRVTG 25959

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
             VN  G  EP    + + +K +        P  L+ T + +  E++ L        RPE  
Sbjct: 25960 VNKYGVGEPL---ESVAIKALDPFTVPSPPTSLEITSVTK--ESMTLCWS-----RPE-- 26007

Query: 873   WKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI---- 928
                 G+EI    I  R  E +++ ++R  ++     YDL+VK     E    + ++    
Sbjct: 26008 -SDGGSEISGYIIERR--EKNSLRWVRVNKKP---VYDLRVKSTGLREGCEYEYRVYAEN 26061

Query: 929   -------------------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
                                +  P PP   KI D     + + W  P  DG A ITGYT++
Sbjct: 26062 AAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVE 26121

Query: 970   KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
                    +W T I+    T  TI+ L  G EY FRV S N  G S+ +  +        D
Sbjct: 26122 YKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSS--------D 26173

Query: 1030  GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
              +I K    E     ++ M    +V     AG + T+    RG P P + W K       
Sbjct: 26174 PQIAKEREEEPLFDIDSEMRKTLIVK----AGASFTMTVPFRGRPVPNVLWSKPDT---- 26225

Query: 1090  DPRYRMF--SNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
             D R R +  +     +L I   +  D G Y     N L    +   L VKV+
Sbjct: 26226 DLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASL--TLVVKVL 26275



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 128/602 (21%), Positives = 222/602 (36%), Gaps = 112/602 (18%)

Query: 581   SSTLVIDIAERDDSGV--YHINLKNEAGEAH----ASIKVKV------VDFPDPPVAPTV 628
             S T  I++++  +  V  + +  KNE G +       I VK       VD  D P A   
Sbjct: 27515 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVT 27574

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEG 687
               +G +   ++ E P      P + +  +    + S ++R +    K T + +  K   G
Sbjct: 27575 VRIGHN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHG 27631

Query: 688   VAYEVRI--------FAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
               Y V +          +  I +  PS P  P            +  D +   +V + W 
Sbjct: 27632 GKYTVILDNAVCRIAVPITVITLGPPSKPKGP------------IRFDEIKADSVILSWD 27679

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P+  G   +  Y +E      T+ K    +                   + +T F +  
Sbjct: 27680 VPEDNGGGEITCYSIEKRETSQTNWKMVCSS-------------------VARTTFKVPN 27720

Query: 800   LPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 859
             L  DA+   RV+A N  G S      QP++   I+   + RIP           G+ V  
Sbjct: 27721 LVKDAEYQFRVRAENRYGVS------QPLVSSIIVAKHQFRIPGP--------PGKPVIY 27766

Query: 860   VIPFQGKPRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERSHSGK------- 908
              +   G     LTW       G+E+     ++   E ++I++ +      SG+       
Sbjct: 27767 NVTSDGM---SLTWDAPVYDGGSEV--TGFHVEKKERNSILWQKVNTSPISGREYRATGL 27821

Query: 909   -----YDLQVKVDKFVETAS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 955
                  Y  +V  +     +S        + +  +D PG P  +   DV  E + L W PP
Sbjct: 27822 VEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPP 27878

Query: 956   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
               DG + I GY+I+K                    T+T L  G+ Y FR+ + N  G   
Sbjct: 27879 LRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTIS 27938

Query: 1016  DATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPK 1075
               + +    ++ RD  +   P   +F     P +   L+     +G +  +   V+G P 
Sbjct: 27939 PPSQSS-GIIMTRDENV---PPIVEF----GPEYFDGLIIK---SGESLRIKALVQGRPV 27987

Query: 1076  PKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLE 1135
             P++TW K+ V I       +    G  +L +R  +    G Y  +A N  G+ + E K++
Sbjct: 27988 PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVK 28047

Query: 1136  VK 1137
             V+
Sbjct: 28048 VQ 28049



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 203/971 (20%), Positives = 332/971 (34%), Gaps = 208/971 (21%)

Query: 259   DPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMT 317
             D  Y   +    R  + +   P   V W K    +   T+   E       L + +CQ +
Sbjct: 19989 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 20048

Query: 318   DDSEYYVT----AGDEKCSTELFVREPPIMVTKQL--EDTTAYC------------GERV 359
             D  +Y +T    AG ++ +  + V   P + T  +  ++ TA              G  +
Sbjct: 20049 DAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEI 20108

Query: 360   ELECEVSEDDANVKWFKNGEEIIPGPKSRYRI-----------RVEGKKHILIIEGATKA 408
                     D  N KW      +    K+ +R+           RV  +    + EG    
Sbjct: 20109 TNYILEKRDSVNNKWVTCASAV---QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSE 20165

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC-LKCEISENIPGKWTK- 466
                                VD++   +    TD     G  I     E  E     W + 
Sbjct: 20166 PIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA 20225

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL 526
             N  P++  D  KV              LTE   +Y F   A N+    K  +   P + L
Sbjct: 20226 NKTPIRMRD-FKVT------------GLTEGL-EYEFRVMAINLAGVGKPSLPSEPVVAL 20271

Query: 527   DGLDAD----------NTVTVI-------AGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             D +D            N+VT+I        G+KL   I    + P K+ W + +      
Sbjct: 20272 DPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS-WMKANHV---- 20326

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYH--INLKNEAGEAHA-SIKVKVVDFPDPPVAP 626
                    + P+ +  V D+ E    G Y   I  KN AG   A S   + +   D   AP
Sbjct: 20327 -------NVPECAFTVTDLVE---GGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 20376

Query: 627   TVTEVGDDWCIMNWEPPAYDG-----GSPIL--GYFIERKKKQSSRWMRLNFDL----CK 675
             T+            +P   DG     G  I+     I  K    S W +   D+      
Sbjct: 20377 TIV----------LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDIT 20426

Query: 676   ETTFEPKKMIEGVAYEVR-------IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             + T  P   +  + Y  R       I A N  G     +       L V  PP  + + +
Sbjct: 20427 QITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPVEISN 20483

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
             V+    T+ W PP   G + +  Y+LE   +  TS                  W V ++D
Sbjct: 20484 VSAEKATLTWTPPLEDGGSPIKSYILE---KRETSRLL---------------WTVVSED 20525

Query: 789   LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT 848
              I   +   T L    +   RV AVN  G  EP   S+P+ + +   PP           
Sbjct: 20526 -IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEP-VQSEPVKMVDRFGPP----------- 20572

Query: 849   YIRRVGEAVNLVIPFQGKPRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERS 904
                  G      +    K    ++WK+     G+EI    +  R  E  ++ ++R  +  
Sbjct: 20573 -----GPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERR--EKKSLRWVRAIKTP 20625

Query: 905   HSGKYDLQVKVDKFVETASIDIQIIDR-----------------------PGPPQIVKIE 941
              S   DL+ KV    E ++ + ++                          PGPP    + 
Sbjct: 20626 VS---DLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVT 20682

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN-- 999
             D   ++ +L W  P  DG   ITGY ++        W   I+    T+  IT+ V+ +  
Sbjct: 20683 DTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAW---IKDTTGTALRITQFVVPDLQ 20739

Query: 1000  ---EYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
                +Y FR+ + N  G+ E A +         D +I +  +  DF+          L  T
Sbjct: 20740 TKEKYNFRISAINDAGVGEPAVIP--------DVEIVEREMAPDFELDAE------LRRT 20785

Query: 1057  YAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1115
               + AG +  +   ++G P P++TW K+ + + +  R  + + +    L I + + YD G
Sbjct: 20786 LVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTG 20843

Query: 1116  TYCCKAVNDLG 1126
              +     N  G
Sbjct: 20844 KFVMTIENPAG 20854



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 128/595 (21%), Positives = 233/595 (39%), Gaps = 66/595 (11%)

Query: 59   LFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFER 118
            +F +KP       G D+    ++          + W K +         K ++  + F+ 
Sbjct: 6459 VFTQKPSPVGALKGSDVILQCEISGTPPFE---VVWVKDR---------KQVRNSKKFKI 6506

Query: 119  HSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLE-------VHESTGTTPNIDI 171
             S+ +   + I+  + +  G Y C+ T +   D+CS  ++       V + + T+  I  
Sbjct: 6507 TSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGD 6566

Query: 172  RSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIA-FQYG 230
                +   EG +    +    L  R EV ++ E           N + S  + IA  Q G
Sbjct: 6567 AVELRAIVEGFQ---PISVVWLKDRGEVIRESE-----------NTRISFIDNIATLQLG 6612

Query: 231  ITDLRGMLKRLKRMRREE--KKSAAFAKILDPAYQVDKGGRVRFV---------VELADP 279
              +     K + +++ +   ++ +A   +L+PA  ++K   +            V    P
Sbjct: 6613 SPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTP 6672

Query: 280  KLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTEL 335
            +L  KW+K+G+E+   +K+          L I   +M+D   Y      + G   C+  +
Sbjct: 6673 ELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSV 6732

Query: 336  FVRE---PPIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK--SRY 389
             V +   PP  + K L+D  A  G  V LEC VS     +V WF++G EI+ GPK  S +
Sbjct: 6733 HVSDRIVPPSFIRK-LKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSF 6791

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
               V      L+    T       + +    + SA L+V   P    TP + + +  G  
Sbjct: 6792 SENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLP-GMS 6850

Query: 450  ICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAP 505
            +     I    P   KW K    +   +   +  +  + +L +      + GDY  +   
Sbjct: 6851 LTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTN 6910

Query: 506  DAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKA 565
            DA + +    + V +P   +    D     +V  G+ + LE   +G PP    W + D+ 
Sbjct: 6911 DAGSASCTTHLFVKEPATFVKRLAD----FSVETGSPIVLEATYTGTPPISVSWIK-DEY 6965

Query: 566  IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFP 620
            ++  S R        S+ L I  +  +D   Y   ++NEAG+      V V++ P
Sbjct: 6966 LISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPP 7020



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 105/480 (21%), Positives = 179/480 (37%), Gaps = 70/480 (14%)

Query: 672   DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTD 731
             D C+E        +   A E  I  +N I + KP  P+ P            + +D VT 
Sbjct: 22209 DACREDVGHYVVKLTNSAGEA-IETLNVIVLDKPGPPTGP------------VKMDEVTA 22255

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLID 791
              ++T+ W PP + G + ++ Y++E                    D     W + +   + 
Sbjct: 22256 DSITLSWGPPKYDGGSSINNYIVE------------------KRDTSTTTWQIVSAT-VA 22296

Query: 792   KTKFTITGLPTDAKIFVRVKAVNAAGAS-----EPKYYSQPILVKEIIEPPKIRIPRH-- 844
             +T      L T  +   R+ A N  G S     EP     P  V      P + +     
Sbjct: 22297 RTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDS 22356

Query: 845   LKQTYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAE 902
             ++  +   + +  + VI +  + K R  + W K    ++K  I     +T  +    + E
Sbjct: 22357 MEVQWNEPISDGGSRVIGYHLERKERNSILWVK----LNKTPIPQTKFKTTGLEEGVEYE 22412

Query: 903   RSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAA 962
                S +  + +     V    +     D PG P+ + +      +V L W  P  DG + 
Sbjct: 22413 FRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTR---NSVTLQWKKPTYDGGSK 22469

Query: 963   ITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGL-SEDATMT 1020
             ITGY ++K +     W      +   T   +T LV  + Y FRV + N  G+ SE +  T
Sbjct: 22470 ITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSEST 22529

Query: 1021  KESAVIARDG----KIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1076
                A+ ARD     +I  +P Y+D                   AG +  ++  + G P P
Sbjct: 22530 --GAITARDEVDPPRISMDPKYKD--------------TIVVHAGESFKVDADIYGKPIP 22573

Query: 1077  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              I W+K    + +  R  + S     +L ++     D G Y  KA N  G   +   ++V
Sbjct: 22574 TIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 100/435 (22%), Positives = 171/435 (39%), Gaps = 65/435 (14%)

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
             PP  + +D V+  ++T+ W PP++ G   +  Y++E     ST+                
Sbjct: 25490 PPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT---------------- 25533

Query: 780   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP-- 837
               W + ++  + +T   I  L T ++   RV A N  G S     S  ++ +    PP  
Sbjct: 25534 --WHIVSQ-AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGP 25589

Query: 838   --KIRIPRHLKQTYIRR----VGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRN 889
                 ++    K T +      V +  + VI +  + K R  + W K       N+I I  
Sbjct: 25590 PGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSK------ANKILI-- 25641

Query: 890   SETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII------DRPGPPQIVKIEDV 943
                DT + +   +     +Y +  +    +   S   + +      D PG P++  I   
Sbjct: 25642 --ADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITR- 25698

Query: 944   WGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYY 1002
               ++V+L W+ P  DG A ITGY +++ +     W      +   T   +TEL     Y 
Sbjct: 25699 --KSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYE 25756

Query: 1003  FRVFSENMC-GLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1061
             FRVF+ N    +SE +  T    +I +D  +    V  D  F +  +           AG
Sbjct: 25757 FRVFARNAADSVSEPSEST--GPIIVKDD-VEPPRVMMDVKFRDVIVVK---------AG 25804

Query: 1062  YNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1121
                 +N  + G P P I+W K+ + I +  R  + S      L ++     D G Y    
Sbjct: 25805 EVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTL 25864

Query: 1122  VNDLGT--VEIECKL 1134
              N  GT  V + CK+
Sbjct: 25865 KNVAGTRSVAVNCKV 25879



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 100/460 (21%), Positives = 169/460 (36%), Gaps = 78/460 (16%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  + +  P  P  PF             +  +     ++ W  P   G + +  Y++E 
Sbjct: 18984 IKVVVMDAPGPPQPPF------------DISDIDADACSLSWHIPLEDGGSNITNYIVEK 19031

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
             C                  D+   DW+ A    + KT   +  L    +   RV+A N  
Sbjct: 19032 C------------------DVSRGDWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRF 19072

Query: 817   GASEPKYYSQPILVKEI-----IEPPKIRIPRHLKQ----TYIRRVGEAVNLVIPF--QG 865
             G SEP   + P +V +       EP   R+ +  K      + R   +  + +I +  + 
Sbjct: 19073 GISEP--LTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIER 19130

Query: 866   KPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERS------HSGKYDLQVKVDKFV 919
             K R  L W K       N   +R++E      +   E S      +        K  ++V
Sbjct: 19131 KERNSLLWVK------ANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV 19184

Query: 920   ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
              TA + +   D PG P+++   DV    V+L W  PK DG + I GY ++       +W 
Sbjct: 19185 -TARMPV---DPPGKPEVI---DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWV 19237

Query: 980   ---TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
                T      +   T T L    +Y FR  +     +S  +  +    ++A +      P
Sbjct: 19238 RCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV-----P 19292

Query: 1037  VYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMF 1096
                D   +   + T         AG N  L+ +V G P P ++W K+   +      +M 
Sbjct: 19293 PRIDLSVAMKSLLTVK-------AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMA 19345

Query: 1097  SNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               + +CTLE+   +  D G Y   A N  G+     KL+V
Sbjct: 19346 MQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 19385



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 21/194 (10%)

Query: 547   IPISGEPPPKAMWSRGDKAIMEGSGRIRTE-------SYPDSSTLVIDIAERDDSGVYHI 599
             + +  EPP         + ++E   R+ T        + PD +  V D+ E  +   + +
Sbjct: 14200 VDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQ-FQV 14258

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPT------VTEVGDDWCIMNWEPPAYDGGSPILG 653
               +NEAG  H S   +++   DP   P+      VT+ G     + W+PP  +GGSPI+G
Sbjct: 14259 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 14318

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVA----YEVRIFAVNAIGISKPSMPS 709
             Y +E     + +WMR+N    K+  F   K+ EGV     Y +R+ AVNAIG+S+PS  S
Sbjct: 14319 YHVEMCPVGTEKWMRVNSRPIKDLKF---KVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 14375

Query: 710   RPFVPLAVTSPPTL 723
                V       PT+
Sbjct: 14376 ENVVAKDPDCKPTI 14389



 Score = 82.4 bits (202), Expect = 2e-15
 Identities = 137/626 (21%), Positives = 234/626 (37%), Gaps = 79/626 (12%)

Query: 27   EAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTV-KVGEDITFIAKVKAED 85
            + GT  +K    V+ PP                FI+KP    V + G+  TF  ++    
Sbjct: 4845 DVGTATSKATLFVKEPPQ---------------FIKKPSPVLVLRNGQSTTFECQITGTP 4889

Query: 86   LLRKPTIKWF-KGKWMDLASKAG-KHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCE 143
             +R   + W+  G  +    K G   +    TF           QI  A+   +G Y CE
Sbjct: 4890 KIR---VSWYLDGNEITAIQKHGISFIDGLATF-----------QISGARVENSGTYVCE 4935

Query: 144  VTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQE----DAGELDFSGLLKRREV 199
                    SCS +L+V E       +      K S    E         + + L   RE+
Sbjct: 4936 ARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREI 4995

Query: 200  KQQEE---EPQVDVWEL-LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFA 255
            +  ++     +V V+ L +    PS+  +  +Q  +++  G      R+  +E  S  F 
Sbjct: 4996 RSSKKYTLTDRVSVFNLHITKCDPSDTGE--YQCIVSNEGGSCSCSTRVALKEPPS--FI 5051

Query: 256  KILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQ 315
            K ++    V K            P + + W K+ Q +                L I +  
Sbjct: 5052 KKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVD 5111

Query: 316  MTDDSEYYVTA----GDEKCSTELFVREPPIMVTK-QLEDTTAYCGERVELECEVS-EDD 369
                  Y   A    G E+C   L V+EP  +V K +  D T    + + LEC V+   +
Sbjct: 5112 NGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVTE--KDPMTLECVVAGTPE 5169

Query: 370  ANVKWFKNGEEIIPGPKSRY-RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
              VKW K+G++I+P   SRY  +  E       I+   K D+ +Y+        S+    
Sbjct: 5170 LKVKWLKDGKQIVP---SRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDA 5226

Query: 429  DLK------PLKILTPLTDQTVNLGKEICLKCEISENIP--GKWTKNGLPVQESDRLKVV 480
             L+      P      LT     LG  I ++C++S ++P   +W K+G  +  S + ++V
Sbjct: 5227 YLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLV 5286

Query: 481  HKGRIHKLVIANALTEDEGDY------VFAPDAYNVTLPAKVHVIDPPKIILDGLDADNT 534
               R   L + N   ED  +Y      V   DA +  L  K    +PP  ++        
Sbjct: 5287 CHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVK----EPPSFLV----KPGR 5338

Query: 535  VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDS 594
               I  + +  +  + G PP K  W + D  ++ G  +        +S L +   +   +
Sbjct: 5339 QQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGP-KCFIGLEGSTSFLNLYSVDASKT 5397

Query: 595  GVYHINLKNEAGEAHASIKVKVVDFP 620
            G Y  ++ N+ G    +  + V + P
Sbjct: 5398 GQYTCHVTNDVGSDSCTTMLLVTEPP 5423



 Score = 80.9 bits (198), Expect = 6e-15
 Identities = 77/261 (29%), Positives = 107/261 (40%), Gaps = 22/261 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+G  V+ SDRL + +      L +  ++  D G Y    +    + T    V VI  
Sbjct: 14420 WHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGL 14479

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIP--ISGEPPPKAMWSRGDKA------IMEGSGRI 573
             P    D   +D T    +  KL  E P    G P    +  R +        +M G  ++
Sbjct: 14480 PGPCKDIKASDITK---SSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKL 14536

Query: 574   R---TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                  +  P+        A     G  +I LKN        I       PDPPV   V  
Sbjct: 14537 SWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPV------IAQDPKQPPDPPVDVEVHN 14590

Query: 631   VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAY 690
                +   + W+PP YDGGS I+GY IE+  K   RW R N  L    T+  K + EG  Y
Sbjct: 14591 PTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEY 14650

Query: 691   EVRIFAVNAIGISKPSMPSRP 711
             + R+ A NA GIS+PS  + P
Sbjct: 14651 QFRVRAENAAGISEPSRATPP 14671



 Score = 77.8 bits (190), Expect = 5e-14
 Identities = 104/452 (23%), Positives = 164/452 (36%), Gaps = 62/452 (13%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             ++ I + KP  P  P            +  D V+   V + W PP + G   +  Y++E 
Sbjct: 24397 LSVIVLEKPGPPVGP------------VRFDEVSADFVVISWEPPAYTGGCQISNYIVE- 24443

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                                D     W + +   + +T   IT L T  +   R+ A N  
Sbjct: 24444 -----------------KRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRY 24485

Query: 817   GASEPKYYSQPILV----KEIIEPPKIRIPRHLKQTYIRRVGEAVN------LVIPFQGK 866
             G S P   S+ ++V    KE   P    +    K   + +  E VN      +    + K
Sbjct: 24486 GKSAP-LDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQK 24544

Query: 867   PRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDI 926
              +  + W K    ++K  I     +T  +    + E   S +  + +     V    +  
Sbjct: 24545 EKNSILWVK----LNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 24600

Query: 927   QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHY 985
                D PG P+ + I      NV L W  P  DG + ITGY ++K D     W      + 
Sbjct: 24601 DPCDPPGRPEAIVITR---NNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 24657

Query: 986   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1045
               T  T++ LV    Y FRV + N  G   + +     A+ ARD     N   +      
Sbjct: 24658 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPS-DSSGAITARDEIDAPNASLD------ 24710

Query: 1046  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-PRYRMFSNQGVCTL 1104
              P +   +V     AG    L   +RG P P + W K+   + +   R  + S     TL
Sbjct: 24711 -PKYKDVIV---VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTL 24766

Query: 1105  EIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              ++     DGG Y  K  N  GT  I   ++V
Sbjct: 24767 VVKDCIRTDGGQYILKLSNVGGTKSIPITVKV 24798



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 118/571 (20%), Positives = 224/571 (39%), Gaps = 53/571 (9%)

Query: 92   IKWFKGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFD 151
            + W+K K         + L+  + ++  S+ +   + I+    +  G Y C+   +   D
Sbjct: 5548 VVWYKDK---------RQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSD 5598

Query: 152  SCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVW 211
            +C   +++ E       ++  S    +GE  E    ++ +  +  + +K++EE     V 
Sbjct: 5599 TCVCTVKLKEPPRFVSKLN--SLTVVAGEPAELQASIEGAQPIFVQWLKEKEE-----VI 5651

Query: 212  ELLKNAKPSEYEKIA-FQYGITDLRGMLKRLKRMRRE--EKKSAAFAKILDPAYQVDKGG 268
               +N + +  E +A  Q+   +     K + +++ +   +++ A   +L+PA  V+K G
Sbjct: 5652 RESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAG 5711

Query: 269  RVRFVV---------ELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDD 319
             +   V             P+L V+WYK+G+ +  S K+ F        L I + +  D 
Sbjct: 5712 PMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDA 5771

Query: 320  SEYYV----TAGDEKCSTELFV--REPPIMVTKQLEDTTAYCGERVELECEVS-EDDANV 372
              Y        G   C+  + V  R  P   T++L++T    G    LEC+V+     +V
Sbjct: 5772 GTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISV 5831

Query: 373  KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS----AKLSV 428
             WF    +I+ G K  Y+         L +     +D   Y+ +      S    A L+V
Sbjct: 5832 AWFHEKTKIVSGAK--YQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 5889

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
               P  +  P     V  GK +     I    P K  W +    + + DR  +  +  + 
Sbjct: 5890 QEPPSFVKEP-EPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVA 5948

Query: 487  KLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLR 544
            +L + N      G+Y  V + +A   +   ++ V +P   +    D     +V  G  + 
Sbjct: 5949 ELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDH----SVEPGKSII 6004

Query: 545  LEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNE 604
            LE   +G  P    W + D   +  S +    +   +  L I  + + D+G Y   ++NE
Sbjct: 6005 LESTYTGTLPISVTWKK-DGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENE 6063

Query: 605  AGEAHASIKVKVVDFP--DPPVAPTVTEVGD 633
            AG       V  ++ P     + P    VGD
Sbjct: 6064 AGRDVCGALVSTLEPPYFVTELEPLEAAVGD 6094



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 50/197 (25%), Positives = 94/197 (47%), Gaps = 14/197 (7%)

Query: 251  SAAFAKILDPAYQ-------VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
            ++A   +++PA++       + +G       + + P ++ +W++NG+ ++P  ++  E +
Sbjct: 8736 ASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVE 8795

Query: 304  GCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
                 L I + +  D  +Y     D + S EL +   PI  TK++++      +    EC
Sbjct: 8796 HKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFEC 8855

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT----- 418
            EVS DDA V W+K   E+    K  Y  R +G+ H + I   T  D   YSV+       
Sbjct: 8856 EVSFDDAIVTWYKGPTELTESQK--YNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRG 8913

Query: 419  GGQSSAKLSVDLKPLKI 435
              +S+A+L +  K +K+
Sbjct: 8914 EARSTAELYLTTKEIKL 8930



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 102/462 (22%), Positives = 169/462 (36%), Gaps = 81/462 (17%)

Query: 696   AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             ++  + + KP  P  P            +  D V+  ++T+ W PP + G   +  Y+++
Sbjct: 23314 SIEIVTLDKPDPPKGP------------VKFDDVSAESITLSWNPPLYTGGCQITNYIVQ 23361

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
                                 D     W V +   + +T   +T L T  +   R+ A N 
Sbjct: 23362 ------------------KRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFAENR 23402

Query: 816   AGASEPKYYSQPILVKEIIE---PPKIRIPRHL-KQTYIRRVGEAVN------LVIPFQG 865
              G S     S PI+ +   +   PP       + K + + +  E VN      +    + 
Sbjct: 23403 YGQSFA-LESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLER 23461

Query: 866   KPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG-KYDLQVKVDKFVETAS- 923
             K R  + W K    ++K  I+      DT     KA+    G +Y+ +V  +  V     
Sbjct: 23462 KERNSILWTK----VNKTIIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVGKA 23508

Query: 924   -------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                    +     D PG P+ + ++      + L WT P  DG + ITGY ++K D    
Sbjct: 23509 SKNSECYVARDPCDPPGTPEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLPDG 23565

Query: 977   EWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCG-LSEDATMTKESAVIARDGKIYK 1034
              W      +   T  T++ L     Y FRV ++N  G +S+ +  T         G I  
Sbjct: 23566 RWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDST---------GPITA 23616

Query: 1035  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
                 E    S  P F   +V     AG    L   V G P P I W++    I +  R  
Sbjct: 23617 KDEVELPRISMDPKFRDTIVVN---AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCE 23673

Query: 1095  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             + +      L ++     DGG Y  +A N  G+      ++V
Sbjct: 23674 IKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKV 23715



 Score = 77.0 bits (188), Expect = 9e-14
 Identities = 106/469 (22%), Positives = 169/469 (36%), Gaps = 97/469 (20%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  I + KP  P+ P            + +D +  T++T+ W PP+  G A L GYV+E 
Sbjct: 29824 IKVIILDKPGPPTGP------------IKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 29871

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                                D     W+  ++  + ++ F  T L    +   RV A N  
Sbjct: 29872 ------------------RDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRF 29912

Query: 817   GASEPKYYSQPILVKEIIE-PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW-- 873
             G           L  E+IE    IRIP           G    L I    +    LTW  
Sbjct: 29913 GIGS-------YLQSEVIECRSSIRIP-----------GPPETLQIFDVSRDGMTLTWYP 29954

Query: 874   -KKDGAE------IDKNQINIR-----NSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
              + DG        +++ ++        N    T+   R    +   +Y+ +V       +
Sbjct: 29955 PEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGS 30014

Query: 922   AS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                       + +  I  PG PQ  ++ D    +V+L W+ P+D+G + +TGY I+    
Sbjct: 30015 GKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKV 30074

Query: 974   KSMEWF------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIA 1027
                EW       T I  Y     T+T L  G EY FRV + N  G  E A        + 
Sbjct: 30075 DQHEWTKCNTTPTKIREY-----TLTHLPQGAEYRFRVLACNAGGPGEPAE-------VP 30122

Query: 1028  RDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAI 1087
                K+ +   Y D++  E     +     +   G    L   ++G P P   W K    I
Sbjct: 30123 GTVKVTEMLEYPDYELDE-----RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI 30177

Query: 1088  VDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                 R  + +++    L I++    D GTY     N  G   +  K+ V
Sbjct: 30178 --SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRV 30224



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 64/235 (27%), Positives = 91/235 (38%), Gaps = 46/235 (19%)

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT-SA 990
             P PP  V++ +   E + +TW PP  DG + I GY I+K  K    W    EH     + 
Sbjct: 14580 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 14639

Query: 991   TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1050
             T   L  G EY FRV +EN  G+SE +  T  +  +            +  D  +  + T
Sbjct: 14640 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAV------------DPIDAPKVILRT 14687

Query: 1051  QPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-------PRYRM-------- 1095
                V      G    L+ S+ G+P P ITW+K++  IV +       P  R         
Sbjct: 14688 SLEVKR----GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEE 14743

Query: 1096  --------------FSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                            S +G   L +R     D G Y  K  ND G  +  C + V
Sbjct: 14744 EPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 59/203 (29%), Positives = 83/203 (40%), Gaps = 14/203 (6%)

Query: 926   IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY 985
             ++  + P PP  + I D+    V+L W  PK DG + ITGY I+   K S +W T I   
Sbjct: 20959 VKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTV 21017

Query: 986   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1045
                   +  L  G EY F+V + N  G S      +ES  +     + +  +  + D   
Sbjct: 21018 KGLECVVRNLTEGEEYTFQVMAVNSAGRSAP----RESRPVI----VKEQTMLPELDLRG 21069

Query: 1046  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1105
                  Q LV   A AG N  +   V G PKP +TW K    +    R    +      L 
Sbjct: 21070 ---IYQKLV--IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILN 21124

Query: 1106  IRKPSPYDGGTYCCKAVNDLGTV 1128
             I +    D G Y   A N +G V
Sbjct: 21125 INECVRSDSGPYPLTARNIVGEV 21147



 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 13/197 (6%)

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             ++P PP+ + + D    +  L W  P  DG + ITGY ++   K S  W     H  + +
Sbjct: 28544 EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLT 28602

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1049
              T+  LV   EY FRV ++N  G SE       S+VI ++ +I           ++    
Sbjct: 28603 FTVERLVEKTEYEFRVKAKNDAGYSEPREAF--SSVIIKEPQIEPT--------ADLTGI 28652

Query: 1050  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1109
             T  L+   A  G   T++  + G P PK+TW   ++ + +  R  + + +   TL ++  
Sbjct: 28653 TNQLITCKA--GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 28710

Query: 1110  SPYDGGTYCCKAVNDLG 1126
                D G Y     N  G
Sbjct: 28711 MRGDSGRYFLTLENTAG 28727



 Score = 72.4 bits (176), Expect = 2e-12
 Identities = 56/222 (25%), Positives = 101/222 (45%), Gaps = 17/222 (7%)

Query: 918   FVETASIDI--QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKS 975
             FVET+   +  + I  P  P+ +++++V    V LTW PPK DG + I  Y ++     +
Sbjct: 16701 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGT 16760

Query: 976   MEWFTVI-EHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
              ++  V  ++      T+  L  G+ Y +RV + N+ G  + +  TK    I    ++  
Sbjct: 16761 EKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKP---ITCKDELAP 16817

Query: 1035  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
               ++ DF        T  +   +A+ G  +       G PKPK++W K++  +++D R  
Sbjct: 16818 PTLHLDF----RDKLTIRVGEAFALTGRYS-------GKPKPKVSWFKDEADVLEDDRTH 16866

Query: 1095  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             + +      LE  K    D G YC    N  G+ +  C++ V
Sbjct: 16867 IKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 16908



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 134/663 (20%), Positives = 230/663 (34%), Gaps = 120/663 (18%)

Query: 2     PEPTKKEENEVPAP----APPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLS 57
             PEP  K    V +P    +P P  P       T P        TP  + Q    +     
Sbjct: 32669 PEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP--------TPTEKVQHLPVSAPPKI 32720

Query: 58    ILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFE 117
               F++       +  ++I  +  V    +LR   + W+K          GK L+    F+
Sbjct: 32721 TQFLK------AEASKEIAKLTCVVESSVLRAKEVTWYKD---------GKKLKENGHFQ 32765

Query: 118   RH-SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFK 176
              H S   T+E++I    ++  G Y CE+                                
Sbjct: 32766 FHYSADGTYELKINNLTESDQGEYVCEI-------------------------------- 32793

Query: 177   RSGEGQEDAGELDFSG---------LLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF 227
              SGEG      L F G         + K  E K+ +++       + +  +P   E I+ 
Sbjct: 32794 -SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTEST--VTRKTEPKAPEPIS- 32849

Query: 228   QYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYK 287
                                   K      + D     D   +   V    +P+    W K
Sbjct: 32850 ---------------------SKPVIVTGLQDTTVSSDSVAKFA-VKATGEPRPTAIWTK 32887

Query: 288   NGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT----AGDEKCSTELFVREPPIM 343
             +G+ I    KY          L I+    +D   Y  T    AG    S +L ++   I 
Sbjct: 32888 DGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--IK 32945

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
              T+  + +T    E    +  V +++ + K  ++ E  +   KS+ ++ ++ +   ++I 
Sbjct: 32946 DTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLIS 33005

Query: 404   GATKADAA---EYSVMTTGGQSSAKLSVDLKP-LKILTPLTDQTVNLGKEICLKCEISEN 459
                K  AA   E S++      +++ S +++   +I    T  ++N G+ + LK  I+  
Sbjct: 33006 EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA 33065

Query: 460   IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--------FAPDAYNVT 511
                KW  NG+ +  S+  +    G    L I  A   DEG                Y++T
Sbjct: 33066 TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLT 33125

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             L  ++   D P  I        +  +  G  +     ISGEP P+  W + +  I   S 
Sbjct: 33126 LSKELS--DAPAFI----SQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISS 33178

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
              +      +  +L I  A   DSG Y I  KN  G+  A+  + V+   + P    V   
Sbjct: 33179 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRT 33238

Query: 632   GDD 634
               D
Sbjct: 33239 SGD 33241



 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 107/465 (23%), Positives = 175/465 (37%), Gaps = 76/465 (16%)

Query: 696   AVNAIGISKPSMPSR-PFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVL 754
             A NA G +K  +  +    P  V  P   +   ++T   +T+ W  P + G A +  Y++
Sbjct: 28033 AKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWWDAPLNDGCAPITHYII 28089

Query: 755   EYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN 814
             E             E    A+ L         +D  +   +T   L    +   RV AVN
Sbjct: 28090 E-----------KRETSRLAWALI--------EDKCEAQSYTAIKLINGNEYQFRVSAVN 28130

Query: 815   AAGASEPKYYSQPILVK---EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 871
               G   P   S P++ +    + + P I  P ++        G ++ L        RPE 
Sbjct: 28131 KFGVGRP-LDSDPVVAQIQYTVPDAPGIPEPSNI-------TGNSITLTWA-----RPE- 28176

Query: 872   TWKKDGAEIDKNQINIRNSE-TDTIIFIRKAERSHS----------GKYDLQVKVDKF-- 918
                  G+EI +  +  R  + T  +  I K   S +           +Y+  V  +    
Sbjct: 28177 --SDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 28234

Query: 919   VETASIDIQII------DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 972
             V  AS   ++I      + PGPP +VK+ D     V+L W+ P  DG   I GY I+   
Sbjct: 28235 VGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCK 28294

Query: 973   KKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1031
                 +W  V  E   +T  T+T+L  G EY FRV + N  G  +   +T     I    +
Sbjct: 28295 ADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVT---GTIKAVDR 28351

Query: 1032  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1091
             +    +  D +F +  +           AG +  L  + +G P P   W K    +    
Sbjct: 28352 LTAPELDIDANFKQTHVVR---------AGASIRLFIAYQGRPTPTAVWSKPDSNL--SL 28400

Query: 1092  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             R  + +     TL +   +  D G Y     N+ G+  I   ++V
Sbjct: 28401 RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKV 28445



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 19/303 (6%)

Query: 341   PIMVTKQLEDT----TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
             P+   K+++D     + + G     EC VS   A   W K+G  I   PK  +R   +GK
Sbjct: 11114 PLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPK--HRFIADGK 11171

Query: 397   KHILIIEGATKADAAEYSVMTTGGQ----SSAKLSVDLKPLKILTPLTDQ-TVNLGKEIC 451
                L I     +DA EY+ +   G     S+AKL V+  P++ +  L ++ TV  G+ + 
Sbjct: 11172 DRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 11231

Query: 452   LKCEISENIPGKWTKNG-LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYN 509
             L CE+++     W K+G + V++  R+     G +  L I +A   D G Y V   +A N
Sbjct: 11232 LSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANN 11291

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             +   + V V++   +I D L        +      +      +  P   W +G   I   
Sbjct: 11292 LECSSCVKVVE---VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI-PA 11347

Query: 570   SGRIRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
                 +TE   D + L + I  A  +D   Y + ++ +   A  ++  + V+   P    T
Sbjct: 11348 EPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVT 11407

Query: 628   VTE 630
             + E
Sbjct: 11408 IYE 11410



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 31/92 (33%), Positives = 43/92 (46%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
            P     L N   I G + TL C + G P P +TW +    I     +++    G+  L I
Sbjct: 943  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 1002

Query: 1107 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
            R+    D G + C AVN+ GTV   C L V+V
Sbjct: 1003 REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 1034



 Score = 62.4 bits (150), Expect = 2e-09
 Identities = 63/287 (21%), Positives = 107/287 (37%), Gaps = 18/287 (6%)

Query: 853  VGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDL 911
            VGE+ +      G    +++W KD  EI    +  I   E    + + K ++  SG+Y  
Sbjct: 8166 VGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTC 8225

Query: 912  QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 971
                +   ++ +  + I +R  PP   K          L+ T  + +GN+      +  +
Sbjct: 8226 YAVNEVGKDSCTAQLNIKERLIPPSFTK---------RLSETVEETEGNSFKLEGRVAGS 8276

Query: 972  DKKSMEWF-TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDG 1030
               ++ W+   IE    ++  IT          R    N  GL          + +    
Sbjct: 8277 QPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSS 8336

Query: 1031 KIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD 1090
             + K P        + P+F Q L       G    L+C V+G+   +I W+K    I   
Sbjct: 8337 IVIKEP-------KKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPS 8389

Query: 1091 PRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             R       G   LE+R  +  D G Y CKA N  G+   + K+ +K
Sbjct: 8390 DRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIK 8436



 Score = 61.2 bits (147), Expect = 5e-09
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 931   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH-YHRTS 989
             RP PP++ K+     E + + W PP+ DG  +ITGY ++K +K S  W  V +       
Sbjct: 18398 RPDPPEVTKVSK---EEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERR 18454

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
               +  L+  +EY FRV +EN  G+ E +  ++   V+A+D
Sbjct: 18455 MKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR--PVVAKD 18492



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/324 (22%), Positives = 129/324 (39%), Gaps = 19/324 (5%)

Query: 829  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID----- 881
            L +E   P +   P  + +  ++++ E  ++V   Q  G P+P + WKK G  +      
Sbjct: 1069 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1128

Query: 882  KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
            K   N +  E   +I +  A+   +G+Y + V+ +K  ET S    +++      ++K +
Sbjct: 1129 KVSYNKQTGECKLVISMTFAD--DAGEYTIVVR-NKHGET-SASASLLEEADYELLMKSQ 1184

Query: 942  DVWGENVALTWTPPKDDGNAAITGYTIQKADKK-SMEWFTVIEHYHRTSATITELVIGNE 1000
                    +T    +        G+   + +K+   E   + +   + +  +   V   E
Sbjct: 1185 QEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQE 1244

Query: 1001 YYFRVFSENMCGLSEDATM-TKESAVIARDGKIYKNPVYEDFDFSEAPM--FTQPLVNTY 1057
            ++   F E +    E   + T    ++  DG+     +  D   SEA    F   + N  
Sbjct: 1245 FHISSFEERLIKEIEYRIIKTTLEELLEEDGE---EKMAVDISESEAVESGFDSRIKNYR 1301

Query: 1058 AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRM-FSNQGVCTLEIRKPSPYDGGT 1116
             + G   T +C + G P PKI W K+   I    RY+M F   G  +L I    P D G 
Sbjct: 1302 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1361

Query: 1117 YCCKAVNDLGTVEIECKLEVKVIA 1140
            Y   A N  G      KL V+  A
Sbjct: 1362 YTAFASNIKGNAICSGKLYVEPAA 1385



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 96/426 (22%), Positives = 148/426 (34%), Gaps = 58/426 (13%)

Query: 717   VTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAY 775
             +  PPT  +  D V+   VT  W PP++ G   +  YV+E     ST+            
Sbjct: 21158 IPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTT------------ 21205

Query: 776   DLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 835
                   W+     +I +T +  T L T  +   RVKA N  G   P   S  I+      
Sbjct: 21206 ------WVELATTVI-RTTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANY--- 21254

Query: 836   PPKIRIPRHLKQ-TYIRRVGEAVNLVIPF------------QGKPRPELTWKKDGAEIDK 882
             P K+  P    Q T + +    ++   P             + K R  + W+     +  
Sbjct: 21255 PFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVP 21314

Query: 883   NQINIRNSETDTIIF-IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
               I   +  TD I +  R    + +GK     K  K  E   + +  ID PG P  + I 
Sbjct: 21315 GNIFKSSGLTDGIAYEFRVIAENMAGKS----KPSKPSEPM-LALDPIDPPGKPVPLNIT 21369

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNE 1000
                   V L W  P+  G   IT Y ++K D  +  W      +      T++ L     
Sbjct: 21370 R---HTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAA 21426

Query: 1001  YYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIA 1060
             Y FRV ++N  G     +   ++     D +  K  V  D  F +  +           A
Sbjct: 21427 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKV--DVKFKDTVILK---------A 21475

Query: 1061  GYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1120
             G    L   V G P P + W K+   +    +  +        L  +  +  D G Y   
Sbjct: 21476 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 21535

Query: 1121  AVNDLG 1126
             A N  G
Sbjct: 21536 ATNPGG 21541



 Score = 57.4 bits (137), Expect = 8e-08
 Identities = 95/406 (23%), Positives = 148/406 (36%), Gaps = 54/406 (13%)

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             I AVN +G +   M       L    PP   +  +SV+   +T+ W PP   G + +  Y
Sbjct: 16196 ITAVNNLGTASKEMRLNV---LGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNY 16252

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             V+E                    +   + W+  + +  + T +TI  L    +   R+ A
Sbjct: 16253 VIE------------------KREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMA 16293

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP-FQGKPRPEL 871
              N  G  EP   S+P   + +   P    P     + + R    VN   P + G      
Sbjct: 16294 QNKYGIGEP-LDSEPETARNLFSVPGA--PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG 16350

Query: 872   TW--KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF----VETASID 925
              W   KD       ++N    +  T+    K      G  D Q +V       V  AS+ 
Sbjct: 16351 YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGS-DYQFRVYAINAAGVGPASLP 16409

Query: 926   IQI------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
                      I  PGPP   K+ D    +  L W+PP  DG + +TGY ++  ++   EW 
Sbjct: 16410 SDPATARDPIAPPGPP-FPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWE 16468

Query: 980   TVIEHYHR-TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1038
                +   R T   +T L  G  Y FRV + N+ G+ E   +T    VI    ++    + 
Sbjct: 16469 KGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD---VIEMKDRLVSPDLQ 16525

Query: 1039  EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNK 1084
              D    +              AG    +   V G P P +TW  N+
Sbjct: 16526 LDASVRD---------RIVVHAGGVIRIIAYVSGKPPPTVTWNMNE 16562



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 345 TKQLEDTTAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
           T+ L+      G     E  +S      V WF++G+ I        +I     +  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 404 GATKADAAEYSVMTTGGQSSAKLSVDL------KPLKILTPLTDQTVNLGKEICLKCEIS 457
             TKA++  YS+  T G   A  + +L       P   +  L   TV  G ++ L+  ++
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 458 ENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             IP    K+ ++G  +Q S   ++  +G ++ L+IA A  ED G Y
Sbjct: 129 -GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 39/140 (27%), Positives = 56/140 (40%), Gaps = 9/140 (6%)

Query: 1003  FRVFSENMCGLSEDATM---TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1059
             F+   E +  +SE       T ES V  +       P+      S  P+    L +T   
Sbjct: 32811 FKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI------SSKPVIVTGLQDTTVS 32864

Query: 1060  AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1119
             +   A       G P+P   W K+  AI    +Y++  ++G   LEI K    D G Y C
Sbjct: 32865 SDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTC 32924

Query: 1120  KAVNDLGTVEIECKLEVKVI 1139
                N  G+V   CKL +K I
Sbjct: 32925 TVKNSAGSVSSSCKLTIKAI 32944



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 74/348 (21%), Positives = 121/348 (34%), Gaps = 77/348 (22%)

Query: 865   GKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYD------------- 910
             G+PRP   W KDG  I +  +  +   +    + I K + S SG Y              
Sbjct: 32877 GEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSS 32936

Query: 911   --LQVKVDKFVETASIDIQIIDRPGPPQIVKIED------VWGENVALTWTPP------K 956
               L +K  K  E   +  Q      P +   +++      +  E + ++          K
Sbjct: 32937 CKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALK 32996

Query: 957   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS-------------ATITELVIGNEYYF 1003
             ++ +  +    ++K+   S+E   V E   +TS             A  T++ I NE   
Sbjct: 32997 EEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSI-NEGQR 33055

Query: 1004  RVFSENMCGLSE-----------------------DATMT------KESAVIARDGKIYK 1034
              V   N+ G ++                       D T+T      ++  ++    K  +
Sbjct: 33056 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 33115

Query: 1035  NPVYEDFDF------SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1088
               V   +D       S+AP F     +     G N    C + G P P+I W KN + I 
Sbjct: 33116 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 33175

Query: 1089  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                   +  ++ V +LEIR  S  D G Y  KA N  G       L V
Sbjct: 33176 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 33223



 Score = 54.7 bits (130), Expect = 5e-07
 Identities = 52/221 (23%), Positives = 77/221 (34%), Gaps = 45/221 (20%)

Query: 920  ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
            +TA  D++++ RP P      E  W             DG   +  YT +          
Sbjct: 1472 QTARFDLKVVGRPMP------ETFWFH-----------DGQQIVNDYTHK---------- 1504

Query: 980  TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1039
             VI+     S  I      +   + V ++N  G S  + +    AV              
Sbjct: 1505 VVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV-------------- 1550

Query: 1040 DFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFS 1097
              +    PMF + L N     G    +     GNP P I W+KN   IV    P+ R+  
Sbjct: 1551 --EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEG 1608

Query: 1098 NQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
             +G   L+I      D   Y   A+N  G     CK+ V+V
Sbjct: 1609 TKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649



 Score = 52.4 bits (124), Expect = 2e-06
 Identities = 26/95 (27%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 1044 SEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVC 1102
            +E P F + L  +  + AG ++ L C + G+P+ ++ W +N+  +    +YRM     V 
Sbjct: 5420 TEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVA 5479

Query: 1103 TLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             +++   S  D G + C+A N  G+     K+ VK
Sbjct: 5480 VIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVK 5514



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 56/305 (18%), Positives = 122/305 (40%), Gaps = 22/305 (7%)

Query: 842   PRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID-KNQINIRNSETDTIIFI 898
             P  + Q   + + E  N++   +  G+P PE+ W K+   I   + ++I  S     + I
Sbjct: 33134 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 33193

Query: 899   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDR-PGPPQIVKIEDVWGENVALTWTPPKD 957
             R A  S SGKY ++ K  +   +A+  + ++     P + V +      ++  +++    
Sbjct: 33194 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 33253

Query: 958   DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 1017
               +A+    +       S    T ++    ++ +++ +    E +  + S +  G+S   
Sbjct: 33254 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM---QESFVEMSSSSFMGISNMT 33310

Query: 1018  TMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKP 1076
              +   ++ + + G                P   + L +  +I  G   T+ C+  G P P
Sbjct: 33311 QLESSTSKMLKAG------------IRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTP 33358

Query: 1077  KITWM--KNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
             ++TW     K+   +  R+ + +   + TL I      DGG Y     N+ G+      +
Sbjct: 33359 EVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 33418

Query: 1135  EVKVI 1139
              ++ I
Sbjct: 33419 HIRSI 33423



 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 54/269 (20%), Positives = 103/269 (38%), Gaps = 30/269 (11%)

Query: 865  GKPRPELTWKKDGAEIDKNQINIRNSETDTIIF-IRKAERSHSGKYDLQVKVDKFVETAS 923
            G P  ++ W KDG +I  ++    + E +   F I+   +  SG+Y  +V+ D    +  
Sbjct: 5166 GTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCD 5225

Query: 924  IDIQIIDRPGPP----QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME-W 978
              ++++D+  PP    ++ K++ V G ++ +     K  G+  I+    +   + S    
Sbjct: 5226 AYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMEC---KVSGSLPISAQWFKDGKEISTSAK 5282

Query: 979  FTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1038
            + ++ H    S  +  L + +   +     N+ G  +DA     S ++            
Sbjct: 5283 YRLVCHERSVSLEVNNLELEDTANYTCKVSNVAG--DDAC----SGILT----------- 5325

Query: 1039 EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1098
                  E P F        AI          ++G P  KI W K+ V +V  P+  +   
Sbjct: 5326 ----VKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLE 5381

Query: 1099 QGVCTLEIRKPSPYDGGTYCCKAVNDLGT 1127
                 L +        G Y C   ND+G+
Sbjct: 5382 GSTSFLNLYSVDASKTGQYTCHVTNDVGS 5410



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 59/283 (20%), Positives = 97/283 (34%), Gaps = 70/283 (24%)

Query: 854  GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 913
            GE+V L     G P P +TW ++  +I+                                
Sbjct: 957  GESVTLECHISGYPSPTVTWYREDYQIE-------------------------------- 984

Query: 914  KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                    +SID QI  + G  +++  E    ++   T +   + G  + + Y   +   
Sbjct: 985  --------SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ--- 1033

Query: 974  KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1033
                   V E + + +  +TE     E   + F E+   +  D ++T+E A        Y
Sbjct: 1034 -------VSEEFEKETTAVTEKFTTEE---KRFVESRDVVMTDTSLTEEQAGPGEPAAPY 1083

Query: 1034 KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1093
                            T+P+V    + G +    C V GNPKP + W K+ V +    RY
Sbjct: 1084 --------------FITKPVVQKL-VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1128

Query: 1094 RMFSNQ--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
            ++  N+  G C L I      D G Y     N  G       L
Sbjct: 1129 KVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 51/213 (23%), Positives = 86/213 (40%), Gaps = 21/213 (9%)

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
             P  P+ +   +     + L W  P+ +G + I GY I+K      ++  V +    T++ 
Sbjct: 15295 PTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSF 15354

Query: 992   ITELVIGNEYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1050
             + E +  ++ Y FRV + N  G SE +       V+ +D ++               +  
Sbjct: 15355 LVENLDEHQMYEFRVKAVNEIGESEPSLPLN---VVIQDDEVPPT----------IKLRL 15401

Query: 1051  QPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAI------VDDPRYRMFSNQGVCT 1103
                 +T  + AG    +   V G P PKI W KN+  I      +   +  +  ++    
Sbjct: 15402 SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTE 15461

Query: 1104  LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             L I K    D GTY   A N LG+V     +EV
Sbjct: 15462 LSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 15494



 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 1044 SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFSNQGV 1101
            ++AP FTQPL +   + G  AT    + G P P+++W ++   I     P  ++  + G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1102 CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
              L I   +  + G Y  KA N  G      +L VK
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 36/105 (34%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 512  LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
            +PA V +   P  ++ GL     VTVI G  + LE  ISG P P   W R D  I E S 
Sbjct: 932  VPAPVEIPVTPPTLVSGL---KNVTVIEGESVTLECHISGYPSPTVTWYREDYQI-ESSI 987

Query: 572  RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              +       + L+I  A  +DSG +  +  NEAG    S  + V
Sbjct: 988  DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 1047  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV---DDPRYRMFSNQGVCT 1103
             P FT PL N  A  G N     ++  +P+P +TW K+   I    +D +Y   S++G+  
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 31749

Query: 1104  LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             L I   +  D   Y   A N  G    + KL V
Sbjct: 31750 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH--YHRTS 989
             P  P    + +V  ++  +TW  P D G   IT Y ++K +  S  W  V +   +  T 
Sbjct: 17012 PDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETMSKRWARVTKDPIHPYTK 17070

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
               + +L+ G +Y FRV +EN  G+ + +  +K   V A+D
Sbjct: 17071 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK--PVFAKD 17108



 Score = 45.1 bits (105), Expect = 4e-04
 Identities = 53/231 (22%), Positives = 95/231 (41%), Gaps = 17/231 (7%)

Query: 394  EGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLK 453
            E + H L IE   +++  E            +LS   +P+ ++  + +QTV    +   +
Sbjct: 8618 EEETHRLEIEEIERSERDEKEFEELVSFIQQRLS-QTEPVTLIKDIENQTVLKDNDAVFE 8676

Query: 454  CEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
             +I  N P     W K    ++ SD+ ++   G  H L + N   +D+G+Y      +  
Sbjct: 8677 IDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIA 8736

Query: 511  TLPAKVHVIDPP--KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME 568
            +  AK+ VI+P   + + D       VT+  G    +    S  P  K+ W R  + I++
Sbjct: 8737 S--AKLTVIEPAWERHLQD-------VTLKEGQTCTMTCQFS-VPNVKSEWFRNGR-ILK 8785

Query: 569  GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
              GR +TE       L I     +D G Y    ++    A   I+ + + F
Sbjct: 8786 PQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQF 8836



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 62/284 (21%), Positives = 105/284 (36%), Gaps = 51/284 (17%)

Query: 869  PELT--WKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDL----QVKVDK-FVE 920
            P++T  W KD  E+   ++I I+  +    + I     S +GKY +     V   K FVE
Sbjct: 3084 PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3143

Query: 921  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA------AITGYTIQKADKK 974
               + I+ I +       +++ +  +   + +   +DD +A          + +Q+  K 
Sbjct: 3144 GRDVRIRSIKK-------EVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK- 3195

Query: 975  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
                + V    HR   + T      EY F V   N   ++                 +Y 
Sbjct: 3196 ----YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVT-----------------LYV 3233

Query: 1035 NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
            N         E P   Q L      +G  A     + G P+PKI+W K +  +    + +
Sbjct: 3234 NA-------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3286

Query: 1095 MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
               +    TL + +  P D   Y C+A ND G       L V+V
Sbjct: 3287 FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV 3330



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 23/72 (31%), Positives = 32/72 (44%)

Query: 1065 TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1124
            TL C V G P+ K+ W+K+   IV    + M     V +  I+     D G Y  K  ND
Sbjct: 5159 TLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVEND 5218

Query: 1125 LGTVEIECKLEV 1136
             G+   +  L V
Sbjct: 5219 FGSSSCDAYLRV 5230



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
           ++TV  G+++RL++ ++G P P   + R D A ++ S   +     D  +L+I  A  +D
Sbjct: 112 SMTVRQGSQVRLQVRVTGIPTPVVKFYR-DGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170

Query: 594 SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
           SG Y +N  N  G A ++ ++ V    + P   T T V
Sbjct: 171 SGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIV 208



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 64/320 (20%), Positives = 110/320 (34%), Gaps = 40/320 (12%)

Query: 315   QMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SEDDANVK 373
             Q T + +Y      E  S + F  +    +T ++      CG+       V S+  A VK
Sbjct: 32353 QKTSERKY------EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVK 32406

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT-------------KADAAEYSVM-TTG 419
             W+ NG E+    K  Y     G   + I++  T             K +A++Y+ +  TG
Sbjct: 32407 WYHNGVELQESSKIHYT-NTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG 32465

Query: 420   GQSSAKLSV---DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDR 476
             G  +   S    +  P  +   LT              E+  +   +  K+ +       
Sbjct: 32466 GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESL 32525

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                 H       + + AL E   +          TL A++            L    ++T
Sbjct: 32526 SSYEHSASAE--MKSAALEEKSLEEKSTTRKIKTTLAARI------------LTKPRSMT 32571

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
             V  G   R      GEP P   W R  + ++  S R +  +    ST  I   +  D G 
Sbjct: 32572 VYEGESARFSCDTDGEPVPTVTWLRKGQ-VLSTSARHQVTTTKYKSTFEISSVQASDEGN 32630

Query: 597   YHINLKNEAGEAHASIKVKV 616
             Y + ++N  G+  A   + +
Sbjct: 32631 YSVVVENSEGKQEAEFTLTI 32650



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 94/440 (21%), Positives = 160/440 (36%), Gaps = 71/440 (16%)

Query: 246  REEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKG 304
            ++EK+        +P  +V +G   RF   +   P+ +V WY NGQ IR S ++   + G
Sbjct: 1835 QKEKQKPDIVLYPEPV-RVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG 1893

Query: 305  CQRILFINNCQMTDDSEYYVTAG------DEKCSTELFVREP------------------ 340
                L I +C+  D  E  VTA       + K   E+  RE                   
Sbjct: 1894 I-HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH 1952

Query: 341  --------------PIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGE-----EI 381
                          P+  T+  E       ER+  E    E +     FK        E 
Sbjct: 1953 EPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEA 2012

Query: 382  IPGPKSRYRIRVEGKKHIL-------------IIEGATKADAAEYSV-MTTGGQSSAKLS 427
            I   + + R + E  + +L             + E   KA A E  + + T      +LS
Sbjct: 2013 ITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELS 2072

Query: 428  VDLKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLK-VVHKGR 484
              ++  KI   +  QTV  G +   +  +    +   +W KNG+ ++ SDR+     +  
Sbjct: 2073 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2132

Query: 485  IHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH---VIDPPKIILDGLDADNTVTVIAGN 541
            + +LVI +   ED    +    A N+      H   ++   ++I    +  + V      
Sbjct: 2133 VCELVIRDVTAEDSASIMV--KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2190

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE-SYPDSSTLVIDIAERDDSGVYHI 599
                E   S EP  K  W +    + EG   R+ ++      S L ID ++ +D     +
Sbjct: 2191 MATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2249

Query: 600  NLKNEAGEAHASIKVKVVDF 619
              +N    A   ++  VV+F
Sbjct: 2250 EDENVKTTAKLIVEGAVVEF 2269



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1059 IAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1118
            + G  A   C V G P+PK+ W  N   I    R+R+    G+  L+I     YD G   
Sbjct: 1853 LEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVK 1911

Query: 1119 CKAVNDLGTVEIECKLEVK 1137
              A N  G +E + KLE++
Sbjct: 1912 VTAENPEGVIEHKVKLEIQ 1930



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 59/286 (20%), Positives = 102/286 (35%), Gaps = 24/286 (8%)

Query: 854   GEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 912
             G+    ++  Q KP  E+ W  +G E+ + ++I+  N+     + I       SG Y  +
Sbjct: 32388 GQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY--R 32445

Query: 913   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 972
                  +   AS D   +D  G            E V  +  P      A    Y +    
Sbjct: 32446 AVCTNYKGEAS-DYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA----YAVSSFK 32500

Query: 973   KKS-MEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1031
             K S ME  + +       + +TE             E++      A+   +SA +     
Sbjct: 32501 KTSEMEASSSVRE---VKSQMTET-----------RESLSSYEHSASAEMKSAALEEKSL 32546

Query: 1032  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1091
               K+   +      A + T+P   T    G +A  +C   G P P +TW++    +    
Sbjct: 32547 EEKSTTRKIKTTLAARILTKPRSMT-VYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 32605

Query: 1092  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             R+++ + +   T EI      D G Y     N  G  E E  L ++
Sbjct: 32606 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 32651



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 61/263 (23%), Positives = 104/263 (39%), Gaps = 35/263 (13%)

Query: 261   AYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDD 319
             +++V  G   RF++ + + P  EVKWY NG E++ S+K  + +      L I +C  TDD
Sbjct: 32382 SHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCH-TDD 32440

Query: 320   SEYY------------------VTAGD-EKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
             S  Y                  VT GD    +++    E P  V  +L  T AY     +
Sbjct: 32441 SGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFK 32500

Query: 361   LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
                E+ E  ++V+  K+         +  R  +   +H      + +  +A     +   
Sbjct: 32501 KTSEM-EASSSVREVKS-------QMTETRESLSSYEH----SASAEMKSAALEEKSLEE 32548

Query: 421   QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLK 478
             +S+ +        +ILT     TV  G+     C+   E +P   W + G  +  S R +
Sbjct: 32549 KSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQ 32608

Query: 479   VVHKGRIHKLVIANALTEDEGDY 501
             V          I++    DEG+Y
Sbjct: 32609 VTTTKYKSTFEISSVQASDEGNY 32631



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 41/170 (24%), Positives = 67/170 (39%), Gaps = 16/170 (9%)

Query: 464  WTKNGLPVQESDRLKVVHK-GRIHKLVIANALTEDEGDYVFAPD--------AYNVTLPA 514
            W  +G  +      KVV K      L+I  A   D G++             +  +T+ A
Sbjct: 1490 WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1549

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS-GRI 573
              H + P  +     +    V +  G++L +++  +G P P  +W +    I+     +I
Sbjct: 1550 VEHQVKPMFV-----EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKI 1604

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV-VDFPDP 622
            R E     + L ID     DS  Y     N+AG      KV V V+F +P
Sbjct: 1605 RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEP 1654



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 67/327 (20%), Positives = 116/327 (35%), Gaps = 65/327 (19%)

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDAN--VKWFKNGEEIIPGPKSRYRIRVEGKKHILI 401
             V+ Q+       G  V+  C++   D +  V W+    ++    K  Y I  E    IL 
Sbjct: 31570 VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEK--YEITYEDGVAILY 31627

Query: 402   IEGATKADAAEY--SVMTTGGQSSAKLSVDLK---------------------------- 431
             ++  TK D   Y   V+   G+ S+   + +K                            
Sbjct: 31628 VKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLE 31687

Query: 432   -PLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVV----HKGR 484
              P +   PL ++T  +G+ +     I+ +      W K+G  ++  D  K       KG 
Sbjct: 31688 RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG- 31746

Query: 485   IHKLVIANALTEDEGDYV------FAPDAYNVTLPAKVHVIDPP---------KIILDGL 529
             +++L I +  T+D+ +Y       +  D+    L   +H   PP         K +L   
Sbjct: 31747 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH--PPPTDSTLRPMFKRLLANA 31804

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             +         G  +  EI +SG PPP   W +  + +  G          D   L I   
Sbjct: 31805 ECQE------GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT 31858

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKV 616
               +D+G Y +   N AG       ++V
Sbjct: 31859 LPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 5/111 (4%)

Query: 1021 KESAVIARDGKI----YKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1076
            +E   +A +GKI    +K    E     EAP   + + +     G +A     V G P P
Sbjct: 2048 EEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDP 2107

Query: 1077 KITWMKNKVAIVDDPR-YRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
            +  W KN V I    R Y  +    VC L IR  +  D  +   KA+N  G
Sbjct: 2108 ECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2158



 Score = 42.0 bits (97), Expect = 0.003
 Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
            P F     +     G  A   C+V G P  +  W K+  A+   P +R+   +    LE+
Sbjct: 3551 PTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILEL 3610

Query: 1107 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
               +  D G Y CKA N  G  +I C+ E+ +I
Sbjct: 3611 SNLTIQDRGVYSCKASNKFG-ADI-CQAELIII 3641



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 1022  ESAVIARDGKIYKNPVYEDFDFSEAPM-FTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1080
             E  + A+D K + N   +     E P+ FT+PL +     G  A L C V      K+ W
Sbjct: 12264 EVQLTAKDFKTHANLFVK-----EPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKW 12317

Query: 1081  MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1121
              KN   I+   +Y + ++  V  L I   +P D  TY C A
Sbjct: 12318 FKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 12358



 Score = 40.0 bits (92), Expect = 0.013
 Identities = 44/211 (20%), Positives = 95/211 (45%), Gaps = 28/211 (13%)

Query: 245  RREEKKSAAFAKILDPAYQVD-------KGGRVRFVVELAD-PKLEVKWYKNGQEIRP-- 294
            R EE   +   ++  P + +        +G   RF +++   P  E  W+ +GQ+I    
Sbjct: 1442 RLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY 1501

Query: 295  STKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFV--------REPPIMVTK 346
            + K + +  G Q ++ +     +D  E+ V A +    + + V         +   M  +
Sbjct: 1502 THKVVIKEDGTQSLIIVP-ATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1560

Query: 347  QLEDTTAYCGERVELECEVSED-DANVKWFKNGEEIIPGPKSRY-RIRVEGKK--HILII 402
            +L++     G R+E++   + + + ++ W KN + I+P    +Y +IR+EG K    L I
Sbjct: 1561 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVP---HKYPKIRIEGTKGEAALKI 1617

Query: 403  EGATKADAAEY--SVMTTGGQSSAKLSVDLK 431
            +     D+A Y  + +   G+ + +  V+++
Sbjct: 1618 DSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1648



 Score = 40.0 bits (92), Expect = 0.013
 Identities = 96/465 (20%), Positives = 165/465 (35%), Gaps = 92/465 (19%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E  S  + + +   K   L E    E+   +   + L+   + KP+  TV  GE   F  
Sbjct: 32523 ESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSC 32582

Query: 80    KVKAEDLLRKPTIKWF-KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAG 138
                 E +   PT+ W  KG+   + S + +H      ++      TFE+  ++A D   G
Sbjct: 32583 DTDGEPV---PTVTWLRKGQ---VLSTSARHQVTTTKYKS-----TFEISSVQASDE--G 32629

Query: 139   NYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRRE 198
             NY   V   +      F L + ++  T   +      K S E +  + E     +   + 
Sbjct: 32630 NYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVK-SPEPRVKSPE----AVKSPKR 32684

Query: 199   VKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKIL 258
             VK  E      V       KP+  EK+        +    K  + ++ E  K  A     
Sbjct: 32685 VKSPEPSHPKAVSP--TETKPTPTEKVQH----LPVSAPPKITQFLKAEASKEIA----- 32733

Query: 259   DPAYQVDKGGRVRFVVELADPKL-EVKWYKNGQEIRPSTKYIFEHKGCQRI-LFINNCQM 316
                       ++  VVE +  +  EV WYK+G++++ +  + F +       L INN   
Sbjct: 32734 ----------KLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 32783

Query: 317   TDDSEYY---------------------------------VTAGDEKCSTELFVR--EP- 340
             +D  EY                                      D+K +     R  EP 
Sbjct: 32784 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 32843

Query: 341   --------PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRI 391
                     P++VT  L+DTT       +   + + E      W K+G+ I  G K  Y++
Sbjct: 32844 APEPISSKPVIVT-GLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK--YKL 32900

Query: 392   RVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSVDLKPLK 434
               +     L I     +D+  Y  +V  + G  S+   + +K +K
Sbjct: 32901 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIK 32945



 Score = 39.7 bits (91), Expect = 0.017
 Identities = 25/98 (25%), Positives = 37/98 (37%)

Query: 1039  EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1098
             + F    AP  T  + +     G N     +V+  P  ++ W  N V + +  +    + 
Sbjct: 32366 QPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNT 32425

Query: 1099  QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              GV TLEI      D GTY     N  G       L+V
Sbjct: 32426 SGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 39.3 bits (90), Expect = 0.022
 Identities = 58/327 (17%), Positives = 107/327 (32%), Gaps = 45/327 (13%)

Query: 854  GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYD 910
            G+     +   G+P PE  W  DG +I  +   ++ I+   T ++I +  A  S SG++ 
Sbjct: 1471 GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIV-PATPSDSGEWT 1529

Query: 911  L--QVKVDKFVETASIDIQIIDRPGPPQIV----------------KIEDVWGENVALTW 952
            +  Q +  +   +  + ++ ++    P  V                K+      N  + W
Sbjct: 1530 VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1589

Query: 953  TPPKD------------DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 1000
                D            +G        I     +   W+T     ++     T   +  E
Sbjct: 1590 LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATA-INKAGRDTTRCKVNVE 1648

Query: 1001 YYFR--------VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQP 1052
              F         +         E A    E   +    + ++     D +  + P F + 
Sbjct: 1649 VEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKK 1708

Query: 1053 LVNTYAIAGYNATLNCSVR--GNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPS 1110
            L +        A   C +   G+P   + W+ +   +    R RM +  G C+L+     
Sbjct: 1709 LTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAY 1768

Query: 1111 PYDGGTYCCKAVNDLGTVEIECKLEVK 1137
              D G   C+A N  GT      L VK
Sbjct: 1769 SRDSGIITCRATNKYGTDHTSATLIVK 1795



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 44/162 (27%), Positives = 69/162 (42%), Gaps = 13/162 (8%)

Query: 279 PKLEVKWYKNGQEIRPST--KYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
           P  EV W+++GQ I  ST           +  L I      +   Y + A    G    +
Sbjct: 33  PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATST 92

Query: 333 TELFVR---EPPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGPKSR 388
            EL V+    PP  V ++L+  T   G +V L+  V+      VK++++G EI       
Sbjct: 93  AELLVKAETAPPNFV-QRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI--QSSLD 149

Query: 389 YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL 430
           ++I  EG  + L+I  A   D+  YSV  T     A  + +L
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAEL 191



 Score = 38.5 bits (88), Expect = 0.037
 Identities = 75/342 (21%), Positives = 130/342 (38%), Gaps = 50/342 (14%)

Query: 316  MTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDA-NVKW 374
            MTD S     AG  + +   F+ +P  +V K +E      G  V   C+V  +   +V W
Sbjct: 1064 MTDTSLTEEQAGPGEPAAPYFITKP--VVQKLVE------GGSVVFGCQVGGNPKPHVYW 1115

Query: 375  FKNGEEIIPGPKSRYRIRVEGKKHI----LIIEGATKADAAEYSVMTTG--GQSSAKLSV 428
             K+G  +  G    YR +V   K      L+I      DA EY+++     G++SA  S+
Sbjct: 1116 KKSGVPLTTG----YRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171

Query: 429  DLKPLKILTPLTDQTVNLGKEICL---KCEISENIPGKWTKNGLPVQESDRLKVVHKGRI 485
              +    L   + Q +    ++     + ++ E  PG +  +    +      ++ K   
Sbjct: 1172 LEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPG-FVYSEYEKEYEKEQALIRKKMA 1230

Query: 486  HKLVIANALTEDEGDYVFAPDA----------YNVTLPAKVHVIDPPKIILD-------- 527
               V+     ED+  ++ + +              TL   +      K+ +D        
Sbjct: 1231 KDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVE 1290

Query: 528  -GLDAD-NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STL 584
             G D+      ++ G  +     +SG P PK  W +  K I  G  R + +   D  ++L
Sbjct: 1291 SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE-RYQMDFLQDGRASL 1349

Query: 585  VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAP 626
             I +   +D G+Y     N  G A  S K+ V      P AP
Sbjct: 1350 RIPVVLPEDEGIYTAFASNIKGNAICSGKLYV-----EPAAP 1386



 Score = 38.1 bits (87), Expect = 0.048
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 3/98 (3%)

Query: 1042  DFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGV 1101
             D +  PMF + L N     G +      V G P P + W K+   +   P   +  ++G+
Sbjct: 31790 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII-HEGL 31848

Query: 1102  --CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
                 L IR   P D G Y   A N  G+   +  L+V+
Sbjct: 31849 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31886



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 5/83 (6%)

Query: 264   VDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             V  G  VRF   +   P    KW  +G EI+    Y  E      +L I NC   D  EY
Sbjct: 17522 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 17581

Query: 323   YVT----AGDEKCSTELFVREPP 341
              +T    AG +  +  L V + P
Sbjct: 17582 QITVSNAAGSKTVAVHLTVLDVP 17604



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 1077  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             ++TW      + +  +Y +    GV  L ++  +  D GTY CK VND G      +L V
Sbjct: 31599 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 31658

Query: 1137  KVIAQ 1141
             K + +
Sbjct: 31659 KGVRE 31663



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR-MFSNQGVCTLE 1105
            P+F    V+   + G  A  +  V G P P+  W  +   IV+D  ++ +    G  +L 
Sbjct: 1457 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1516

Query: 1106 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
            I   +P D G +   A N  G   I   L V+ +
Sbjct: 1517 IVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV 1550



 Score = 36.6 bits (83), Expect = 0.14
 Identities = 53/275 (19%), Positives = 95/275 (34%), Gaps = 51/275 (18%)

Query: 340  PPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
            PP +V+  L++ T   GE V LEC +S      V W++   +I       ++I  +    
Sbjct: 942  PPTLVSG-LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQI--ESSIDFQITFQSGIA 998

Query: 399  ILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE 458
             L+I  A   D+  +                          T   VN    +   C ++ 
Sbjct: 999  RLMIREAFAEDSGRF--------------------------TCSAVNEAGTVSTSCYLAV 1032

Query: 459  NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN-ALTEDEGDYVFAPDAYNVTLPAKVH 517
             +  ++ K    V E    +         +V+ + +LTE++         Y +T P    
Sbjct: 1033 QVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQK 1092

Query: 518  VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE 576
            +++                   G  +     + G P P   W +    +  G   ++   
Sbjct: 1093 LVE-------------------GGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYN 1133

Query: 577  SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                   LVI +   DD+G Y I ++N+ GE  AS
Sbjct: 1134 KQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS 1168



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 45/250 (18%), Positives = 92/250 (36%), Gaps = 31/250 (12%)

Query: 873   WKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
             W KDG EI  + + +I+      I+ I+KA+    G+Y      DK     +++ ++I  
Sbjct: 11694 WFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKV 11753

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
               P   V++      +  +  + P   G   + G  +                   T++ 
Sbjct: 11754 EKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPL-------------------TASP 11794

Query: 992   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQ 1051
               E++   + +  +      G++ + +    +A  A + K+ + P+          +F  
Sbjct: 11795 DCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPL----------IFIT 11844

Query: 1052  PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1111
             PL +        A   C V   PK    W+K    I  D R+ +  +    ++ I+  + 
Sbjct: 11845 PLSDVKVFEKDEAKFECEVSREPK-TFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAF 11903

Query: 1112  YDGGTYCCKA 1121
              D   Y  +A
Sbjct: 11904 EDEAKYMFEA 11913



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 39/146 (26%), Positives = 56/146 (38%), Gaps = 11/146 (7%)

Query: 276   LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
             L  PK  V W K  Q ++ + +  FE      IL IN C  +D   Y +TA +       
Sbjct: 21090 LGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN------- 21142

Query: 336   FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
              V E   ++T Q+ D        ++ + EVS D     W    E     P S Y + +  
Sbjct: 21143 IVGEVGDVITIQVHDIPGPPTGPIKFD-EVSSDFVTFSW-DPPENDGGVPISNYVVEMRQ 21200

Query: 396   KKHILIIEGATKADAAEYSV--MTTG 419
                   +E AT      Y    +TTG
Sbjct: 21201 TDSTTWVELATTVIRTTYKATRLTTG 21226



 Score = 35.8 bits (81), Expect = 0.24
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STLVIDIAERD 592
           +V V+ G+    E  ISG P P+  W R  + I   +      S+ D  + L I    + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 593 DSGVYHINLKNEAGEAHASIKVKVVDFPDPP 623
           +SG Y +   N +G+A ++ ++ V     PP
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 35.8 bits (81), Expect = 0.24
 Identities = 23/89 (25%), Positives = 34/89 (38%), Gaps = 2/89 (2%)

Query: 536   TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG--RIRTESYPDSSTLVIDIAERDD 593
             T   G  +R  + I+  P P   W +  + I  G    +   ES      L I+    DD
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 31759

Query: 594   SGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                Y +  +N+ GE     K+ V   P P
Sbjct: 31760 DAEYTVVARNKYGEDSCKAKLTVTLHPPP 31788



 Score = 35.0 bits (79), Expect = 0.41
 Identities = 23/91 (25%), Positives = 37/91 (40%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
            P F Q L +     G    L   V G P P + + ++   I     +++     + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1107 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             +  P D GTY   A N +G      +L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.0 bits (79), Expect = 0.41
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 1047  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
             P FT  L +  A+     TL C V  +   K  W K+   IV  P+Y + ++     L+I
Sbjct: 11663 PYFTVKLHDKTAVEKDEITLKCEVSKDVPVK--WFKDGEEIVPSPKYSIKADGLRRILKI 11720

Query: 1107  RKPSPYDGGTYCCKAVND--LGTVEIECKL 1134
             +K    D G Y C    D     V +E +L
Sbjct: 11721 KKADLKDKGEYVCDCGTDKTKANVTVEARL 11750



 Score = 33.9 bits (76), Expect = 0.91
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 11/119 (9%)

Query: 393  VEGKKHILIIEGATKADAAEYSVM-------TTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
            VE KK + +    T      + V+       T   +  A + + + P  +++ L + TV 
Sbjct: 896  VEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVI 955

Query: 446  LGKEICLKCEISENIPGK---WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             G+ + L+C IS   P     W +    ++ S   ++  +  I +L+I  A  ED G +
Sbjct: 956  EGESVTLECHIS-GYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRF 1013



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 792 KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 851
           + K TI  +         +KA N +G +     +  +LVK    PP     + L+   +R
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATS---TAELLVKAETAPPNF--VQRLQSMTVR 116

Query: 852 RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI--IFIRKAERSHSGKY 909
           + G  V L +   G P P + + +DGAEI ++ ++ + S+   +  + I +A    SG Y
Sbjct: 117 Q-GSQVRLQVRVTGIPTPVVKFYRDGAEI-QSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174

Query: 910 DLQV--KVDKFVETASIDIQ 927
            +     V +   TA + +Q
Sbjct: 175 SVNATNSVGRATSTAELLVQ 194



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 105/543 (19%), Positives = 203/543 (37%), Gaps = 71/543 (13%)

Query: 3     EPTKKEENEVP-APAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFI 61
             +P K EE   P  P  PPE PS   E         +L  + P     K +  S+++  +I
Sbjct: 30312 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRP-----KDDGGSRVTGYYI 30366

Query: 62    EKPQGGTVK-VGEDITFIAKVKAEDLLRKPTIKWF------KGKWMDLASKAGKHLQLKE 114
             E+ +  T K V  + T I           P  ++           +   S A + +  K+
Sbjct: 30367 ERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD 30426

Query: 115   TFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSA 174
              F++ S+    E+  I                    DS +   E  E  G    +     
Sbjct: 30427 PFDKPSQPGELEILSISK------------------DSVTLQWEKPECDGGKEILGYWVE 30468

Query: 175   FKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF---QYGI 231
             +++SG+               ++  K++ ++ Q  +  LL+    +EYE   F   + G+
Sbjct: 30469 YRQSGDSAW------------KKSNKERIKDKQFTIGGLLE---ATEYEFRVFAENETGL 30513

Query: 232   TDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQE 291
             +  R     +K      +      ++ D   ++ +  ++   + +  P  ++KWY+ G+E
Sbjct: 30514 SRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQI-VGRPLPDIKWYRFGKE 30572

Query: 292   IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVT-- 345
             +  S KY     G    L +   +  D+  Y   A    G+ + S++L ++  P      
Sbjct: 30573 LIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGY 30632

Query: 346   KQLEDTTAYCGERVELE-CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEG 404
                E      G  + L    +      + WF +G++++   ++      E   H+++   
Sbjct: 30633 PLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNV 30691

Query: 405   ATKADAAEYSVMTTG--GQSSAKLSVDL--KPLKILTPLTDQTVNLGKEICLKCEISENI 460
               K  A +Y V  +   G   A L V++  KP K   P+  + + L     +  +   + 
Sbjct: 30692 QRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEAL-LKNSAVISWKPPADD 30750

Query: 461   PGKWTKNGL----PVQESDRLKVVHKG-RIHKLVIANALTEDEGDY--VFAPDAYNVTLP 513
              G W  N +      +E    ++V     +    I N LTE+ G Y  V A + + ++ P
Sbjct: 30751 GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVN-LTENAGYYFRVSAQNTFGISDP 30809

Query: 514   AKV 516
              +V
Sbjct: 30810 LEV 30812



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 43/147 (29%), Positives = 59/147 (40%), Gaps = 10/147 (6%)

Query: 279   PKLEVKWYKNGQE-IRPSTKY-IFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
             PK  VKWY+ G+E I    KY I E KG    L I +    D + Y V A    G    +
Sbjct: 30955 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGT 31014

Query: 333   TELFVREP-PIMVTKQLED---TTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               L V  P  I + K LE      A  GE V ++   S     V  ++ G+++I      
Sbjct: 31015 ASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHY 31074

Query: 389   YRIRVEGKKHILIIEGATKADAAEYSV 415
               I       ++   G  + DA  Y V
Sbjct: 31075 QVIVTRSFTSLVFPNGVERKDAGFYVV 31101



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 3/96 (3%)

Query: 847 QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ---INIRNSETDTIIFIRKAER 903
           Q+ +   G          G P PE++W +DG  I  +    + I  S+    + I    +
Sbjct: 13  QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72

Query: 904 SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
           ++SG+Y L+        T++ ++ +     PP  V+
Sbjct: 73  ANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQ 108



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 21/93 (22%), Positives = 39/93 (41%), Gaps = 1/93 (1%)

Query: 538  IAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
            + G   R ++ + G P P+  W    + I+             + +L+I  A   DSG +
Sbjct: 1469 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEW 1528

Query: 598  HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             +  +N AG +  S+ +  V+  +  V P   E
Sbjct: 1529 TVVAQNRAGRSSISV-ILTVEAVEHQVKPMFVE 1560



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 1064 ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVN 1123
            AT  C     P  K+ W K+ + + +  +YRM S++ V  L I      D   Y C  V 
Sbjct: 2192 ATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2250

Query: 1124 D 1124
            D
Sbjct: 2251 D 2251



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 31/118 (26%), Positives = 46/118 (38%), Gaps = 20/118 (16%)

Query: 1038 YEDFDFS-------EAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD 1090
            YED + S       E   FT+ + N       +AT  C V  +    +TW K    + + 
Sbjct: 8818 YEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAI-VTWYKGPTELTES 8876

Query: 1091 PRYRMFSNQGVC-TLEIRKPSPYDGGTYC----------CKAVNDLGTVEIECKLEVK 1137
             +Y  F N G C  + I   +P D G Y            ++  +L     E KLE+K
Sbjct: 8877 QKYN-FRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLELK 8933



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 27/117 (23%), Positives = 42/117 (35%), Gaps = 9/117 (7%)

Query: 1004  RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1063
             R+   N C L ++A  + E       G +            E  +FT+ L N        
Sbjct: 12428 RILVINKCLLDDEAEYSCEVRTARTSGMLTV--------LEEEAVFTKNLANIEVSETDT 12479

Query: 1064  ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1120
               L C V   P  ++ W K    I++  RY + +      L I+     D G Y C+
Sbjct: 12480 IKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCR 12535



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 836   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
             PP+  +P + K  Y   VGE V   +     P P +TW K G +I
Sbjct: 31689 PPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQKI 31730



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 26/88 (29%), Positives = 33/88 (37%), Gaps = 4/88 (4%)

Query: 1052 PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1111
            PL +   I G  A L C V       + W  N   I  D R +         L I +   
Sbjct: 2450 PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHA 2509

Query: 1112 YDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
             D G Y  K +  +G VE  C L V+ I
Sbjct: 2510 SDEGPY--KLI--VGRVETNCNLSVEKI 2533



 Score = 31.2 bits (69), Expect = 5.9
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 262   YQVDKGGRVRFVVE-LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDS 320
             Y +  G  ++  +  +  P+  + W K+G+ ++ +T+   E      +L I      D  
Sbjct: 24321 YSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFG 24380

Query: 321   EYYVTA 326
             +Y VTA
Sbjct: 24381 KYTVTA 24386


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  288 bits (738), Expect = 2e-77
 Identities = 218/774 (28%), Positives = 346/774 (44%), Gaps = 70/774 (9%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F  +L+  K  VKWY+NG+EI+   KY FE  G    L I +C++ D+ EY     D K 
Sbjct: 6537 FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS 6596

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
               LFV E P+ + +  +D     G  V    E+++D   V+W +N   ++ G K  +++
Sbjct: 6597 RARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDK--HQM 6654

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
              EGK H L I      D  EY  +    ++ AKL +   P KI T   D  V++GK + 
Sbjct: 6655 MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVGKPLT 6713

Query: 452  LKC--EISENIPGKWTKNGLPV----------QESDRL---KVVHKGRIHKLVIANALTE 496
            +    +       +W K   P+          Q S R+   K   KGR +K+V+ N   +
Sbjct: 6714 MVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGR-YKIVLQNKHGK 6772

Query: 497  DEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             EG                + VID P  + +    + T T      L  E P++      
Sbjct: 6773 AEGFI-------------NLKVIDVPGPVRN---LEVTETFDGEVSLAWEEPLTDGGSKI 6816

Query: 557  AMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHAS 611
              +    + I   +  + T+        V  + +     ++ ++ +N  G     E    
Sbjct: 6817 IGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNP 6876

Query: 612  IKVKV-VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLN 670
            ++ +   D P PP+  T+T+V      + WEPP YDGG+ I  Y IE + K S RW    
Sbjct: 6877 VEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 6936

Query: 671  FDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTSPPTLLTV 726
                ++ +     ++EG  Y  R+ A N IG+ KPS  + PFV    P+   SPP  LT 
Sbjct: 6937 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLTS 6995

Query: 727  DSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVAN 786
               T ++V ++W PP   G + + GY++E C EG                   ++WI  N
Sbjct: 6996 SDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK------------------DNWIRCN 7037

Query: 787  KDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLK 846
              L+ +  + +TGL    K   RV A N AG S+P     P+   +    P + +    K
Sbjct: 7038 MKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSA-FK 7096

Query: 847  QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSH 905
                  V   + +++P  G PRP  TW      ++  +++ ++       + I  +ERS 
Sbjct: 7097 DGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSD 7156

Query: 906  SGKYDLQVKVDKFVETAS--IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 963
             G Y L  K++  V+T S  ID+ +I RP  P+ +K  D+  ++V LTW PP DDG + +
Sbjct: 7157 KGIYTL--KLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPL 7214

Query: 964  TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 1017
            TGY ++K +     W  V++       T+ +LV G EY F+V + N CG  E A
Sbjct: 7215 TGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 7268



 Score =  278 bits (711), Expect = 2e-74
 Identities = 166/521 (31%), Positives = 269/521 (51%), Gaps = 35/521 (6%)

Query: 511   TLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             TLP  V     I+PP+I LD  D    V + A   LRL + I G P P+  W + +  + 
Sbjct: 18786 TLPGSVVAQERIEPPEIELDA-DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 18844

Query: 568   EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
             +   R + E     + LVID   R DSG Y++ L+N +G   A + V+V+D P  PV  T
Sbjct: 18845 D---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLT 18901

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             + EV  D   ++WEPP  DGG+ I  Y +E+++     +  +  + C +TTF  + + EG
Sbjct: 18902 IREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEG 18960

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
              +Y  R+ A N  GI  P+  + P        PP  +T+  VT  T T++W  P+  G +
Sbjct: 18961 CSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGS 19020

Query: 748   GLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIF 807
              + GYV+E   +GS                  E W    +  +   + TI+GL    +  
Sbjct: 19021 KITGYVVEMQTKGS------------------EKWSTCTQ--VKTLEATISGLTAGEEYV 19060

Query: 808   VRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 867
              RV AVN  G S+P+    P++ ++I   P + +P H   T+  +  E + + +PF+G+P
Sbjct: 19061 FRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFKGRP 19117

Query: 868   RPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDI 926
             +  + W+KDG  + +  ++N+ +S+T T + I++A +   G Y+L V       T  I I
Sbjct: 19118 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 19177

Query: 927   QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYH 986
              ++DRPGPP  ++I++V  +++ ++W PP+ DG   I+ Y ++K +  S  W  V +   
Sbjct: 19178 IVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVA 19237

Query: 987   RTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIA 1027
             RTS  I  L  G+EY FRV +EN  G S   + ++ SAV+A
Sbjct: 19238 RTSIKIVRLTTGSEYQFRVCAENRYGKS---SYSESSAVVA 19275



 Score =  270 bits (691), Expect = 4e-72
 Identities = 179/588 (30%), Positives = 288/588 (48%), Gaps = 53/588 (9%)

Query: 438   PLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQ------ESDRLKVVHKGRIHKLVIA 491
             P+ D    +   I  KC++S    G+WT    P        E ++L   H+       I 
Sbjct: 16556 PIYDGGCEIQGYIVEKCDVSV---GEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAIN 16612

Query: 492   NALTEDEGDYVFAPDAYNVTLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIP 548
              A   +  D           +P  + V   ++ P I LD L+    + + AG  LRL +P
Sbjct: 16613 KAGVGEHAD-----------VPGPIIVEEKLEAPDIDLD-LELRKIINIRAGGSLRLFVP 16660

Query: 549   ISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEA 608
             I G P P+  W + D  I + +    T S+   ++LV+D   R DSG Y + L+N +G  
Sbjct: 16661 IKGRPTPEVKWGKVDGEIRDAAIIDVTSSF---TSLVLDNVNRYDSGKYTLTLENSSGTK 16717

Query: 609   HASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
              A + V+V+D P PPV   VTE+  D   + WEPP  DGGS I  Y +E+++     +  
Sbjct: 16718 SAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAA 16777

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             +  + C + +++  ++ EG +Y  R+ A N  GI  P+  + P     V  PP  +TVD 
Sbjct: 16778 VVTN-CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDD 16836

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
             VT  +V++ W  P+H G + +  Y++E        AK S++  E A              
Sbjct: 16837 VTRNSVSLSWTKPEHDGGSKIIQYIVE------MQAKHSEKWSECA-------------- 16876

Query: 789   LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT 848
              +   +  IT L    +   RV AVN  G S+P+  + PI+ K+++  P +   +    +
Sbjct: 16877 RVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV---KPAFSS 16933

Query: 849   YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSG 907
             Y  +VG+ + + +P  G+P+P +TW KDG  + +  +IN+ +S   T + I++  +   G
Sbjct: 16934 YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGG 16993

Query: 908   KYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGY 966
             +Y + V      +TASI+I  +D+P PP+  VK +DV  E++ L+W PP   G   IT Y
Sbjct: 16994 QYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNY 17053

Query: 967   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
              +QK D  +  W  V     RT+  +T+L  G EY FR+F+EN  G S
Sbjct: 17054 IVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS 17101



 Score =  259 bits (662), Expect = 1e-68
 Identities = 158/580 (27%), Positives = 280/580 (48%), Gaps = 37/580 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++ P++ LD  +    + V AG   R+ IP  G P P+  WSR +    E + +++ E  
Sbjct: 17714 LEAPELDLDS-ELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEG---EFTDKVQIEKG 17769

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
              + + L ID  +R+D+G Y + L+N +G   A + VKV+D P PP    V EV  D   +
Sbjct: 17770 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFL 17829

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              WEPP  DGG+ +  Y I++++     +  ++   C +T+F+ + + EG  Y  R+ A N
Sbjct: 17830 VWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKTSFKVENLTEGAIYYFRVMAEN 17888

Query: 699   AIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
               G+  P             SPP  +T+  V+ T+ ++ W  P+H G + + GYV+E   
Sbjct: 17889 EFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 17948

Query: 759   EGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 818
             +G+                  E W +  +  +      +TGL +  +   RVKA N  G 
Sbjct: 17949 KGT------------------EKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGK 17988

Query: 819   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 878
             S+P+    P++ K++   P +++P +   TY  + GE + + IP  G+PRP ++W KDG 
Sbjct: 17989 SDPRVLGVPVIAKDLTIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGE 18045

Query: 879   EIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-Q 936
              + +  ++N+  + T T++ I++  +   GKY +         T ++ + ++++PGPP  
Sbjct: 18046 PLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVG 18105

Query: 937   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 996
              V+ ++V  + V ++W PP   G   I+ Y ++K D  +  W  V     RT+  IT+L 
Sbjct: 18106 PVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 18165

Query: 997   IGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
              G EY FR+F+EN  G S  A +  ++ ++      +K P      F  +    Q LV  
Sbjct: 18166 TGTEYQFRIFAENRYGKS--APLDSKAVIVQYP---FKEPGPPGTPFVTSISKDQMLVQW 18220

Query: 1057  YAIAGYNAT--LNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
             +       T  +   +    K  I W+K     + D +++
Sbjct: 18221 HEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18260



 Score =  248 bits (632), Expect = 3e-65
 Identities = 149/496 (30%), Positives = 252/496 (50%), Gaps = 30/496 (6%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PP+I LD  D    VT+ A   LRL +PI G P P+  W+R     ++ +    T SY  
Sbjct: 15552 PPEIELDA-DLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSY-- 15608

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              + L++    R DSG Y + ++N +G   A + V+V+D P PP    V EV      + W
Sbjct: 15609 -TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTW 15667

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGGS I  Y +E+++     +  +  + C +T+++  ++ EG +Y  R+ A N  
Sbjct: 15668 DPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENEY 15726

Query: 701   GISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
             GI  P+  +          PP  +T+  VT  +V++ W  P+H G + + GY++E   +G
Sbjct: 15727 GIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKG 15786

Query: 761   STSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
             S                  + W  A    +  T+ TITGL    +   RV A N  G S+
Sbjct: 15787 S------------------DKW--ATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISD 15826

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
             P+  S P++ K+++ PP  ++   L  T+    GE + + +PF G+P P +TW KD   +
Sbjct: 15827 PRQLSVPVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPL 15883

Query: 881   DK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IV 938
              +  ++N  ++E ++++ I+ A R   G Y +++         ++++ ++D+PGPP   V
Sbjct: 15884 KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPV 15943

Query: 939   KIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIG 998
             K+++V  +++ L+W PPK DG ++I  Y ++K D  +  W  V     RT+     L  G
Sbjct: 15944 KMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTG 16003

Query: 999   NEYYFRVFSENMCGLS 1014
              EY FR+ +EN  G S
Sbjct: 16004 CEYQFRIAAENRYGKS 16019



 Score =  244 bits (624), Expect = 3e-64
 Identities = 156/511 (30%), Positives = 243/511 (47%), Gaps = 35/511 (6%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG--DKAIMEGSGRIRT 575
             +++PP+I LD       V V AG  +RL   + G P PK  W +   D  + +G    + 
Sbjct: 12295 ILEPPEIDLDA-SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG----QV 12349

Query: 576   ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
             +     + LVI  + RDDSG Y + L N AGE    + V+V+D P P     V++V    
Sbjct: 12350 DLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTS 12409

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++W PP  DGGS +  Y +E+++     W  +  ++ K+T+F    ++ G  Y  R+ 
Sbjct: 12410 CHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNLVPGNEYYFRVT 12468

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             AVN  G   P+   +P +   PL+   PP  L V  +T  + T+ W PP   G A +DGY
Sbjct: 12469 AVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 12528

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             +  Y  E                + PA+ W      ++      +TGL    K   RV A
Sbjct: 12529 ITSYREE----------------EQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAA 12570

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
              NA G S P+        KE + PPKI +P  +      + G+ + +     GKP P   
Sbjct: 12571 RNAVGVSLPREAEGVYEAKEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCK 12626

Query: 873   WKKDGAE-IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
             WKK   E +  + + +  +++ +I+ I+   R  SG Y L  +     +T  I + ++D 
Sbjct: 12627 WKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDA 12686

Query: 932   PGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSA 990
             PGPPQ    I D+  +  +L+W  P +DG + IT Y ++K D    +W T +    +TS 
Sbjct: 12687 PGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSC 12746

Query: 991   TITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
              + +L+ G EY FRV +EN  G+SE  T  K
Sbjct: 12747 RVGKLIPGQEYIFRVRAENRFGISEPLTSPK 12777



 Score =  244 bits (623), Expect = 3e-64
 Identities = 143/488 (29%), Positives = 242/488 (49%), Gaps = 34/488 (6%)

Query: 534   TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSS----TLVIDIA 589
             T+ V AG    + +P  G P P  +WS+ D  +       RT +Y D++    +L I+ A
Sbjct: 19890 TLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-------RTRAYVDTTDSRTSLTIENA 19942

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R+DSG Y + ++N    A  ++ VKV+D P PP   TV +V  +  +++W+ P  DGG+
Sbjct: 19943 NRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGA 20002

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y IE+++     W+ +  + C   +++   + EG  Y  R+   N  G+  P+   
Sbjct: 20003 PVKNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETK 20061

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
                      SPP  L V S++  +V++ W  P+H G + +  YV+E   +G         
Sbjct: 20062 EGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQ-------- 20113

Query: 770   NGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPIL 829
                       ++W+     +   T   ++GL  +++ F RV A N AG S+P+    P+L
Sbjct: 20114 ----------KNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVL 20161

Query: 830   VKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIR 888
             +KE +EPP+I +      T   R G  + + IP  GKP P++T  +DG  +    + N  
Sbjct: 20162 IKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTE 20221

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGEN 947
              +  +  I ++++  + +G+Y++          A I+I ++DRPGPP   V I D+  E+
Sbjct: 20222 ITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEES 20281

Query: 948   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 1007
             V L W PPK DG + +T Y + K +  +  W  V     RT   + +L  G EY FR+ +
Sbjct: 20282 VTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKA 20341

Query: 1008  ENMCGLSE 1015
             EN  G+S+
Sbjct: 20342 ENRFGISD 20349



 Score =  244 bits (622), Expect = 4e-64
 Identities = 157/500 (31%), Positives = 254/500 (50%), Gaps = 31/500 (6%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P + LD    D  V V AG  +R+   +SG+PPP   W+  ++ + + +     E+   S
Sbjct: 10217 PDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAIS 10272

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-VGDDWCIMNW 640
             S++VI   +R   GVY +  KNEAGE   +I V V+D P P   P +   + ++ C + W
Sbjct: 10273 SSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTW 10332

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGGSPI  Y IE+++     W  + + + ++     + +I+G AY  RI A N+I
Sbjct: 10333 FSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSI 10391

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+      S   V   P+ V   P  L V  VT  TVT+ W PP + G + +  YVLE  
Sbjct: 10392 GMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESR 10451

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
               G+    +                 V N +L+ + K+T+ GL        RV AVN  G
Sbjct: 10452 LIGTEKFHK-----------------VTNDNLLSR-KYTVKGLKEGDTYEYRVSAVNIVG 10493

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDG 877
               +P + ++PI  K+ + PP + +    K T   RVGEA  L   + GKP+P+++W KD 
Sbjct: 10494 QGKPSFCTKPITCKDELAPPTLHLDFRDKLTI--RVGEAFALTGRYSGKPKPKVSWFKDE 10551

Query: 878   AEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 936
             A++ + ++ +I+ +     +   KA+RS SGKY + V+           + ++DRPGPP 
Sbjct: 10552 ADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPV 10611

Query: 937   -IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 995
               V  ++V  + + ++W PP DDG + IT Y I+K +     W  V     +T+  +++L
Sbjct: 10612 GPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKL 10671

Query: 996   VIGNEYYFRVFSENMCGLSE 1015
             + G +Y FR+ +EN+ G+S+
Sbjct: 10672 LEGKDYIFRIHAENLYGISD 10691



 Score =  239 bits (611), Expect = 8e-63
 Identities = 151/488 (30%), Positives = 240/488 (49%), Gaps = 28/488 (5%)

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             D   TVT+ AG  LRL + +SG PPP   WS+    +   +    TESY   S L++D  
Sbjct: 23146 DLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY---SLLIVDKV 23202

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R D+G Y I  +N++G+  A++ VKV D P P  +  V EV  D   + WE P  DGG+
Sbjct: 23203 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23262

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y +E K++ + R  +     C +T +    ++EG  Y  R+   N  GI +P   S
Sbjct: 23263 PVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETS 23321

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
                +   V   P  L V  VT +TVT+ W  P + G + L GYVLE C  G+        
Sbjct: 23322 DAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGT-------- 23373

Query: 770   NGEAAYDLPAEDW--IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQP 827
                       E W  +V  K  +   + T+T L    +   R++A N  G SEP+     
Sbjct: 23374 ----------ERWMKVVTLKPTV--LEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTA 23421

Query: 828   ILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQIN 886
             + V+++   P I +    ++T     G  V LVIP  G+P P  +W   G+++ +  ++ 
Sbjct: 23422 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 23481

Query: 887   IRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWG 945
             +        + IR+     +G+Y L++K      + +I + I+D+PGPP   +KI+++  
Sbjct: 23482 VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA 23541

Query: 946   ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 1005
              ++ ++W PP+ DG A ++GY +++ D     W  V E   R++   T L  GNEY FRV
Sbjct: 23542 TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRV 23601

Query: 1006  FSENMCGL 1013
              + N  G+
Sbjct: 23602 AATNRFGI 23609



 Score =  239 bits (610), Expect = 1e-62
 Identities = 152/526 (28%), Positives = 245/526 (46%), Gaps = 40/526 (7%)

Query: 508  YNVTLPAKVHVIDPPKIILDGLDADNT--------------VTVIAGNKLRLEIPISGEP 553
            Y V+   K  V DP +I L  L AD+               + VI  N + + +P +G P
Sbjct: 7059 YRVSAENKAGVSDPSEI-LGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYP 7117

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
             P A W  GDK ++E   R++ ++    + LVI  +ER D G+Y + L+N        I 
Sbjct: 7118 RPTATWCFGDK-VLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEID 7176

Query: 614  VKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL 673
            V V+  P  P      ++  D   + WEPP  DGGSP+ GY +E+++     W ++  D 
Sbjct: 7177 VNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDF 7235

Query: 674  CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPF---VPLAVTSPPTLLTVDSVT 730
              +  F    +++G  Y  ++ A N  G  +P+    P     P  V  PP  +     T
Sbjct: 7236 VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRT 7295

Query: 731  DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLI 790
              ++ + W PP + G + + GY++E C  GS                  + W+   +  +
Sbjct: 7296 ANSIFLTWDPPKNDGGSRIKGYIVERCPRGS------------------DKWVACGEP-V 7336

Query: 791  DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYI 850
             +TK  +TGL        RVKA+N  GAS+P   ++ I   +  E P+I +   L     
Sbjct: 7337 AETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLT 7396

Query: 851  RRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKY 909
             + G  + L     GKP P++TW K    + ++ +I I N    + + I  ++RS +G Y
Sbjct: 7397 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 7456

Query: 910  DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
             ++        TA +++ ++D+PGPP    I DV  E+  LTW PP+DDG + IT Y ++
Sbjct: 7457 IIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVE 7516

Query: 970  KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
            +    S  W  +      T+   T+L+   EY FRV +ENM G+ E
Sbjct: 7517 RRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGE 7562



 Score =  239 bits (610), Expect = 1e-62
 Identities = 138/399 (34%), Positives = 201/399 (50%), Gaps = 21/399 (5%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT V  D   ++W  P  DGGSPILGY +ERK++    W  ++  L     F
Sbjct: 14954 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIF 15013

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   + +G+AYE R+ A N  G SKPS PS P + L    PP      ++T  TVT++W 
Sbjct: 15014 KSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWA 15073

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P++ G   +  Y++E                    DLP   W+ AN   I + +FT++G
Sbjct: 15074 KPEYTGGFKITSYIVE------------------KRDLPNGRWLKANFSNILENEFTVSG 15115

Query: 800   LPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVN 858
             L  DA    RV A NAAGA S P   S  I  ++ +E PKI++    K T I + GEA  
Sbjct: 15116 LTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFR 15175

Query: 859   LVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDK 917
             L     G+P P + W KDG E++   ++ I+ ++  T +  + + R  SG Y L      
Sbjct: 15176 LEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPG 15235

Query: 918   FVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                    +++++DRPGPP+  + + +V  E   L+W PP DDG A I  Y +QK +   +
Sbjct: 15236 GFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRL 15295

Query: 977   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              W  V      T   +T+L+ GNEY FRV + N  G+ E
Sbjct: 15296 AWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGE 15334



 Score =  239 bits (610), Expect = 1e-62
 Identities = 162/609 (26%), Positives = 285/609 (46%), Gaps = 58/609 (9%)

Query: 429   DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
             D+KP       +  +V +G+++ ++  IS        WTK+GLP++++ R+ V     + 
Sbjct: 16926 DVKPA-----FSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT 16980

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPK--IILDGLDADNTVTVIA 539
              L I     +D G Y            A + ++     DPPK  +  D + A++      
Sbjct: 16981 TLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES------ 17034

Query: 540   GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT-----ESYPDSSTLVIDIAERDDS 594
                    I +S  PP      +    I++      T      +    +TL +   +    
Sbjct: 17035 -------ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTE 17087

Query: 595   GVYHINLKNEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
               + I  +N  G++ A     +V       P PP  P  T +  D  ++ W  P  +GGS
Sbjct: 17088 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 17147

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P++GY +ERK++ S  W ++N  +  +T F+ + + EG+ YE R++A N +G+ K S  S
Sbjct: 17148 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 17207

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
               +V      PP       V    +T++W  P + G + + GY++E              
Sbjct: 17208 ECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVE-------------- 17253

Query: 770   NGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPI 828
                   DLP   W+ A+   + +T+FT++GL  D +   RV A NAAGA S+P   + PI
Sbjct: 17254 ----KRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPI 17309

Query: 829   LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINI 887
               K+ +E P+I +    + T +   GE   L     GKP P + W +   EI+++ +  I
Sbjct: 17310 TAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEI 17369

Query: 888   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGE 946
             +N++   ++ ++ A R   G+Y L+       ++  ++++++DRPGPP+  V++  V  E
Sbjct: 17370 KNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSE 17429

Query: 947   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 1006
               +LTW+PP  DG + I+ Y ++K +   + W  V       S  +T+L+ GNEY FR+ 
Sbjct: 17430 KCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIM 17489

Query: 1007  SENMCGLSE 1015
             + N  G+ E
Sbjct: 17490 AVNKYGVGE 17498



 Score =  239 bits (610), Expect = 1e-62
 Identities = 171/602 (28%), Positives = 283/602 (47%), Gaps = 51/602 (8%)

Query: 436   LTPLTDQTVNL--GKEICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIA 491
             L+ +  +T+++  G+ + L   I+   P    W   G  ++ES+R+ V    ++ KL I 
Sbjct: 23435 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIR 23494

Query: 492   NALTEDEGDYVFAPDAYNVTLPA----KVHVIDPP-----KIILDGLDADNTVTVIAGNK 542
                  D G+Y    +  NVT       KV ++D P      I +D +DA +        +
Sbjct: 23495 ETTIRDTGEYTL--ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPE 23552

Query: 543   LRLEIPISG-----EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
             L    P+SG         +  W    +++   + +    +  +     +    R   G Y
Sbjct: 23553 LDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 23612

Query: 598   HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
                L++E  E  +SI++     P PP    + +V  D   + W PP  DGGS + GY +E
Sbjct: 23613 ---LQSEVIECRSSIRI-----PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVE 23664

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK+ ++ RW+R+N      T +    + EG+ YE R+ A+NA G  KPS PS+P V +  
Sbjct: 23665 RKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDP 23724

Query: 718   TSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAA 774
              +PP       VTDTT   V++ W  P+  G + + GY++E         ++ D++    
Sbjct: 23725 IAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIE--------MQKVDQH---- 23772

Query: 775   YDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 834
                   +W   N       ++T+T LP  A+   RV A NA G  EP      + V E++
Sbjct: 23773 ------EWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEML 23826

Query: 835   EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT 894
             E P   +    ++    R G  + L IP +GKP P   W K+G +I K  + I  SET T
Sbjct: 23827 EYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAM-IATSETHT 23885

Query: 895   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWT 953
              + I++A+R  SG YDL ++     +   I +++I  P  P+  ++ +D+   +V ++W 
Sbjct: 23886 ELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWR 23945

Query: 954   PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 1013
             PP DDG A I GY +++ +     W+T+      TS  +  L    EY+FRV +EN  G+
Sbjct: 23946 PPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGI 24005

Query: 1014  SE 1015
             S+
Sbjct: 24006 SK 24007



 Score =  238 bits (607), Expect = 2e-62
 Identities = 169/578 (29%), Positives = 277/578 (47%), Gaps = 44/578 (7%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH--VIDP 521
             W K+G+ ++E  R +++       L + + +  D G YV        T    V+  V+D 
Sbjct: 19518 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 19577

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + ++GL A+         +      I      K   S     I EG  ++   
Sbjct: 19578 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQM--- 19634

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEV 631
                 +S  V  + + ++  ++ +   N+   GE   S+ +K +D    P PP +  +T V
Sbjct: 19635 ----TSCKVTKLLKGNEY-IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSV 19689

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               +   + W  P  DGGS I GY IER++K S RW+R+N     +   +   + EG  YE
Sbjct: 19690 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 19749

Query: 692   VRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAG 748
              R++A NA G+S PS  S   R   P+ + SPP+   +     TT+T+ W  P   G A 
Sbjct: 19750 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19809

Query: 749   LDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFV 808
             + GY +EY        K+SD+           DW  + + L   T++TI+GL T A+   
Sbjct: 19810 ITGYTVEY--------KKSDDT----------DWKTSIQSLRG-TEYTISGLTTGAEYVF 19850

Query: 809   RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPR 868
             RVK+VN  GAS+P   S P + KE  E P   I   +++T I + G +  + +PF+G+P 
Sbjct: 19851 RVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPV 19910

Query: 869   PELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI 928
             P + W K   ++ + +  +  +++ T + I  A R+ SGKY L ++      + ++ +++
Sbjct: 19911 PNVLWSKPDTDL-RTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKV 19969

Query: 929   IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT 988
             +D PGPP  + ++DV  E+  L+W  P++DG A +  Y I+K +     W +V  + +R 
Sbjct: 19970 LDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRL 20029

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1026
             S  +T L  G  YYFRV  EN  G+   A  TKE   I
Sbjct: 20030 SYKVTNLQEGAIYYFRVSGENEFGVGIPAE-TKEGVKI 20066



 Score =  236 bits (603), Expect = 7e-62
 Identities = 153/533 (28%), Positives = 261/533 (48%), Gaps = 43/533 (8%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP+  LD  D   T+ + AG  +RL +P+ G PPPK  WS+ +  + +  G +  +S
Sbjct: 13382 ILIPPEGELDA-DLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIG-LDIKS 13439

Query: 578   YPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCI 637
                 + L  +   + D+G Y + L+N  G+   +I VKV+D P PPV  TV E+  D   
Sbjct: 13440 TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAY 13499

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + WEPP  DGGSPI+ Y ++++  +   W  +  + C +T+F    + EG +Y  R+FA 
Sbjct: 13500 VTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAE 13558

Query: 698   NAIGISKPSMPSRPFVPLAVTSPPTL-LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             N  GI  P   +R  V  + T  P + L V SV+ ++ ++ W+ P   G + + GYV+++
Sbjct: 13559 NEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 13617

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                       ++EN           W    K L    +++   L    +   RV A N  
Sbjct: 13618 L---------TEEN----------KWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENEN 13656

Query: 817   GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK- 875
             G   P   +  ++ ++ +  P + +       Y+ +      L IP +GKP P ++WKK 
Sbjct: 13657 GEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 13714

Query: 876   DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-P 934
             +       ++++ +S  +T + +   ++S +GKY + +K     +  +I I+++ +PG P
Sbjct: 13715 EDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIP 13774

Query: 935   PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE 994
                +K ++V  E + L W PPKDDG + IT Y ++K D  + +W T      +T+  +T 
Sbjct: 13775 TGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR 13834

Query: 995   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1047
             L  G EY FRV +EN  G+ E     K   ++AR            FD  +AP
Sbjct: 13835 LHEGMEYTFRVSAENKYGVGEG---LKSEPIVAR----------HPFDVPDAP 13874



 Score =  236 bits (603), Expect = 7e-62
 Identities = 185/698 (26%), Positives = 312/698 (44%), Gaps = 80/698 (11%)

Query: 364   EVSEDDANVKWFK----NGEEII-------PGPKSRYRIRVEGKKHILIIEGATKADAAE 412
             +VS+  A++ W K     G  ++       P    ++ I  E K    ++ G +     +
Sbjct: 17918 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 17977

Query: 413   YSVMTTG--GQSSAKL--------SVDLKPLKILTPLTDQTVNLGKEICLKCEI----SE 458
             + V      G+S  ++         + ++P  +  P    ++  G+++ ++  +      
Sbjct: 17978 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQP-SLKLPFNTYSIQAGEDLKIEIPVIGRPRP 18036

Query: 459   NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKV 516
             NI   W K+G P++++ R+ V        L I     +D G Y       A   T    V
Sbjct: 18037 NI--SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSV 18094

Query: 517   HVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              V++ P      +  D + AD  V             IS EPP      +    I+E   
Sbjct: 18095 IVLEKPGPPVGPVRFDEVSADFVV-------------ISWEPPAYTGGCQISNYIVEKRD 18141

Query: 572   RIRTESYPDSSTLV---IDIAERDDSGVYHINL--KNEAGE-AHASIKVKVVDFP----D 621
                T  +  S+T+    I I +      Y   +  +N  G+ A    K  +V +P     
Sbjct: 18142 TTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPG 18201

Query: 622   PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
             PP  P VT +  D  ++ W  P  DGG+ I+GY +E+K+K S  W++LN    ++T F+ 
Sbjct: 18202 PPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKT 18261

Query: 682   KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
               + EG+ YE ++ A N +GI KPS  S  FV      PP       +T   VT++W+ P
Sbjct: 18262 TGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKP 18321

Query: 742   DHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
              + G + + GY++E                    DLP   W+ A+   + +T+FT++GL 
Sbjct: 18322 AYDGGSKITGYIVE------------------KKDLPDGRWMKASFTNVLETEFTVSGLV 18363

Query: 802   TDAKIFVRVKAVNAAG-ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
              D +   RV A NAAG  SEP   S  I  ++ I+ P   +    K   +   GE   L 
Sbjct: 18364 EDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 18423

Query: 861   IPFQGKPRPELTWKKDGAEIDKN--QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 918
                +GKP P++ W KDG E+++   ++ I+++   T + ++   R+  G+Y L++     
Sbjct: 18424 ADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 18483

Query: 919   VETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
              ++  I ++++DRPGPP+  +K+  V  E   L W PP  DG A I+ Y I+K +   + 
Sbjct: 18484 TKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLS 18543

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V       +  +T+L+ GNEY FRV + N  G+ E
Sbjct: 18544 WTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGE 18581



 Score =  234 bits (596), Expect = 5e-61
 Identities = 171/604 (28%), Positives = 285/604 (47%), Gaps = 46/604 (7%)

Query: 428   VDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             +DLK   +LT     T+ L  E  ++ +    +     K+   +  S R+K+  +    K
Sbjct: 11898 LDLKLSGVLTVKAGDTIRL--EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11955

Query: 488   LVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
               +  A   D G YV      A +    A V+V+D P     G   +  +  ++ ++   
Sbjct: 11956 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP-----GPVRNLKIVDVSSDRCT- 12009

Query: 546   EIPISGEPPPKAMWSRGDKAIMEG--SGRIRTESYPDS----STLVIDIAERDDSGVYHI 599
                +  +PP           I+E   + R+   +Y  +     T V  + E ++  ++ +
Sbjct: 12010 ---VCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEY-IFRV 12065

Query: 600   NLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
               +N+ G     E+   I     D P  P  P VT+V  +   + W PP YDGG  I GY
Sbjct: 12066 RAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGY 12125

Query: 655   FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV- 713
             F+E+K+K S+RW+ +N     E   + + ++    Y+ R+ A N IGI +PS+PSRP V 
Sbjct: 12126 FLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVA 12185

Query: 714   --PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENG 771
               P+    PPT   V   T  ++T+ W  P + G A + GYV+E         K +D + 
Sbjct: 12186 KDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEM------RPKIADAS- 12238

Query: 772   EAAYDLPAEDWIVANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 830
                   P E W   N    + + +FT+T L  + +   RV A N  G   P    + I  
Sbjct: 12239 ------PDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKP 12292

Query: 831   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE--IDKNQINIR 888
             KEI+EPP+I +   +++  I R G  + L    +G+P P++TW+K G +  + K Q+++ 
Sbjct: 12293 KEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDL- 12351

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENV 948
               +T   + I  + R  SGKY L +      +   ++++++D PGP   +K+ DV   + 
Sbjct: 12352 -VDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSC 12410

Query: 949   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 1008
              ++W PP++DG + +T Y ++K +     W TV     +TS  +T LV GNEYYFRV + 
Sbjct: 12411 HVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAV 12470

Query: 1009  NMCG 1012
             N  G
Sbjct: 12471 NEYG 12474



 Score =  233 bits (594), Expect = 8e-61
 Identities = 202/725 (27%), Positives = 321/725 (44%), Gaps = 83/725 (11%)

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKW----FKNGEEIIP---- 383
             S  L +REP I V ++ ED        +E++ EV+++   + W    +  G EII     
Sbjct: 10400 SEALVIREP-ITVPERPED--------LEVK-EVTKNTVTLTWNPPKYDGGSEIINYVLE 10449

Query: 384   ----GPKSRYRIRVEGK-KHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTP 438
                 G +  +++  +        ++G  + D  EY V         K S   KP+     
Sbjct: 10450 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 10509

Query: 439   LTDQTVNLGKEICLKCEISE------NIPGK------WTKNGLPVQESDRLKVVHKGRIH 486
             L   T++L     L   + E         GK      W K+   V E DR  +       
Sbjct: 10510 LAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10569

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVIDPPKIILDGLDADNTVTVIAGNK 542
              L    A   D G Y    +  N T   K    V+V+D P   +  +  D          
Sbjct: 10570 ALEKIKAKRSDSGKYCVVVE--NSTGSRKGFCQVNVVDRPGPPVGPVSFDEVT------- 10620

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR------TESYPDSSTLVIDIAERDDSGV 596
              +  + IS +PP     S+    I+E     +      T +   ++  V  + E  D  +
Sbjct: 10621 -KDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY-I 10678

Query: 597   YHINLKNEAG--EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 651
             + I+ +N  G  +   S  +K  D    PD P  P VTEV  D  ++ W  P +DGG PI
Sbjct: 10679 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPI 10737

Query: 652   LGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
               Y +E+++  S RW R+  D +   T F    ++EG  YE R+ A N IGI  PS PS+
Sbjct: 10738 TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK 10797

Query: 711   PFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQS 767
             P     P+A  SPP        T  +V + W+PP H G + + GY++EY        K  
Sbjct: 10798 PVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEY-------QKVG 10850

Query: 768   DENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQP 827
             DE    A   P         +   +TK+ +TGL        RV AVNAAG S+P +  +P
Sbjct: 10851 DEEWRRANHTP---------ESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEP 10901

Query: 828   ILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINI 887
             +LVK+ +EPP++ +  ++ +    +VG+ + L    +G P P++TWKK+  +    +  I
Sbjct: 10902 VLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAP-TKARI 10960

Query: 888   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 947
               +   + + IR A     G Y L V+     +T S+ + ++D+PGPP+ +++ ++  ++
Sbjct: 10961 DVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDS 11020

Query: 948   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 1007
               LTW  P DDG + IT Y +++ D  S +W  +     + S     L  GN+Y FRV +
Sbjct: 11021 CYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAA 11080

Query: 1008  ENMCG 1012
             EN  G
Sbjct: 11081 ENQYG 11085



 Score =  233 bits (593), Expect = 1e-60
 Identities = 172/611 (28%), Positives = 288/611 (47%), Gaps = 45/611 (7%)

Query: 241  LKRMRREEKKSAAFA-------KILDPAYQVDKGGR--VRFVVELADPKLEVKWYKNGQE 291
            L   R E  KSAA         +I++P   ++   +  V F  ++    + +KW KNG+E
Sbjct: 6408 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 6467

Query: 292  IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT 351
            +    +  +     + +L I +C   D+ EY VTAG +K   EL + E P    + LED 
Sbjct: 6468 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 6527

Query: 352  TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA 411
            T    +     C++S + ANVKW++NG EI  G K  Y+   +G  H LII+     D  
Sbjct: 6528 TVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK--YKFEKDGSIHRLIIKDCRLDDEC 6585

Query: 412  EYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLP 470
            EY+      +S A+L V+  P++I+ P  D     G ++    E++ + +  +W +N + 
Sbjct: 6586 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 6645

Query: 471  VQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD 530
            V + D+ +++ +G+IH+L I +    D+G+Y F   A +    AK+ +   PKI      
Sbjct: 6646 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI--AKDKEARAKLELAAAPKI----KT 6699

Query: 531  ADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAE 590
            AD  + V  G  L + +P    P  +A W + ++ +   +     ++  + ++  I  A+
Sbjct: 6700 ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEAK 6755

Query: 591  RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
            + D G Y I L+N+ G+A   I +KV+D P P     VTE  D    + WE P  DGGS 
Sbjct: 6756 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSK 6815

Query: 651  ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE-GVAYEVRIFAVNAIGISKPSMPS 709
            I+GY +ER+  +   W+ L  D  +   F    + + GV Y  R+ A N +G  +P    
Sbjct: 6816 IIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETD 6874

Query: 710  RPFVPLA---VTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
             P    +   V  PP  +T+  V    V++ W PP++ G A +  YV+E      TS + 
Sbjct: 6875 NPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIE--LRDKTSIR- 6931

Query: 767  SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
                 + A  + AED      D+++  +++            RV+A N  G  +P   + 
Sbjct: 6932 ----WDTAMTVRAEDLSATVTDVVEGQEYSF-----------RVRAQNRIGVGKPSAATP 6976

Query: 827  PILVKEIIEPP 837
             + V + IE P
Sbjct: 6977 FVKVADPIERP 6987



 Score =  232 bits (592), Expect = 1e-60
 Identities = 158/525 (30%), Positives = 252/525 (48%), Gaps = 40/525 (7%)

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS---RGDKAIMEGSGRI--- 573
             + P++ +D + A + +   AG+++R+   I G P PK+ W    +  KA+ +G   I   
Sbjct: 9501  EEPEVFID-IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 9559

Query: 574   -RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVG 632
              + E+  +SS ++I   +R  +G Y I  KN+AG+  A+ +VKV+D P PP    V+++ 
Sbjct: 9560  AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDIT 9619

Query: 633   DDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEV 692
                C ++W+ P  DGG  I GY IE++      W ++N D C  TTF    ++    Y  
Sbjct: 9620  RGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFF 9678

Query: 693   RIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGL 749
             R+ A N  GI  P    +      P+    PP  L +  +T  TV + W+PP + G + +
Sbjct: 9679  RVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPV 9738

Query: 750   DGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVR 809
               Y++E      T  K+             E W   NK  +++ +FT+  L    +   R
Sbjct: 9739  THYIVECLAWDPTGTKK-------------EAWRQCNKRDVEELQFTVEDLVEGGEYEFR 9785

Query: 810   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 869
             VKAVNAAG S+P     P   +    PP I     LK+      G  VN+V   +G P P
Sbjct: 9786  VKAVNAAGVSKPSATVGPCDCQRPDMPPSI----DLKEFMEVEEGTNVNIVAKIKGVPFP 9841

Query: 870   ELTW------KKDGAE---IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
              LTW      K D  E    D +   +   +T T++ I ++ RS +G Y +    +    
Sbjct: 9842  TLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLV-IPQSRRSDTGLYTITAVNNLGTA 9900

Query: 921   TASIDIQIIDRPGPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
             +  + + ++ RPGPP   +K E V  + + L+W PPKDDG + IT Y I+K +     W 
Sbjct: 9901  SKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWV 9960

Query: 980   TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1024
              V       + TI +L+ G+EY FR+ ++N  G+ E      E+A
Sbjct: 9961  HVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETA 10005



 Score =  232 bits (591), Expect = 2e-60
 Identities = 174/651 (26%), Positives = 304/651 (46%), Gaps = 60/651 (9%)

Query: 386   KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
             K++Y+ R   +  + I   +  +D    +++         LSV +K L         TV 
Sbjct: 12954 KAQYQFRAIARTAVNISPPSEPSDPV--TILAENVPPRIDLSVAMKSLL--------TVK 13003

Query: 446   LGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              G  +CL   +  + +P   W K+G  ++ ++ +K+  +  +  L + +   +D GDY  
Sbjct: 13004 AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTI 13063

Query: 504   APDAYNVTLPA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR 561
               +  + +  A  K+ V+D P     G  A   +  +  ++  L    S EPP +   S 
Sbjct: 13064 TAENSSGSKSATIKLKVLDKP-----GPPASVKINKMYSDRAML----SWEPPLEDGGSE 13114

Query: 562   GDKAIMEGSGRIRTESYPDSSTLVI---DIAERDDSGVYHINL--KNEAGEA-----HAS 611
                 I++     R      S+T+ I    + +  +   Y   +  +N+ G         +
Sbjct: 13115 ITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPA 13174

Query: 612   IKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
             I     D P   DPPV   +T+   D   ++W+PPA DGGSPI GY +E+++ Q+  W +
Sbjct: 13175 IAKNPYDPPGRCDPPVISNITK---DHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK 13231

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLT 725
             +N     E T +   + EG  YE R+ A+N  G  KPS  S+      P     PP    
Sbjct: 13232 VNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPK 13291

Query: 726   VDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVA 785
             V   T ++V++ W  P + G + + GY++E         K++D +     +LP       
Sbjct: 13292 VYDTTRSSVSLSWGKPAYDGGSPIIGYLVE--------VKRADSDNWVRCNLPQN----- 13338

Query: 786   NKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHL 845
                 + KT+F +TGL  D +   RV AVN  G S+P         K+I+ PP+  +   L
Sbjct: 13339 ----LQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADL 13394

Query: 846   KQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERS 904
             ++T I R G  + L +P +G+P P++TW K    + D+  ++I++++ DT +      + 
Sbjct: 13395 RKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKY 13454

Query: 905   HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT 964
              +GKY L ++     +  +I ++++D PGPP  V ++++  ++  +TW PP  DG + I 
Sbjct: 13455 DAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPII 13514

Query: 965   GYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              Y +QK D +   W TV     +TS  +  L  G  Y+FRVF+EN  G+ +
Sbjct: 13515 NYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD 13565



 Score =  229 bits (585), Expect = 9e-60
 Identities = 149/513 (29%), Positives = 245/513 (47%), Gaps = 28/513 (5%)

Query: 506   DAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D+  VT   K V  +  P++ +D  +   T  V AG  +RL I   G P P A+WS+ D 
Sbjct: 22033 DSCEVTGTIKAVDRLTAPELDIDA-NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDS 22091

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
              +   +    T+S+   STL ++   R+D+G Y + ++N +G    +  VKV+D P PP 
Sbjct: 22092 NLSLRADIHTTDSF---STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPG 22148

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
               T  +V      + W+ P  DGG+ I  Y +E+++     W  ++ + C    F+   +
Sbjct: 22149 PITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDL 22207

Query: 685   IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
              EGV Y  R+ AVN  G+ +P     P V     +PP  L V   + ++  + W  PDH 
Sbjct: 22208 AEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHD 22267

Query: 745   GAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDA 804
             G + + GY+LE   +GS                  + W+ A      +  FT+  L    
Sbjct: 22268 GGSRITGYLLEMRQKGS------------------DFWVEAGH--TKQLTFTVERLVEKT 22307

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   RVKA N AG SEP+     +++KE    P   +     Q    + G    + +P  
Sbjct: 22308 EYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPIS 22367

Query: 865   GKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 923
             G+P P++TWK +   + + ++++I  ++  T + ++ + R  SG+Y L ++    V+T S
Sbjct: 22368 GRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFS 22427

Query: 924   IDIQIIDRPGP-PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVI 982
             + + +I RPGP    +++  V  E+  L+W  PKD G   IT Y ++K +  +  W  V 
Sbjct: 22428 VTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVN 22487

Query: 983   EHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
                 RT   +T L    EY FRV SEN  G+S+
Sbjct: 22488 SSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSK 22520



 Score =  229 bits (584), Expect = 1e-59
 Identities = 159/586 (27%), Positives = 270/586 (46%), Gaps = 42/586 (7%)

Query: 465   TKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKI 524
             +++G+P++ + R           + +  ++T D G Y       + T  A ++++     
Sbjct: 20206 SRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV----- 20260

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM---EGSGRIRTESYPDS 581
             +LD      T  V+  +     + +  EPP     S+    I+   E S  + TE     
Sbjct: 20261 VLDR-PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATV 20319

Query: 582   STLVIDIAERDDSGVYHINLKNE--------AGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             +  ++ + +      Y   +K E           A  ++K+     P PP  P VT V  
Sbjct: 20320 ARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTT-PGPPSTPWVTNVTR 20378

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             +   + W  P  +GGS ++GY +E K + S  W + N  + + T F+   +  G+ YE R
Sbjct: 20379 ESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFR 20438

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYV 753
             ++A NA G+ KPS PS P + +    PP  + +  ++  +V++ W+ P   G + + GY+
Sbjct: 20439 VYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYI 20498

Query: 754   LEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAV 813
             +E                    DLP   W  A+   + +T+F I+GL  +++   RV A 
Sbjct: 20499 VE------------------RRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFAR 20540

Query: 814   NAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
             NA G+ S P     PI   +    P I +P    +    R G +V L     GKP P + 
Sbjct: 20541 NAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIE 20600

Query: 873   WKKDGAEIDKNQINIRNSETD-TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
             W KD  E+  N +    + TD   I I+ A+R +SG Y+L+++      +A+I +QI+D+
Sbjct: 20601 WYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDK 20660

Query: 932   PGPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSA 990
             PGPP   ++ + V  E + L W PP DDG A IT Y ++K +   + W  V EH      
Sbjct: 20661 PGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECII 20720

Query: 991   TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
             T T+++ GNEY FRV + N  G+ E     +  +V+A++  +   P
Sbjct: 20721 TTTKIIKGNEYIFRVRAVNKYGIGEP---LESDSVVAKNAFVTPGP 20763



 Score =  228 bits (581), Expect = 3e-59
 Identities = 172/638 (26%), Positives = 274/638 (42%), Gaps = 44/638 (6%)

Query: 394   EGKKHILIIEGATKADAAEYSVMTTGGQSSAKL-SVDLKPLKILTPLTDQTVNLGKEICL 452
             EGK++   +    +      S +T   +       +DLK L  L  L  +  N   +I +
Sbjct: 13642 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 13701

Query: 453   KCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTL 512
             K + + ++   W K   P+    R+ V        L++ +    D G Y         T 
Sbjct: 13702 KGKPAPSV--SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 13759

Query: 513   PA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                  + V+  P I    +  D  VT  A       + +   PP     S     I+E  
Sbjct: 13760 EGTISIKVVGKPGIPTGPIKFDE-VTAEA-------MTLKWAPPKDDGGSEITNYILEKR 13811

Query: 571   GRIRTE-----SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV-----DFP 620
               +  +     S    +T  +          + ++ +N+ G         +V     D P
Sbjct: 13812 DSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 13871

Query: 621   DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE 680
             D P  P + +V  D   + W  P   GGSPI GY +E K++ S  W R N    +   F+
Sbjct: 13872 DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFK 13931

Query: 681   PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRP 740
                + EG+ YE R+ A+N  G+ KPS+PS P V L    PP    V ++T  +VT+ W  
Sbjct: 13932 VTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTE 13991

Query: 741   PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
             P + G   L GY++E                    DLP++ W+ AN   + +  FT+T L
Sbjct: 13992 PKYDGGHKLTGYIVE------------------KRDLPSKSWMKANHVNVPECAFTVTDL 14033

Query: 801   PTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 859
                 K   R++A N AGA S P   ++ I+ K+  E P I +   +K     + G+ + L
Sbjct: 14034 VEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVL 14093

Query: 860   -VIPFQGKPRPELTWKKDGAEIDKNQI-NIRNSETDTIIFIRKAERSHSGKYDLQVKVDK 917
               I   GKP P+ +W K G +I  + I  I ++ T +++ I+ A R  +G+Y +      
Sbjct: 14094 NAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPF 14153

Query: 918   FVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
               +   + + ++D PGPP  V+I +V  E   LTWTPP +DG + I  Y ++K +   + 
Sbjct: 14154 GTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLL 14213

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V E         T+L+ GNEY FRV + N  G  E
Sbjct: 14214 WTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE 14251



 Score =  227 bits (579), Expect = 4e-59
 Identities = 156/571 (27%), Positives = 260/571 (45%), Gaps = 50/571 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF--APDAYNVTLPAKVHVIDP 521
             W K+G  ++E+ R+ V     +  L I  A  ED G Y    +  A ++T+P  + V+D 
Sbjct: 19123 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19182

Query: 522   P----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             P     I +D +  D+             I IS  PP      +    I+E      T  
Sbjct: 19183 PGPPGPIRIDEVSCDS-------------ITISWNPPEYDGGCQISNYIVEKKETTSTTW 19229

Query: 578   YPDSSTLV---IDIAERDDSGVYHINL-------KNEAGEAHASIKVKVVDFPDPPVAPT 627
             +  S  +    I I        Y   +       K+   E+ A +       P PP  P 
Sbjct: 19230 HIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPK 19289

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             V        ++ W+ P  DGGS ++GY +E K++ S  W + N  L  +T  +   + EG
Sbjct: 19290 VVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEG 19349

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
             + YE R++A N  GI K S    P        PP    V ++T  +V+++W  P + G A
Sbjct: 19350 LMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGA 19409

Query: 748   GLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIF 807
              + GY++E                    +LP   W+  N   I +T F +T L  D +  
Sbjct: 19410 KITGYIVE------------------RRELPDGRWLKCNYTNIQETYFEVTELTEDQRYE 19451

Query: 808   VRVKAVNAA-GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 866
              RV A NAA   SEP   + PI+VK+ +EPP++ +    +   + + GE + +     G+
Sbjct: 19452 FRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGR 19511

Query: 867   PRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASID 925
             P P ++W KDG EI++  +  I +++  T++ ++   R  +G+Y L +K      + +++
Sbjct: 19512 PLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVN 19571

Query: 926   IQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 984
              +++D+PGPP   ++I  +  E  +L+W  P++DG A I  Y ++K +   + W      
Sbjct: 19572 CKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGE 19631

Query: 985   YHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
                TS  +T+L+ GNEY FRV   N  G+ E
Sbjct: 19632 LQMTSCKVTKLLKGNEYIFRVTGVNKYGVGE 19662



 Score =  226 bits (575), Expect = 1e-58
 Identities = 154/509 (30%), Positives = 238/509 (46%), Gaps = 33/509 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++PP++ILD   A     +  G+ LRL   I G P PK  W + D+   +   + R +  
Sbjct: 10908 LEPPELILDANMAREQ-HIKVGDTLRLSAIIKGVPFPKVTWKKEDR---DAPTKARIDVT 10963

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
             P  S L I  A  +D G+Y + ++N AG    S+KV V+D P PP    V+E+  D C +
Sbjct: 10964 PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYL 11023

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              W+ P  DGGS I  Y +ER+   S++W  L+    K++ F  K + EG  Y  R+ A N
Sbjct: 11024 TWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAEN 11082

Query: 699   AIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
               G     +   P +   PL    PP  L    V  T V++ W  PD  G + + GY++E
Sbjct: 11083 QYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVE 11142

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
             Y  EG+                  +DWI      +   +  +TGL        RVKA N 
Sbjct: 11143 YQEEGT------------------QDWI--KFKTVTNLECVVTGLQQGKTYRFRVKAENI 11182

Query: 816   AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 875
              G   P   + PI  +E + PP + +   L +  + + G  V      +G P P   W  
Sbjct: 11183 VGLGLPD-TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTT 11241

Query: 876   DGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP 934
             DG+EI  ++   +      +++ I+   R  +G+Y + V      +T ++ + ++D PGP
Sbjct: 11242 DGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGP 11301

Query: 935   PQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATIT 993
             P   + I DV  E++ ++W PPKDDG + +  Y ++K D +   W  V     +T   I 
Sbjct: 11302 PTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIP 11361

Query: 994   ELVIGNEYYFRVFSENMCGLSE--DATMT 1020
              L  G EY FRV +EN  G+    D+T T
Sbjct: 11362 HLQKGCEYVFRVRAENKIGVGPPLDSTPT 11390



 Score =  224 bits (572), Expect = 3e-58
 Identities = 142/494 (28%), Positives = 240/494 (48%), Gaps = 29/494 (5%)

Query: 529   LDAD--NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
             LDA+   T+ V AG  +R+ +PI G P P+  W++ +  +   +    TES+   + L+I
Sbjct: 14473 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESF---TLLII 14529

Query: 587   DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
                 R D+G + + ++N AG+    + V+V+D P P +    T++  D   ++W+ P  D
Sbjct: 14530 PECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLID 14589

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I  Y +E+++     +       C + T++   + EG  Y  R+ A N  GI +P+
Sbjct: 14590 GGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPT 14648

Query: 707   MPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
               + P       SPP  L +  +T +TV++ W  P H G + + GYV+E   +GS     
Sbjct: 14649 ETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGS----- 14703

Query: 767   SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
                          + W   +   +   +  +  L    +   +V AVN+AG S P+  S+
Sbjct: 14704 -------------DQW--THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESR 14747

Query: 827   PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-I 885
             P++VKE    P++ +    ++  I + G+ + + IP  G+P+P +TWKK    + + Q +
Sbjct: 14748 PVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRV 14807

Query: 886   NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVW 944
             N   + T TI+ I +  RS SG Y L  +         I IQ+ D PGPP   +K ++V 
Sbjct: 14808 NFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVS 14867

Query: 945   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFR 1004
              + V  +W PP++DG   I+ Y ++     S  W  +     RT+   T L  G EY FR
Sbjct: 14868 SDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFR 14927

Query: 1005  VFSENMCGLSEDAT 1018
             V ++N  G+    T
Sbjct: 14928 VKAQNRYGVGPGIT 14941



 Score =  224 bits (570), Expect = 5e-58
 Identities = 165/572 (28%), Positives = 264/572 (46%), Gaps = 51/572 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDP 521
             W K+ +P++++ R+          L I +A  ED G YV      A        V V+D 
Sbjct: 15876 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDK 15935

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + +D + AD+             I +S  PP     S  +  I+E      T 
Sbjct: 15936 PGPPTGPVKMDEVTADS-------------ITLSWGPPKYDGGSSINNYIVEKRDTSTTT 15982

Query: 577   SYPDSSTLVIDI--AERDDSGV---YHINLKNEAGEA-HASIKVKVVDF----PDPPVAP 626
                 S+T+      A R  +G    + I  +N  G++ + + +  V  +    P PP  P
Sbjct: 15983 WQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTP 16042

Query: 627   TVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              VT    D   + W  P  DGGS ++GY +ERK++ S  W++LN     +T F+   + E
Sbjct: 16043 VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEE 16102

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGA 746
             GV YE R+ A N +GI KPS  S  +V      PP       VT  +VT++W+ P + G 
Sbjct: 16103 GVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGG 16162

Query: 747   AGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKI 806
             + + GY++E                    +LP   W+ A+   I  T F +TGL  D + 
Sbjct: 16163 SKITGYIVE------------------KKELPEGRWMKASFTNIIDTHFEVTGLVEDHRY 16204

Query: 807   FVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQG 865
               RV A NAAG  SEP   +  I  ++ ++PP+I +    K T +   GE+  +     G
Sbjct: 16205 EFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYG 16264

Query: 866   KPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 924
             KP P + W K   E+    ++ I++++  T + ++ A R  SG Y L+ K      + ++
Sbjct: 16265 KPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTV 16324

Query: 925   DIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 983
             +++++DRPGPP+  V I  V  E   L W PP  DG + I  Y +++ +   + W  V  
Sbjct: 16325 NVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDA 16384

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             +    S  +T+L+ GNEY FR+ + N  G+ E
Sbjct: 16385 NVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGE 16416



 Score =  220 bits (560), Expect = 7e-57
 Identities = 161/544 (29%), Positives = 248/544 (45%), Gaps = 66/544 (12%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            + P+I LD +     +TV AG K+ L   ++G+P PK  W++ D  I++   RI  E+ P
Sbjct: 7381 EAPEIFLD-VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM-ILKQDKRITIENVP 7438

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              ST+ I  ++R D+G Y I   N  G A A ++V V+D P PP A  +T+V ++ C++ 
Sbjct: 7439 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLT 7498

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W PP  DGGS I  Y +ER+   S  W +L+    K+T F+  K+I    Y  R+ A N 
Sbjct: 7499 WNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENM 7557

Query: 700  IGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+ +P  + P           PPT L    +T   VT+ W  PD  G + + GY +E  
Sbjct: 7558 YGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVE-- 7615

Query: 758  FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                              D   + W+  NK  +  T + + GL    K   RV A N AG
Sbjct: 7616 ----------------RLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAG 7659

Query: 818  ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-- 875
              +P   ++PIL+K+ I+PP       +K                  GK    L W K  
Sbjct: 7660 PGKPSKSTEPILIKDPIDPPWPPGKPTVKDV----------------GKTSVRLNWTKPE 7703

Query: 876  --DGAEIDKNQINIRNSETDTIIFIRKAE-----------RSHSGKYDLQVK-VDKFVET 921
               GA+I+   I +  + TD   ++R AE                +Y  +V+ V+K  E+
Sbjct: 7704 HDGGAKIESYVIEMLKTGTDE--WVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGES 7761

Query: 922  ASID-------IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKK 974
               +        + +  P PP+ +++ ++      L WT P+ DG + IT Y ++K D +
Sbjct: 7762 EPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVR 7821

Query: 975  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
               W TV      T  T+T L  G+ Y FRV +EN  G S+   +  E +V+A+D     
Sbjct: 7822 RKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEI--EDSVLAKDTFTTP 7879

Query: 1035 NPVY 1038
             P Y
Sbjct: 7880 GPPY 7883



 Score =  219 bits (559), Expect = 9e-57
 Identities = 174/636 (27%), Positives = 290/636 (45%), Gaps = 67/636 (10%)

Query: 428   VDLKPLKILTPLTDQTV-NLGKEICLKCEISENIPG--KWTKNGLPVQESDRLKVVHKGR 484
             V+   +K+     D  +   G+   L+ ++S   P   +W+K+G  ++ + +L++     
Sbjct: 15151 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15210

Query: 485   IHKLVIANALTEDEGDYV--------FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                LV  ++   D G Y         FA   +NV       V+D P       +    VT
Sbjct: 15211 STNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVK------VLDRP----GPPEGPLAVT 15260

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAER 591
              +   K  L    S  PP     ++ D  I++     R       S    + L +    +
Sbjct: 15261 EVTSEKCVL----SWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLK 15316

Query: 592   DDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
              +  ++ +   N+ G     E+   + V     PDPP  P VT +  D  ++ W  P  D
Sbjct: 15317 GNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSD 15376

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I+ Y +ER+ K   RW++ N     +  ++   + EG  YE RI A NA GIS PS
Sbjct: 15377 GGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 15436

Query: 707   MPSRPFVPLAVT----SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGST 762
              P+ PF     T     PP    V   + +++++ W  P + G + + GY++E       
Sbjct: 15437 -PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIA----- 15490

Query: 763   SAKQSDENGEAAYDLPAED-W-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                           LP ED W IV     +  T +TITGL  + +  +R+ A+N+ G  E
Sbjct: 15491 --------------LPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGE 15536

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD-GAE 879
             P         ++ + PP+I +   L++    R    + L +P +G+P PE+ W +D G  
Sbjct: 15537 PALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGES 15596

Query: 880   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
             +DK   +I ++ + T++ +    R  SGKY L V+     ++A ++++++D PGPPQ +K
Sbjct: 15597 LDK--ASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK 15654

Query: 940   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 999
             +++V   +V LTW PP  DG + I  Y ++K +     + TV  + H+TS  + +L  G 
Sbjct: 15655 VKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGC 15714

Query: 1000  EYYFRVFSENMCGL---SEDATMTKESAVIARDGKI 1032
              YYFRV +EN  G+   +E A   K S      GKI
Sbjct: 15715 SYYFRVLAENEYGIGLPAETAESVKASERPLPPGKI 15750



 Score =  219 bits (557), Expect = 2e-56
 Identities = 163/601 (27%), Positives = 258/601 (42%), Gaps = 40/601 (6%)

Query: 430   LKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             L P KIL P    T+  GK++ ++  +    +   KW K    V  S  L V        
Sbjct: 12592 LLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI 12650

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPKIILDGLDADNTVTVIAGNK 542
             L+I +   +D G Y    +  + T   K+ V+      PP+   D  D D          
Sbjct: 12651 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC-----S 12705

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
             L   IP+         +      +  G       S   +S  V  +    +  ++ +  +
Sbjct: 12706 LSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEY-IFRVRAE 12764

Query: 603   NEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N  G +      K+V       P  P    VT+V  D   + W+ P  DGGSPI+GY IE
Sbjct: 12765 NRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIE 12824

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK++ S  W++ N  L + T +    ++EG+ Y  RI+A+N  G S PS P+        
Sbjct: 12825 RKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP 12884

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDL 777
               PP    V  VT +TV++ W  P H G + + GY +E C                   L
Sbjct: 12885 VDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEAC------------------KL 12926

Query: 778   PAEDWIVAN--KDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 835
             P + W+  N     I + ++T TGL   A+   R  A  A   S P   S P+ +     
Sbjct: 12927 PGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV 12986

Query: 836   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDT 894
             PP+I +   +K     + G  V L     GKP P ++WKKDG  +   + I +       
Sbjct: 12987 PPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLC 13046

Query: 895   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTP 954
              + +    R  SG Y +  +     ++A+I ++++D+PGPP  VKI  ++ +   L+W P
Sbjct: 13047 TLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEP 13106

Query: 955   PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
             P +DG + IT Y + K +     W  V      TS ++ +L+ G+EY FR+ +EN  G+ 
Sbjct: 13107 PLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVG 13166

Query: 1015  E 1015
             +
Sbjct: 13167 D 13167



 Score =  219 bits (557), Expect = 2e-56
 Identities = 151/565 (26%), Positives = 257/565 (45%), Gaps = 42/565 (7%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+GLP++ES+ ++         L I NA  E  G Y    D     + +P  V  + P
Sbjct: 21292 WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 21351

Query: 522   PK-----IILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      I  D + AD+ +       L  ++P          +S   +   + + ++   
Sbjct: 21352 PSKPKGPIRFDEIKADSVI-------LSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCS 21404

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD-----FPDPPVAPTVTEV 631
             S   ++  V ++  +D    + +  +N  G +   +   +V       P PP  P +  V
Sbjct: 21405 SVARTTFKVPNLV-KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNV 21463

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               D   + W+ P YDGGS + G+ +E+K++ S  W ++N        +    ++EG+ Y+
Sbjct: 21464 TSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQ 21523

Query: 692   VRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDG 751
              R++A N+ G+S PS PS+  + ++   PP       VT  T+T++W PP   G + + G
Sbjct: 21524 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 21583

Query: 752   YVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 811
             Y +E         +Q +E            W+  N   + + ++T+TGL    +   R+ 
Sbjct: 21584 YSIE--------KRQGNER-----------WVRCNFTDVSECQYTVTGLSPGDRYEFRII 21624

Query: 812   AVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPE 870
             A NA G  S P   S  I+ ++   PP +          I + GE++ +    QG+P P 
Sbjct: 21625 ARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPR 21684

Query: 871   LTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
             +TW KDG EI+K   + I +    T +F+R A R H G Y ++ K       A I +++ 
Sbjct: 21685 VTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21744

Query: 930   DRPGP-PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT 988
             D PG     ++  ++ GE + L W  P +DG A IT Y I+K +   + W  + +     
Sbjct: 21745 DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQ 21804

Query: 989   SATITELVIGNEYYFRVFSENMCGL 1013
             S T  +L+ GNEY FRV + N  G+
Sbjct: 21805 SYTAIKLINGNEYQFRVSAVNKFGV 21829



 Score =  216 bits (551), Expect = 8e-56
 Identities = 161/592 (27%), Positives = 267/592 (45%), Gaps = 52/592 (8%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHV 518
             +W K    +  + RL++        L + +A+  D G+Y+    A NV    ++   V V
Sbjct: 16271 QWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK--AKNVAGERSVTVNVKV 16328

Query: 519   IDPP-----KIILDGLDADNTVTVIA-----GNKLRLEIPISGEPPPKAMWSRGDKAIME 568
             +D P      +++ G+ A+            G    +   +      + +W+  D  +  
Sbjct: 16329 LDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQT 16388

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              S ++      +  T  I    +   G        E  E+   +       PD P AP V
Sbjct: 16389 LSCKVTKLLEGNEYTFRIMAVNKYGVG--------EPLESEPVVAKNPFVVPDAPKAPEV 16440

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV 688
             T V  D  I+ WE PA DGGS ILGY +E++ K+  RW R +  L  E       +IE  
Sbjct: 16441 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 16500

Query: 689   AYEVRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIG 745
              YE R+ A NA G+S+PS PS   +   P+    PP    V  +T ++V + W  P + G
Sbjct: 16501 DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDG 16560

Query: 746   AAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDL-IDKTKFTITGLPTDA 804
                + GY++E C                  D+   +W +      I+KT   +  L    
Sbjct: 16561 GCEIQGYIVEKC------------------DVSVGEWTMCTPPTGINKTNIEVEKLLEKH 16602

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   R+ A+N AG  E      PI+V+E +E P I +   L++    R G ++ L +P +
Sbjct: 16603 EYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIK 16662

Query: 865   GKPRPELTW-KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 923
             G+P PE+ W K DG   D   I++ +S T  +  +    R  SGKY L ++     ++A 
Sbjct: 16663 GRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLV--LDNVNRYDSGKYTLTLENSSGTKSAF 16720

Query: 924   IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 983
             + ++++D P PP  +K+ ++  ++V++TW PP  DG + I  Y ++K +     +  V+ 
Sbjct: 16721 VTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVT 16780

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGL---SEDATMTKESAVIARDGKI 1032
             + H+ S  I +L  G  YYFRV +EN  G+   ++ A   K + V    GKI
Sbjct: 16781 NCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 16832



 Score =  216 bits (550), Expect = 1e-55
 Identities = 154/518 (29%), Positives = 249/518 (48%), Gaps = 36/518 (6%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   N  + AK  +++ P+I LD +    +V   AG  +++ IP  G PPP   W R D+
Sbjct: 20948 PIEMNEPVQAK-DILEAPEIDLD-VALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDE 21004

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS-IKVKVVDFPDPP 623
               +    R   E+   SS L I    R+D+G Y + ++N  GE  +S + VKV+D P   
Sbjct: 21005 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 21064

Query: 624   VAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
                 V  V      + W+PP  DGGSPI+ Y IE++      W  ++   C  T+F+   
Sbjct: 21065 QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHK-CSSTSFKLID 21123

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             + E   +  R+ A N IGI +P   + P     V +P   L++   T T+V + W  PD 
Sbjct: 21124 LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDF 21183

Query: 744   IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKT-KFTITGLPT 802
              G + +  YV+E   +G                   + W  A    I KT +  ++ L  
Sbjct: 21184 DGGSVITEYVVERKGKGE------------------QTWSHAG---ISKTCEIEVSQLKE 21222

Query: 803   DAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP 862
              + +  RV A N  G S+P     PI VKE+I  P++ +          R+G  V+L +P
Sbjct: 21223 QSVLEFRVFAKNEKGLSDPVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELP 21281

Query: 863   FQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
             ++GKP+P ++W KDG  + +++ +    +E    + I+ A++ H GKY   V +D  V  
Sbjct: 21282 YKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYT--VILDNAVCR 21339

Query: 922   ASIDIQIIDRPGPPQI----VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
              ++ I +I   GPP      ++ +++  ++V L+W  P+D+G   IT Y+I+K +     
Sbjct: 21340 IAVPITVITL-GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTN 21398

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V     RT+  +  LV   EY FRV +EN  G+S+
Sbjct: 21399 WKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQ 21436



 Score =  214 bits (546), Expect = 3e-55
 Identities = 142/494 (28%), Positives = 224/494 (45%), Gaps = 36/494 (7%)

Query: 573   IRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPT 627
             +   S P   T  I         V+ I  +N+ G     ++       +   P  P  PT
Sbjct: 9960  VHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPT 10019

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT----FEPKK 683
             V+ V  +   +NWE P YDGGSP+ GY++E K   S RW R+N D  K  T    ++   
Sbjct: 10020 VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTG 10079

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRP 740
             +IEG  Y+ R++A+NA G+   S+PS P     P+A   PP    V   T ++  + W P
Sbjct: 10080 LIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPP-FPKVTDWTKSSADLEWSP 10138

Query: 741   PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
             P   G + + GY++EY  EG                   E+W       +  TK  +TGL
Sbjct: 10139 PLKDGGSKVTGYIVEYKEEGK------------------EEWEKGKDKEVRGTKLVVTGL 10180

Query: 801   PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
                A    RV+AVN AG  EP   +  I +K+ +  P +++   ++   +   G  + ++
Sbjct: 10181 KEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRII 10240

Query: 861   IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
                 GKP P +TW  +   + + +  I  +   + + I+  +RSH G Y L  K +    
Sbjct: 10241 AYVSGKPPPTVTWNMNERTLPQ-EATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGER 10299

Query: 921   TASIDIQIIDRPGPPQIVKI-EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
               +I + ++D PGP     +  ++  E+  LTW  P+DDG + IT Y I+K +     W 
Sbjct: 10300 KKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWT 10359

Query: 980   TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1039
              V     R +AT+  L+ G  Y+FR+ +EN  G+      T E+ VI     + + P  E
Sbjct: 10360 PVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMG-PFVETSEALVIREPITVPERP--E 10416

Query: 1040  DFDFSEAPMFTQPL 1053
             D +  E    T  L
Sbjct: 10417 DLEVKEVTKNTVTL 10430



 Score =  211 bits (537), Expect = 3e-54
 Identities = 160/553 (28%), Positives = 257/553 (46%), Gaps = 70/553 (12%)

Query: 502  VFAPDAYNVTLPAKV--HVI--DP---PKIILDGLDADNTVTVIAGNKLRLEIPISGEPP 554
            V A +A  V+ P+++  +V+  DP   P I L+  D    + VI G KL + +P    P 
Sbjct: 8055 VRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD----IIVIEGEKLSIPVPFRAVPV 8110

Query: 555  PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
            P   W +  K + + S R+  ++   S+ L +  + R D+G+Y I L+N+ G A ASI V
Sbjct: 8111 PTVSWHKDGKEV-KASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINV 8169

Query: 615  KVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC 674
            KV+  P P      +++    C + WEPP +DGG+PIL Y +ER++     ++ +     
Sbjct: 8170 KVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGEN 8229

Query: 675  KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTD 731
            K  ++  K +I    Y  R+ AVN +G  +      P +   P     PP  + V + T 
Sbjct: 8230 K-LSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTA 8288

Query: 732  TTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLID 791
              +T+ W+PP + G + + GY++E   +G                   E W   N+ L+ 
Sbjct: 8289 EAMTITWKPPLYDGGSKIMGYIIEKIAKGE------------------ERWKRCNEHLVP 8330

Query: 792  KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 851
               +T  GL    +   RV+A NAAG SEP   + P    + I+ PK+ +   L+   ++
Sbjct: 8331 ILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLE---VK 8387

Query: 852  RVGEAVNLVIPFQGKPRPELTWKKD-----GAEIDK------------------------ 882
            R G+ + L     G P P +TW KD       EI K                        
Sbjct: 8388 R-GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLT 8446

Query: 883  NQINIRNSET-DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
             +++I NS+  ++ + +R + R   G Y ++V+ D  +  A   + ++D PGPP     E
Sbjct: 8447 QRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFE 8506

Query: 942  DVWGENVALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGN 999
            D+   +V   W PP DDG + I  YT++K D  K   EW  V         ++T+L+ G 
Sbjct: 8507 DIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGK 8566

Query: 1000 EYYFRVFSENMCG 1012
            EY FRV +EN  G
Sbjct: 8567 EYLFRVRAENRFG 8579



 Score =  210 bits (535), Expect = 5e-54
 Identities = 177/671 (26%), Positives = 293/671 (43%), Gaps = 79/671 (11%)

Query: 380   EIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPL 439
             +++ G K  +RIR +         GA  A +     +    +  A       P  +L P 
Sbjct: 14032 DLVEGGKYEFRIRAKNTA------GAISAPSESTETIICKDEYEA-------PTIVLDPT 14078

Query: 440   TDQ--TVNLGKEICLKCE--ISENIP-GKWTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                  T+  G  I L     + + +P   W+K G  ++ SD  ++        L I  A 
Sbjct: 14079 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 14138

Query: 495   TEDEGDY-VFAPDAYNVTLP-AKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              +D G+Y + A + +   +   KV V+D P     G      ++ ++  K  L    +  
Sbjct: 14139 RKDAGEYTITATNPFGTKVEHVKVTVLDVP-----GPPGPVEISNVSAEKATL----TWT 14189

Query: 553   PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK----NE---- 604
             PP +   S     I+E           ++S L+  +   D     H+  K    NE    
Sbjct: 14190 PPLEDGGSPIKSYILEKR---------ETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFR 14240

Query: 605   --------AGEAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILG 653
                      GE   S  VK+VD    P PP  P V+ V  +   ++W+ P  DGGS I G
Sbjct: 14241 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 14300

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV 713
             Y +ER++K+S RW+R       +   +   + EG  YE R+ A N  GI  PS  S   +
Sbjct: 14301 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 14360

Query: 714   PLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDEN 770
                   PP   +   VTDTT    ++ W  P + G   + GYV+E+   G   A   D  
Sbjct: 14361 MKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGD-EAWIKDTT 14419

Query: 771   GEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 830
             G A                +  T+F +  L T  K   R+ A+N AG  EP       +V
Sbjct: 14420 GTA----------------LRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIV 14463

Query: 831   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 890
             +  + P    +   L++T + R G ++ + +P +G+P PE+TW KD   + KN+ NI N+
Sbjct: 14464 EREMAPD-FELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIENT 14521

Query: 891   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVAL 950
             E+ T++ I +  R  +GK+ + ++     ++  ++++++D PGP   ++  D+  ++V L
Sbjct: 14522 ESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTL 14581

Query: 951   TWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENM 1010
              W  P  DG + IT Y ++K +     + T     H+ +  +T L  G EY+FRV +EN 
Sbjct: 14582 HWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENE 14641

Query: 1011  CGLSEDATMTK 1021
              G+ E    T+
Sbjct: 14642 YGIGEPTETTE 14652



 Score =  207 bits (527), Expect = 5e-53
 Identities = 119/408 (29%), Positives = 212/408 (51%), Gaps = 24/408 (5%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT++  +   + W  P  DGGS I GYF+E++ K+S  W ++  +  ++T  
Sbjct: 20761 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQ 20820

Query: 680   EPKKMIEGVAYEVRIFAVNAIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             +   + E   Y+ R+ AVNA G    S+PS   +   P+    PP  + +   T +++T+
Sbjct: 20821 KVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITL 20880

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWI-VANKDLIDKTKF 795
              W  P + G + + GYV+E         +Q +E          E+W  V+ K  +  T++
Sbjct: 20881 GWSKPVYDGGSAVTGYVVEI--------RQGEE----------EEWTTVSTKGEVRTTEY 20922

Query: 796   TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 855
              ++ L      + RV AVN AG  EP   ++P+  K+I+E P+I +   L+ + I + GE
Sbjct: 20923 VVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGE 20982

Query: 856   AVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVK 914
              V ++IPF+G+P P +TW+KD   +  + + +I N+++ +++ I +  R+ +GKY L ++
Sbjct: 20983 DVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIE 21042

Query: 915   VD-KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                   +++++ ++++D P   Q ++++ V    V L W PP  DG + I  Y I+K D 
Sbjct: 21043 NGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDA 21102

Query: 974   KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
                 W  V      TS  + +L     ++FRV +EN  G+ E    T+
Sbjct: 21103 TKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTE 21150



 Score =  206 bits (525), Expect = 8e-53
 Identities = 160/599 (26%), Positives = 279/599 (46%), Gaps = 50/599 (8%)

Query: 444   VNLGKEICLKCEI-SENIPGK-WTKNGLPVQESD-RLKVVHKGRIHKLVIANALTEDEGD 500
             V+ G+   L+ +I  + IP   W+K+G  ++E+  R+++    +   LV+ + +  D G 
Sbjct: 18414 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18473

Query: 501   YVFAPDAYNVT--LPAKVHVIDPP-----KIILDGLDAD------NTVTVIAGNKLRLEI 547
             Y+        T  +P  V V+D P      + + G+ A+      N      G  +   I
Sbjct: 18474 YILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYI 18533

Query: 548   PISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE 607
              I      +  W++    +   + ++ T+  P +  +   +A       Y I    E+G 
Sbjct: 18534 -IEKRETSRLSWTQVSTEVQALNYKV-TKLLPGNEYIFRVMAVNK----YGIGEPLESGP 18587

Query: 608   AHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
               A    K    P PP  P V+ +  D  ++ W  P  DGG+ I GY +E++ K+  RW 
Sbjct: 18588 VTACNPYKP---PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18644

Query: 668   RLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVD 727
             + N     +       + EG +YE R+ A NA G+ +PS PS  +       PP   +  
Sbjct: 18645 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP 18704

Query: 728   SVTDT---TVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIV 784
              VTDT   +V++ W  P + G A + GYV+E                EAA    A++W  
Sbjct: 18705 KVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEV--------------KEAA----ADEWTT 18746

Query: 785   ANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 843
                   +   +FT+T L  + +   R+ A+N+ G  EP      ++ +E IEPP+I +  
Sbjct: 18747 CTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDA 18806

Query: 844   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-DGAEIDKNQINIRNSETDTIIFIRKAE 902
              L++  + R    + L +  +G+P PE+ W+K +G   D+ QI + +S   T++ I    
Sbjct: 18807 DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS--FTMLVIDNVT 18864

Query: 903   RSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAA 962
             R  SG+Y+L ++ +   +TA ++++++D P  P  + I +V  ++V L+W PP  DG A 
Sbjct: 18865 RFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAK 18924

Query: 963   ITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
             IT Y ++K +     + T+  +  +T+  I  L  G  YYFRV + N  G+   A  T+
Sbjct: 18925 ITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTE 18983



 Score =  206 bits (524), Expect = 1e-52
 Identities = 159/616 (25%), Positives = 268/616 (43%), Gaps = 73/616 (11%)

Query: 434   KILTPLTDQTVNLGKEICLKCEISENIPG----------KWTKNGLPVQESDRLKVVHKG 483
             K++ P  +  V L + + +K   +   P           KWT +G  ++  +   V    
Sbjct: 11199 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11258

Query: 484   RIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVID---PPKIILDGLDADNTVTVI 538
                 L I N L  D G+Y       A + T+   + V+D   PP   ++ LD        
Sbjct: 11259 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPE---- 11314

Query: 539   AGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAERDD 593
                     + IS +PP     S     I+E     +       S    + L I   ++  
Sbjct: 11315 -------HMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 11367

Query: 594   SGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
               V+ +  +N+ G     ++  ++       P PP  P VT++ ++   ++W  P  DGG
Sbjct: 11368 EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGG 11427

Query: 649   SPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             SPI GY++ER++  + +W+R+N     +  F    + EG  YE R+FA N  G+SKPS  
Sbjct: 11428 SPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 11486

Query: 709   SRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
             S P     P+    PP    +   +  T  + W  P   G + + GYV+E C +  T+  
Sbjct: 11487 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVE-CQKPGTA-- 11543

Query: 766   QSDENGEAAYDLPAEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYY 824
                             W   NKD LI +  F + GL    +   R+KA N  G  EP+  
Sbjct: 11544 ---------------QWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPREL 11588

Query: 825   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ 884
             ++ ++ K+I+ PP++ +    +     RVG+ + ++   +G+P P++TW K+G      +
Sbjct: 11589 AESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG------K 11642

Query: 885   INIRNSETDTI-------IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI 937
             + +R    D I       + I++A R+  GKY +  K        S  + ++DRPGP Q 
Sbjct: 11643 VLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQN 11702

Query: 938   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVI 997
             +K+ +V  EN  ++W  P D+G + IT + ++        W  V     +       L+ 
Sbjct: 11703 LKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIK-ANLLA 11761

Query: 998   GNEYYFRVFSENMCGL 1013
              NEYYFRV +EN  G+
Sbjct: 11762 NNEYYFRVCAENKVGV 11777



 Score =  204 bits (520), Expect = 3e-52
 Identities = 127/423 (30%), Positives = 206/423 (48%), Gaps = 36/423 (8%)

Query: 611  SIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
            S KV + D    P PP  P V        +++W PP  +GGSPI GY++E++++ S  W 
Sbjct: 9282 SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWS 9341

Query: 668  RLNFDLC-----KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
            R++         K   F   +++EGV Y+ R  A+NA GI  PS PS P V   P+    
Sbjct: 9342 RVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPG 9401

Query: 720  PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
            PP+   V   T +++++ W+PP   G + + GY++E   EG+T  K+ +E  +       
Sbjct: 9402 PPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDK------- 9454

Query: 780  EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 839
                     LI   +  +  L    K   RVKAVN AG SEP   +  I   +I E P++
Sbjct: 9455 ---------LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEV 9505

Query: 840  RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWK---------KDGAEIDKNQINIRNS 890
             I    +   + + G  + +    +G+P P+ +W+         KDG         +  +
Sbjct: 9506 FIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETA 9565

Query: 891  ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVAL 950
            E  ++I I + +RSH+GKY +  K     +TA+  ++++D PGPP+ +K+ D+   +  L
Sbjct: 9566 ENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRL 9625

Query: 951  TWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENM 1010
            +W  P DDG   I GY I+K       W  V      T+  + +L+   +Y+FRV +EN 
Sbjct: 9626 SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENR 9685

Query: 1011 CGL 1013
             G+
Sbjct: 9686 FGI 9688



 Score =  204 bits (518), Expect = 5e-52
 Identities = 146/522 (27%), Positives = 236/522 (45%), Gaps = 39/522 (7%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            +PP + LD +     + ++AG  LR+   ++G P P  +W++ +  +     R+  ++  
Sbjct: 8795 EPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL--DKDRVVIDNVG 8851

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              S L+I  A R D G Y I   N  G   A+ +V+V D P P +           C++N
Sbjct: 8852 TKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLN 8911

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W  P  DGGS I G+ IERK  +   W R   +  + +  +   ++EG  Y+ R+ A N 
Sbjct: 8912 WSDPEDDGGSEITGFIIERKDAKMHTW-RQPIE-TERSKCDITGLLEGQEYKFRVIAKNK 8969

Query: 700  IGISKPSM--PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P    P     PL   + P  LT    T +T+T+ W+ P   G + + GY++E  
Sbjct: 8970 FGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIE-- 9027

Query: 758  FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                          +  +D P  D+   NK L   T F +  L        RVKAVN  G
Sbjct: 9028 --------------KRRHDKP--DFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIG 9071

Query: 818  ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELTWKKD 876
             SEP      +++++   PP I++   ++   I+ + GE V++     G P P++ W K+
Sbjct: 9072 ESEPS-LPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKN 9130

Query: 877  GAEIDK-------NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
               I+K        +  +  SE  T + I KA R   G Y +           ++ +++ 
Sbjct: 9131 ETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVY 9190

Query: 930  DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHR 987
            DRP PP+ + + D+  E+  LTW  P D+G + IT Y I K D  +K  EW  V      
Sbjct: 9191 DRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE 9250

Query: 988  TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
                I +L+   +Y FRV + N  G+S++    K   V+ +D
Sbjct: 9251 KRYGIWKLIPNGQYEFRVRAVNKYGISDEC---KSDKVVIQD 9289



 Score =  203 bits (516), Expect = 9e-52
 Identities = 164/613 (26%), Positives = 270/613 (44%), Gaps = 62/613 (10%)

Query: 443   TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T+  G ++ L   +      K  WTK    +   +++ + + G+    VI      D G 
Sbjct: 22753 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGK 22812

Query: 501   YVFAPDAYNVT--LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP---- 554
             Y       + T  +   V V+D P     G     TV+ +   K  L   +  E      
Sbjct: 22813 YTLTVKNASGTKAVSVMVKVLDSP-----GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 22867

Query: 555   -----PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                   +   SR +  I+EG     T SY      V+    +++  ++ +   N+ G   
Sbjct: 22868 THYIVERRETSRLNWVIVEGE--CPTLSY------VVTRLIKNNEYIFRVRAVNKYGPGV 22919

Query: 607   --EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
               E+   +       P PP  P     G +  I+ W  P  DGG+ I  Y +++++K+S 
Sbjct: 22920 PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSL 22979

Query: 665   RWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTS 719
             RW R+N D +  +T  +   ++EG  Y+ R+ AVNA G S+PS  S  F+    P     
Sbjct: 22980 RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASN-FISCREPSYTPG 23038

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
             PP+   V   T  ++++ W  P + G   + GYVLE         K +D+          
Sbjct: 23039 PPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEM------QEKDTDQ---------- 23082

Query: 780   EDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
               W  V     I  T+FT+  L    K   RV AVN  G SE       I   E IE P 
Sbjct: 23083 --WYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD 23140

Query: 839   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFI 898
             + +   LK+T   R G ++ L++   G+P P +TW K G ++    I I  +E+ +++ +
Sbjct: 23141 LELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSLLIV 23199

Query: 899   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 958
              K  R  +GKY ++ +     ++A++ +++ D PGP   VK+++V  ++V +TW  P  D
Sbjct: 23200 DKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTID 23259

Query: 959   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE--- 1015
             G A +  Y ++K +     + TV     +T   I+ LV G  YYFRV  EN+ G+ E   
Sbjct: 23260 GGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE 23319

Query: 1016  --DATMTKESAVI 1026
               DA +  E  ++
Sbjct: 23320 TSDAVLVSEVPLV 23332



 Score =  201 bits (512), Expect = 3e-51
 Identities = 157/613 (25%), Positives = 280/613 (45%), Gaps = 46/613 (7%)

Query: 420   GQSSAKLSVDLKPLKILTPLTDQ-TVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDR 476
             G  +AK  V+L  + +     D   VN G+   L+ ++  + +P  +W +    ++ES R
Sbjct: 17307 GPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESAR 17366

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNT 534
              ++ +      L++ +A+  D G Y+      A + + P  V V+D P       +    
Sbjct: 17367 CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQ 17422

Query: 535   VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIA 589
             VT +   K  L    +  PP +   S     ++E     R       S   +++L +   
Sbjct: 17423 VTGVTSEKCSL----TWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKL 17478

Query: 590   ERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPA 644
                +  V+ I   N+   GE   S  V + +    P PP +  VT +  D   + W  P 
Sbjct: 17479 LEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPD 17538

Query: 645   YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
              DGGS I+GY +E++ +   RW++ N     +       + E   YE R+ A NA G+ +
Sbjct: 17539 SDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGE 17598

Query: 705   PSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             PS  +   +   P+    PPT   +   T  ++T+ W  P + G + + GYV+E C    
Sbjct: 17599 PSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEIC---- 17654

Query: 762   TSAKQSDENGEAAYDLPAEDW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                 ++DE          E+W IV  +  +  T+F I+ L    +  +RV A+N  G  E
Sbjct: 17655 ----KADE----------EEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGE 17700

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
                    +  ++ +E P++ +   L++  + R G +  + IPF+G+P PE+TW ++  E 
Sbjct: 17701 ATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEF 17760

Query: 881   DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKI 940
               +++ I      T + I   +R+ +GKY L+++     ++A + ++++D PGPPQ + +
Sbjct: 17761 T-DKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAV 17819

Query: 941   EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 1000
             ++V  ++  L W PP  DG A +  Y I K +     +  V     +TS  +  L  G  
Sbjct: 17820 KEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAI 17879

Query: 1001  YYFRVFSENMCGL 1013
             YYFRV +EN  G+
Sbjct: 17880 YYFRVMAENEFGV 17892



 Score =  201 bits (510), Expect = 4e-51
 Identities = 139/497 (27%), Positives = 230/497 (46%), Gaps = 32/497 (6%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P  P  P V  V  +   + WE P +DGGS I+GY++E+K++ +  W++ N   C E  +
Sbjct: 22536 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 22595

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   ++EG+ Y+ R +A+NA G+SK S  SRP +       P    V  VT +TV++ W 
Sbjct: 22596 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 22655

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P + G + + GY++E         K   E G+         W+  N  ++    FT+T 
Sbjct: 22656 APAYDGGSKVVGYIIE--------RKPVSEVGDGR-------WLKCNYTIVSDNFFTVTA 22700

Query: 800   LPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAV 857
             L        RV A NAAG  S+    + P+  ++   PPK  +   L    +  R G  +
Sbjct: 22701 LSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDL 22760

Query: 858   NLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVD 916
              L     GKP P++ W K   E+D   +++++ +       I+  +RS SGKY L VK  
Sbjct: 22761 VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 22820

Query: 917   KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                +  S+ ++++D PGP   + +  V  E   L W+ P++DG A IT Y +++ +   +
Sbjct: 22821 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 22880

Query: 977   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
              W  V       S  +T L+  NEY FRV + N  G        +   ++AR+     +P
Sbjct: 22881 NWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYG---PGVPVESEPIVARNSFTIPSP 22937

Query: 1037  --VYEDFDFSEAPM---FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDD 1090
               + E+    +  +   +T+P  +     G N   N  V    K  + W + NK  +V D
Sbjct: 22938 PGIPEEVGTGKEHIIIQWTKPESD-----GGNEISNYLVDKREKKSLRWTRVNKDYVVYD 22992

Query: 1091  PRYRMFSNQGVCTLEIR 1107
              R ++ S    C  + R
Sbjct: 22993 TRLKVTSLMEGCDYQFR 23009



 Score =  196 bits (497), Expect = 1e-49
 Identities = 219/924 (23%), Positives = 366/924 (39%), Gaps = 131/924 (14%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +   V F  E+     + KW++N + I  S+KYI   K     L I +  + D + Y
Sbjct: 6345 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6404

Query: 323  YVTAGDE-----KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKN 377
             V+  +      K +  L V E  + + + L+D      + V   C+V+  +  +KW KN
Sbjct: 6405 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 6464

Query: 378  GEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILT 437
            GEE+    +  YR  V+  KH+L I+     D  EY V     +S A+L +   P + + 
Sbjct: 6465 GEEVPFDNRVSYR--VDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 6522

Query: 438  PLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTE 496
             L DQTV    +    C++S E    KW +NG  ++E  + K    G IH+L+I +   +
Sbjct: 6523 HLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLD 6582

Query: 497  DEGDYVFAPD-----AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISG 551
            DE +Y    +     A        V +I PP+ IL+   AD  V +   NK ++E+    
Sbjct: 6583 DECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD-VVFLAELNKDKVEV---- 6637

Query: 552  EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                   W R +  +++G               + DI  RD  G Y    K++  EA A 
Sbjct: 6638 ------QWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQ-GEYRFIAKDK--EARAK 6688

Query: 612  IKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF-IERKKKQSSRWMRLN 670
            +++          AP +     D  +        D G P+      +   K  + W + N
Sbjct: 6689 LELAA--------APKIKTADQDLVV--------DVGKPLTMVVPYDAYPKAEAEWFKEN 6732

Query: 671  FDL--------CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPT 722
              L         ++T+F   +  +G     +I   N  G ++  +  +    + V  P  
Sbjct: 6733 EPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV---IDVPGPVR 6789

Query: 723  LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDW 782
             L V    D  V++ W  P   G + + GYV+E                    D+  + W
Sbjct: 6790 NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVE------------------RRDIKRKTW 6831

Query: 783  IVANKDLIDKTKFTITGLPTDAKIFV-RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRI 841
            ++A  D  +  +FT+TGL      ++ RV A N  G  EP     P+  +   + P    
Sbjct: 6832 VLAT-DRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP---- 6886

Query: 842  PRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD----GAEIDKNQINIRNSET---DT 894
                        G  +N+ I    +    LTW+      GAEI    I +R+  +   DT
Sbjct: 6887 ------------GPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDT 6934

Query: 895  IIFIRKAERS-------HSGKYDLQVKVDKFV-----ETASIDIQI---IDRPGPPQIVK 939
             + +R  + S          +Y  +V+    +       A+  +++   I+RP PP  + 
Sbjct: 6935 AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLT 6994

Query: 940  IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIG 998
              D    +V L W PP  DG + I GY I++ ++    W    ++     +  +T L  G
Sbjct: 6995 SSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKG 7054

Query: 999  NEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYA 1058
            N+Y +RV +EN  G+S+ + +                P+  D  F E  M      +   
Sbjct: 7055 NKYLYRVSAENKAGVSDPSEIL--------------GPLTADDAFVEPTMDLSAFKDGLE 7100

Query: 1059 IAGYNA-TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
            +   N  T+     G P+P  TW      +    R +M +      L I      D G Y
Sbjct: 7101 VIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIY 7160

Query: 1118 CCKAVNDLGTVEIECKLEVKVIAQ 1141
              K  N + T+  E  ++V VIA+
Sbjct: 7161 TLKLENRVKTISGE--IDVNVIAR 7182



 Score =  195 bits (496), Expect = 2e-49
 Identities = 141/519 (27%), Positives = 228/519 (43%), Gaps = 38/519 (7%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP++ LD +   + +TV  G  +R+   + G P P   W++  K ++      R + 
Sbjct: 11597 ILHPPEVELD-VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK---RVDL 11652

Query: 578   YPDSSTLVIDIAE--RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
               D   + + I E  R D G Y I+ KN +G A  S  V V+D P P     VT V  + 
Sbjct: 11653 IQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKEN 11712

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++WE P  +GGS I  + +E +K     W  +  D+ K        ++    Y  R+ 
Sbjct: 11713 CTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYFRVC 11770

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             A N +G+        P +   P+     P  L +     T V ++WR PD+ G +    Y
Sbjct: 11771 AENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSY 11830

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
              +E   +GS                  +DW   +K  I +T + +     +     RV+ 
Sbjct: 11831 HVERRLKGS------------------DDWERVHKGSIKETHYMVDRCVENQIYEFRVQT 11872

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
              N  G S+    ++ ++VKE ++ P + +   L      + G+ + L    +GKP PE+ 
Sbjct: 11873 KNEGGESD-WVKTEEVVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVA 11929

Query: 873   WKKDGAEIDKNQ---INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
             W KD    D  +   + I      +   + KA+RS  GKY +          A   + ++
Sbjct: 11930 WTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVL 11989

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             D+PGP + +KI DV  +   + W PP+DDG   I  Y ++K + K M W T         
Sbjct: 11990 DKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPG 12049

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIAR 1028
              T+T L+ GNEY FRV +EN  G       T+   VIA+
Sbjct: 12050 TTVTRLIEGNEYIFRVRAENKIGTGPP---TESKPVIAK 12085



 Score =  195 bits (495), Expect = 2e-49
 Identities = 123/422 (29%), Positives = 206/422 (48%), Gaps = 28/422 (6%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP A  V +V      + WEPP  DGG PI  Y IE+K++  +RW++       +  F
Sbjct: 7879 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7938

Query: 680  EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTM 736
                +IEG   + ++ A N  G+  PS P+       P +  SPP  L V       + +
Sbjct: 7939 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 7998

Query: 737  RWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFT 796
             W+PP+  G + + GY +E C  G+                  E W+  N   I   KF 
Sbjct: 7999 AWKPPEKNGGSPIIGYHVEMCPVGT------------------EKWMRVNSRPIKDLKFK 8040

Query: 797  IT-GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 855
            +  G+  D +  +RV+AVNA G SEP   S+ ++ K+    P I +  H     I   GE
Sbjct: 8041 VEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGE 8097

Query: 856  AVNLVIPFQGKPRPELTWKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDLQVK 914
             +++ +PF+  P P ++W KDG E+   +++ ++N      + + K+ R+ +G Y + ++
Sbjct: 8098 KLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLE 8157

Query: 915  VDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKK 974
                  TASI++++I  PGP + +K  D+   +  LTW PP+ DG   I  Y +++ +  
Sbjct: 8158 NKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAG 8217

Query: 975  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
               +  V+   ++ S T+ +L+   EY+FRV + N  G  E   +  ++ VIA+D K   
Sbjct: 8218 RRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIEL--KNPVIAQDPKQPP 8275

Query: 1035 NP 1036
            +P
Sbjct: 8276 DP 8277



 Score =  194 bits (493), Expect = 4e-49
 Identities = 148/575 (25%), Positives = 258/575 (44%), Gaps = 49/575 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVI 519
             W K+G+ +++   +++        L + +A  +  G  V+  +A N +  AK    V V 
Sbjct: 21687 WFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG--VYTVEAKNASGSAKAEIKVKVQ 21744

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRL--EIPISGEPPP-------KAMWSRGDKAIMEGS 570
             D P  ++  +   N    I G K+ L  + P++    P       K   SR   A++E  
Sbjct: 21745 DTPGKVVGPIRFTN----ITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIED- 21799

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGV--YHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              +   +SY     +  +  +   S V  + +    ++    A I+  V   PD P  P  
Sbjct: 21800 -KCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTV---PDAPGIPEP 21855

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR-LNFDLCKETTFEPKKMIEG 687
             + +  +   + W  P  DGGS I  Y +ER++K+S+RW++ ++     ET F+   + EG
Sbjct: 21856 SNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEG 21915

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               YE  + A NA G+   S  SR      P+    PPT++ V   + TTV++ W  P   
Sbjct: 21916 NEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFD 21975

Query: 745   GAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDA 804
             G   + GY++E C                       DW   N +   KT++T+T L    
Sbjct: 21976 GGMEIIGYIIEMC------------------KADLGDWHKVNAEACVKTRYTVTDLQAGE 22017

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   RV A+N AG  +    +  I   + +  P++ I  + KQT++ R G ++ L I +Q
Sbjct: 22018 EYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQ 22077

Query: 865   GKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 924
             G+P P   W K  + +   + +I  +++ + + +    R+ +GKY L V+ +   ++ + 
Sbjct: 22078 GRPTPTAVWSKPDSNLSL-RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITF 22136

Query: 925   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 984
              ++++D PGPP  +  +DV   +  L W  P  DG A I  Y ++K +     W  + E 
Sbjct: 22137 TVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEK 22196

Query: 985   YHRTSATITELVIGNEYYFRVFSENMCGLSEDATM 1019
               R    + +L  G  YYFRV + N  G+ E   M
Sbjct: 22197 CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEM 22231



 Score =  185 bits (470), Expect = 2e-46
 Identities = 172/692 (24%), Positives = 288/692 (41%), Gaps = 92/692 (13%)

Query: 373  KWFKNGEEIIP-----------GPKSRYRIRVEGKKHILIIEGATKA-------DAAEYS 414
            +W +  E ++P           G + ++R+R E    I     AT         DA +  
Sbjct: 8320 RWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI 8379

Query: 415  VMTT-----GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC---------EISENI 460
            + T+     G + +   S+   P   +T + D+ V + +EI  +          E+ E  
Sbjct: 8380 LRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEE 8439

Query: 461  PGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN--VTLPAKVHV 518
            P       LP+ +   +    KG   +L + ++L  D G Y+   +  +     P  V V
Sbjct: 8440 PFV-----LPLTQRLSIDNSKKGE-SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8493

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
            +D P   ++ +  D   T +             EPP       G   I+  +   + ++ 
Sbjct: 8494 LDTPGPPINFVFEDIRKTSVL---------CKWEPP----LDDGGSEIINYTLEKKDKTK 8540

Query: 579  PDSSTLVIDIAERD-----------DSGVYHINLKNEAGEAHASIKVKVVDF-----PDP 622
            PDS  +V+    R               ++ +  +N  G     +   +V       PD 
Sbjct: 8541 PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDA 8600

Query: 623  PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPK 682
            P  P V +V  +  ++ W  P  D GSPILGY++E+++  S+ W R+N  L         
Sbjct: 8601 PDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVD 8659

Query: 683  KMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP--PTLLTVDSVTDTTVTMRWRP 740
             ++EG+ Y  R+ A NA G  K S PS P       SP  P +  V   + TT+ + W P
Sbjct: 8660 GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEP 8719

Query: 741  PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
            P   G   + GY ++    G+                   +W    + +I   ++T+  +
Sbjct: 8720 PAFNGGGEIVGYFVDKQLVGT------------------NEWSRCTEKMIKVRQYTVKEI 8761

Query: 801  PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
               A   +RV AVNAAG   P   +QP+ V E  EPP + +   +K       G+ + + 
Sbjct: 8762 REGADYKLRVSAVNAAGEGPPG-ETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIP 8820

Query: 861  IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
                G+P P   W K+  E+DK+++ I N  T + + I+ A R   G+Y +        +
Sbjct: 8821 AVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSK 8880

Query: 921  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 980
             A+  +++ D PGP   +K      +   L W+ P+DDG + ITG+ I++ D K   W  
Sbjct: 8881 FAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ 8940

Query: 981  VIEHYHRTSATITELVIGNEYYFRVFSENMCG 1012
             IE   R+   IT L+ G EY FRV ++N  G
Sbjct: 8941 PIE-TERSKCDITGLLEGQEYKFRVIAKNKFG 8971



 Score =  184 bits (467), Expect = 4e-46
 Identities = 177/720 (24%), Positives = 313/720 (43%), Gaps = 79/720 (10%)

Query: 344   VTKQLEDTTAYCGERVELECE-VSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
             + K+++D T   GE  +L C+ V     ++KW++ G+E+I   K  Y++  +G+ H L +
Sbjct: 24230 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRK--YKMSSDGRTHTLTV 24287

Query: 403   EGATKADAAEYSVMTTGG----QSSAKLSVDLKP-LKILTPLTDQTVN-LGKEICLKCE- 455
                 + D   Y+ + T      ++S+KL +   P      PL ++    +G  + L    
Sbjct: 24288 MTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMY 24347

Query: 456   ISENIPGK-WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
             I   +P   W      +Q S+ + + +      LV+ N   +           Y V L  
Sbjct: 24348 IGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAG------KYKVQLSN 24401

Query: 515   KVHVIDPPKIILDGLDADN----TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME-- 568
                 +D    ILD    D     T  ++    L+    IS +PP     S     ++E  
Sbjct: 24402 VFGTVDA---ILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKC 24458

Query: 569   -----GSGRIRTESYPDSSTLVIDIAERDDSGVY-HINLKNEAG-----EAHASIKVKV- 616
                     ++ + +   ++  ++++ E  ++G Y  ++ +N  G     E  + + +K  
Sbjct: 24459 EAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 24516

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
              + P  P  PT+T V  D C++ W+PPA DGG+ I  Y++E+++K+ ++W+ +  +  +E
Sbjct: 24517 FEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 24576

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             T F  K +IEG+ YE R+   N  G S+ S  S P  P +          + + +  V  
Sbjct: 24577 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRY 24636

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEG----STSAKQSDENGEAAYDLPAEDWIVANKDLIDK 792
             +          G    ++++  +G    +   K   +  +  Y                 
Sbjct: 24637 QSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYH---------------- 24680

Query: 793   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 852
              +  I  +  D     +V+A N  G+             E+  P KI +P+ L+      
Sbjct: 24681 -QLIIASVTDDDATVYQVRATNQGGSVSGT------ASLEVEVPAKIHLPKTLEGMGAVH 24733

Query: 853   V--GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSG 907
                GE V++ IPF GKP P +TW+K    ID N   Q+ +  S T +++F    ER  +G
Sbjct: 24734 ALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFT-SLVFPNGVERKDAG 24792

Query: 908   KYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYT 967
              Y +  K    ++  ++++ + D P PP+ VK+ DV  ++V LTWT P  DG + IT Y 
Sbjct: 24793 FYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYI 24852

Query: 968   IQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKE 1022
             ++K    +  W  V      T  T+  L     Y FRV +EN  GLS+     + T+TKE
Sbjct: 24853 VEKCATTAERWLRV-GQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 24911



 Score =  169 bits (427), Expect = 2e-41
 Identities = 165/704 (23%), Positives = 284/704 (40%), Gaps = 93/704 (13%)

Query: 350  DTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
            D    CGE V E + EV+  +   KW+             YR++   +      +GA+K 
Sbjct: 7327 DKWVACGEPVAETKMEVTGLEEG-KWYA------------YRVKALNR------QGASKP 7367

Query: 409  DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTK 466
                  +     Q + ++ +D+K L  LT      V  G +I L   ++     K  WTK
Sbjct: 7368 SRPTEEIQAVDTQEAPEIFLDVKLLAGLT------VKAGTKIELPATVTGKPEPKITWTK 7421

Query: 467  NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHVIDP- 521
              + +++  R+ + +  +   + I ++   D G Y+   +A NV    T   +V+V+D  
Sbjct: 7422 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII--EAVNVCGRATAVVEVNVLDKP 7479

Query: 522  -PKIILDGLDADNTVTVIAGNKLR-------LEIPISGEPPPKAMWSRGDKAIMEGSGRI 573
             P    D  D  N   ++  N  R           +        +W +    + + + + 
Sbjct: 7480 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFK- 7538

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             T+  P+   +    AE     +Y +    +A    A  +    D P PP     +++  
Sbjct: 7539 ATKLIPNKEYIFRVAAE----NMYGVGEPVQASPITAKYQ---FDPPGPPTRLEPSDITK 7591

Query: 634  DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
            D   + W  P  DGGSPI GY++ER    + +W+R N    K+TT+  K +     Y  R
Sbjct: 7592 DAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFR 7651

Query: 694  IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
            + A N  G  KPS  + P +   P+    PP   TV  V  T+V + W  P+H G A ++
Sbjct: 7652 VLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE 7711

Query: 751  GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 810
             YV+E    G+                  ++W+   +  +  T+  + GL    +   RV
Sbjct: 7712 SYVIEMLKTGT------------------DEWVRVAEG-VPTTQHLLPGLMEGQEYSFRV 7752

Query: 811  KAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP- 869
            +AVN AG SEP   S P+L +E + PP    PR L+   I +    +   +P +    P 
Sbjct: 7753 RAVNKAGESEPSEPSDPVLCREKLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPI 7810

Query: 870  -----------ELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 918
                          W+     +   +  +      ++   R A  +  G+ D        
Sbjct: 7811 TNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTE----- 7865

Query: 919  VETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEW 978
            +E + +       PGPP  + + DV   +V L W PPK+DG   I  Y I+K ++    W
Sbjct: 7866 IEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRW 7925

Query: 979  FTVIEHY-HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
                +      +  +T+++ G E  F+V +EN  G+   +  T+
Sbjct: 7926 VKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTE 7969



 Score =  162 bits (411), Expect = 1e-39
 Identities = 110/364 (30%), Positives = 175/364 (48%), Gaps = 16/364 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V  G    F  EL+   + V+WY  G+++ PS K +   +G    L + + ++ D  E  
Sbjct: 5902 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 5961

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
            +TA D K    LFV+EPP+  TK LED T   G    LECEVS ++A VKWFKNG EI+ 
Sbjct: 5962 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 6021

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
              K  Y I  +G+   L+I   T  D   Y+      ++S  L+V    ++ L PLTD  
Sbjct: 6022 SKK--YEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ 6079

Query: 444  VNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V   +    +CE+S EN   KW K+G  +++  +  ++ KG +  LVI   L +DE +Y 
Sbjct: 6080 VREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY- 6138

Query: 503  FAPDAYNVTLPAKVHVIDPPKII---LDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
             + +         + V++   +    L  ++   T T+    KL  E+    +P  + +W
Sbjct: 6139 -SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTI----KLVCEV---SKPGAEVIW 6190

Query: 560  SRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
             +GD+ I+E +GR    +      LVI  A  +D+G Y+  L +   +    +     +F
Sbjct: 6191 YKGDEEIIE-TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEF 6249

Query: 620  PDPP 623
               P
Sbjct: 6250 ISKP 6253



 Score =  152 bits (383), Expect = 2e-36
 Identities = 107/326 (32%), Positives = 162/326 (49%), Gaps = 37/326 (11%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +DPP+I +D    D T+ V AG   +++  I G+P P   W +GD+ +   + R+  +S 
Sbjct: 16233 VDPPRISMDPKYKD-TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKST 16290

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV-TEVGDDWCI 637
               +++L +  A R DSG Y +  KN AGE   ++ VKV+D P PP  P V + V  + C 
Sbjct: 16291 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCT 16350

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL----CKETTFEPKKMIEGVAYEVR 693
             + W+PP  DGGS I+ Y +ER++     W  ++ ++    CK T     K++EG  Y  R
Sbjct: 16351 LAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVT-----KLLEGNEYTFR 16405

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             I AVN  G+ +P + S P V   P  V   P    V +VT  ++ + W  P   G + + 
Sbjct: 16406 IMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEIL 16464

Query: 751   GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 810
             GYVLE          + D+ G          W   +K LI + +  +TGL  +     RV
Sbjct: 16465 GYVLE----------KRDKEGIR--------WTRCHKRLIGELRLRVTGLIENHDYEFRV 16506

Query: 811   KAVNAAGASEPKYYSQPILVKEIIEP 836
              A NAAG SEP   S P   ++  +P
Sbjct: 16507 SAENAAGLSEP---SPPSAYQKACDP 16529



 Score =  150 bits (379), Expect = 7e-36
 Identities = 100/328 (30%), Positives = 160/328 (48%), Gaps = 26/328 (7%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P++ L G+     V   AG+ +++EIP+ G P P   W +GD+ I++ + R+  E+   S
Sbjct: 14758 PELDLRGI-YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQ-ILKQTQRVNFETTATS 14815

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             + L I+   R DSG Y +  +N  GE    I ++V D P PP  P    EV  D+   +W
Sbjct: 14816 TILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSW 14875

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGG PI  Y +E ++  S+ W+ L   + + TT++  ++  G+ Y+ R+ A N  
Sbjct: 14876 DPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRY 14934

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+  P + S   V   P  V  PP    V +VT  ++T+ W  P   G + + GY +E  
Sbjct: 14935 GVG-PGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVE-- 14991

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                     + + NG          W   +K L+    F  +GL        RV A N AG
Sbjct: 14992 --------RKERNGIL--------WQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAG 15035

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHL 845
              S+P   S+P+L  + I+PP   +P ++
Sbjct: 15036 KSKPSKPSEPMLALDPIDPPGKPVPLNI 15063



 Score =  150 bits (379), Expect = 7e-36
 Identities = 103/337 (30%), Positives = 165/337 (48%), Gaps = 25/337 (7%)

Query: 506   DAYNVTLPAKV-HVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D   + LP  +   ++PP+I +    + +TV V AG+ L+++IPISG+P PK   SR D 
Sbjct: 20152 DPRELLLPVLIKEQLEPPEIDMKNFPS-HTVYVRAGSNLKVDIPISGKPLPKVTLSR-DG 20209

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R  TE   ++ T+ +  +   D+G Y I   N +G   A I + V+D P PP 
Sbjct: 20210 VPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPT 20269

Query: 625   APTV-TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P V +++ ++   + WEPP YDGGS +  Y + +++  ++ W  ++  + + T  +  K
Sbjct: 20270 GPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVAR-TMMKVMK 20328

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  GIS    S      +P     PP+   V +VT  ++T+ W  P
Sbjct: 20329 LTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 20388

Query: 742   DHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
                G + + GY LE            D N           W  ANK +I  T F +T + 
Sbjct: 20389 VSNGGSAVVGYHLE----------MKDRNSIL--------WQKANKLVIRTTHFKVTTIS 20430

Query: 802   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
                    RV A NAAG  +P + S+P+L  +  EPP+
Sbjct: 20431 AGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPR 20467



 Score =  149 bits (377), Expect = 1e-35
 Identities = 148/568 (26%), Positives = 234/568 (41%), Gaps = 60/568 (10%)

Query: 360   ELEC-EVSEDDANVKWFK----NGEEII-----------PGPKSRYRIRVEGKKHILIIE 403
             ELE   +S+D   ++W K     G+EI+              K   + R++ K+    I 
Sbjct: 24131 ELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ--FTIG 24188

Query: 404   GATKADAAEYSVMT---TGGQSSAKLSVDLKPLK-------ILTPLTDQTVNLGKEICLK 453
             G  +A   E+ V     TG     + ++ +K          I   + D T  LG+   L 
Sbjct: 24189 GLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLS 24248

Query: 454   CEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYN 509
             C+I    +P  KW + G  + +S + K+   GR H L +     EDEG Y  +   +   
Sbjct: 24249 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 24308

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             V   +K+ +   P+    G           G+ LRL +   G P P   W  G K +++ 
Sbjct: 24309 VETSSKLLLQATPQFH-PGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK-LLQN 24366

Query: 570   SGRIRTESYPDSSTLVI-DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
             S  I  E+    + LV+ ++  +  +G Y + L N  G   A + V++ D PD P  P V
Sbjct: 24367 SENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV 24426

Query: 629   TE-VGDDWCIMNWEPPAYDGGSPILGYFIER-KKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              E +  +  +++W+PPA DGGS I  Y +E+ + K+ + W +L       TT     + E
Sbjct: 24427 IEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEW-QLVSSAISVTTCRIVNLTE 24485

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
                Y  R+ A N  GIS P   S   +   P      P   T+ +VT  +  + W+PP  
Sbjct: 24486 NAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPAS 24545

Query: 744   IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTD 803
              G A +  Y LE         ++  +N           WI    + I +T F++  L   
Sbjct: 24546 DGGAKIRNYYLE--------KREKKQN----------KWISVTTEEIRETVFSVKNLIEG 24587

Query: 804   AKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPF 863
              +   RVK  N  G SE    S+PI  K  +          L+   +R    A  LV   
Sbjct: 24588 LEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNA-TLVCKV 24646

Query: 864   QGKPRPELTWKKDGAEIDKNQINIRNSE 891
              G P+P + W + G EI  + +  R  E
Sbjct: 24647 TGHPKPIVKWYRQGKEIIADGLKYRIQE 24674



 Score =  148 bits (373), Expect = 3e-35
 Identities = 104/358 (29%), Positives = 163/358 (45%), Gaps = 33/358 (9%)

Query: 491   ANALTEDEGDYVFAPDAYNVT---LPAKVHVIDPPKIILDGLDA----DNTVTVIAGNKL 543
             A  LTE + +Y F   A N      P+++ V+    ++   LD     D        +  
Sbjct: 13637 AKDLTEGK-EYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF 13695

Query: 544   RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN 603
             RL+IPI G+P P   W +G+  +   + R+  ES   ++TL++   ++ D+G Y I LKN
Sbjct: 13696 RLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKN 13754

Query: 604   EAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
              AG    +I +KVV  P  P  P    EV  +   + W PP  DGGS I  Y +E++   
Sbjct: 13755 VAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSV 13814

Query: 663   SSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             +++W+       ++TTF   ++ EG+ Y  R+ A N  G+ +  + S P V   P  V  
Sbjct: 13815 NNKWVTCA-SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPD 13872

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
              P    +  V   +V++ W  P   G + + GY LE+    S                  
Sbjct: 13873 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL---------------- 13916

Query: 780   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 837
               W  ANK  I    F +TGL    +   RV A+N AG  +P   S+P++  + I+PP
Sbjct: 13917 --WKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 13972



 Score =  145 bits (365), Expect = 3e-34
 Identities = 110/374 (29%), Positives = 173/374 (46%), Gaps = 19/374 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            QV +    RF  EL+    +VKW+K+G EI+   KY    KG  RIL IN C + D++EY
Sbjct: 6079 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6138

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII 382
                   + S  L V E   + TK L +      + ++L CEVS+  A V W+K  EEII
Sbjct: 6139 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 6198

Query: 383  PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 442
                 RY I  EG+K IL+I+ A   DA  Y+      ++  K+ V     + ++   + 
Sbjct: 6199 --ETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL 6256

Query: 443  TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             +  G++    C IS E+ P +W ++   ++  D+  V+  G+   LV+ +A  +D G Y
Sbjct: 6257 EILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTY 6316

Query: 502  VF----APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKA 557
            V     A  A ++T+  K+ ++ P K        D  V          E+   G    KA
Sbjct: 6317 VVMVGAARAAAHLTVIEKLRIVVPLK--------DTRVKEQQEVVFNCEVNTEG---AKA 6365

Query: 558  MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV 617
             W R ++AI + S  I  +      TL I  A  DD   Y+++L N  GE   S    +V
Sbjct: 6366 KWFRNEEAIFDSSKYIILQK-DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV 6424

Query: 618  DFPDPPVAPTVTEV 631
            +  D  +   + ++
Sbjct: 6425 EEEDLRIVEPLKDI 6438



 Score =  143 bits (360), Expect = 1e-33
 Identities = 99/322 (30%), Positives = 145/322 (45%), Gaps = 23/322 (7%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ID P   LD    D  + V AG    LE  I G+P P  +WS+  K + E + R+  +S 
Sbjct: 18397 IDAPNASLDPKYKD-VIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 18455

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCI 637
                +TLV+    R D G Y + L N  G     I VKV+D P PP  P  VT V  + C 
Sbjct: 18456 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 18515

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + W PP  DGG+ I  Y IE+++     W +++ ++ +   ++  K++ G  Y  R+ AV
Sbjct: 18516 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAV 18574

Query: 698   NAIGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             N  GI +P  S P     P     PP+   V ++T  ++ + W  P   G   ++GY+LE
Sbjct: 18575 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILE 18634

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
                       + D+ G          W   NK  +   +  +TGL        RV A NA
Sbjct: 18635 ----------KRDKEGVR--------WTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENA 18676

Query: 816   AGASEPKYYSQPILVKEIIEPP 837
             AG  EP   S      + + PP
Sbjct: 18677 AGVGEPSEPSVFYRACDALYPP 18698



 Score =  140 bits (352), Expect = 9e-33
 Identities = 97/357 (27%), Positives = 171/357 (47%), Gaps = 39/357 (10%)

Query: 496   EDEGDYVF---APDAYNVTLPAK----VHVID---PPKIILDGLDADNTVTVIAGNKLRL 545
             E++  Y F   A  A N++ P++    V ++    PP+I L  +   + +TV AG  + L
Sbjct: 12952 EEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS-VAMKSLLTVKAGTNVCL 13010

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
             +  + G+P P   W + D  +++ +  I+     +  TL +    R DSG Y I  +N +
Sbjct: 13011 DATVFGKPMPTVSWKK-DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSS 13069

Query: 606   GEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSR 665
             G   A+IK+KV+D P PP +  + ++  D  +++WEPP  DGGS I  Y +++++     
Sbjct: 13070 GSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPN 13129

Query: 666   WMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGI-----SKPSMPSRPFVPLAVTSP 720
             W +++  +   T+   +K+IEG  Y+ RI A N  G+     ++P++   P+ P     P
Sbjct: 13130 WAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 13188

Query: 721   PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE 780
             P    + ++T   +T+ W+PP   G + + GY+LE                    +  A 
Sbjct: 13189 P---VISNITKDHMTVSWKPPADDGGSPITGYLLE------------------KRETQAV 13227

Query: 781   DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 837
             +W   N+  I +     TGL    +   RV A+N AG  +P   S+    ++   PP
Sbjct: 13228 NWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP 13284



 Score =  139 bits (350), Expect = 2e-32
 Identities = 112/414 (27%), Positives = 188/414 (45%), Gaps = 21/414 (5%)

Query: 270  VRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDE 329
            + F V +    +  KW KNG EI+ + K     K     L I N    D ++Y   AG  
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 330  KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRY 389
              +  L+V    I   K ++D      +R   ECEVSE D  V+W K+ +E+      R 
Sbjct: 3000 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRI 3057

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
            +I+ E   H L+I     +DA +Y+V+  G  S+AKL V+ + ++I +   +  V   + 
Sbjct: 3058 KIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3117

Query: 450  ICLKCEISE-NIPGKWTKNGLPV--QESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD 506
              ++ E++E ++   W K+G+ +  Q  +R K V + RIH++ I+     D G+Y F   
Sbjct: 3118 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3177

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                ++   V+  +PP++    L     VTV +G   R    ISG P PK  W + ++ +
Sbjct: 3178 RNRSSVTLYVNAPEPPQV----LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL 3233

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG----EAHASIKVKVVDFPD- 621
              G  + +        TL++  A  +D+ VY    KN+ G     A  S++V  V  PD 
Sbjct: 3234 STGF-KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3292

Query: 622  --PPVAPTVTEVGDDWCIMNWEPPAY----DGGSPILGYFIERKKKQSSRWMRL 669
              P   P +     D      +P  +     G    + ++ + KK + SR+ R+
Sbjct: 3293 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3346



 Score =  137 bits (344), Expect = 8e-32
 Identities = 104/360 (28%), Positives = 172/360 (47%), Gaps = 10/360 (2%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F VEL+   + VKW+KN Q +  +     + +G    +   +  + D S+  V A     
Sbjct: 5643 FTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSS 5702

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +L V E     T +L+D T    + V L+CE+S+ DA VKWFK+G+EI P   +   I
Sbjct: 5703 EAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNA--VI 5760

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
            + +GKK +LI++ A K+D  +Y+      ++S KL ++ + +K++ PL    V   +   
Sbjct: 5761 KADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETAR 5820

Query: 452  LKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
             + EISE +I   W   G  + ++   ++  +G+IH LV+ N   +  G   F   A NV
Sbjct: 5821 FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANV 5878

Query: 511  TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
               A + V   P++I   L     VTV AG     +  +S E  P   + +G K  +E S
Sbjct: 5879 KSSAHLRV--KPRVI-GLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKK--LEPS 5933

Query: 571  GRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             ++   S     TL +   + +D+G   +  K+    A+  +K   V+F  P    TV E
Sbjct: 5934 DKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEE 5993



 Score =  137 bits (344), Expect = 8e-32
 Identities = 134/554 (24%), Positives = 209/554 (37%), Gaps = 88/554 (15%)

Query: 617  VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
            +D P PP  PTV +VG     +NW  P +DGG+ I  Y IE  K  +  W+R+   +   
Sbjct: 7676 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTT 7735

Query: 677  TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTT 733
                P  M EG  Y  R+ AVN  G S+PS PS P +    L   SPP  L V ++T  T
Sbjct: 7736 QHLLPGLM-EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 7794

Query: 734  VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKT 793
              ++W  P+  G + +  Y++E                    D+  + W   +  + D T
Sbjct: 7795 ADLKWTVPEKDGGSPITNYIVE------------------KRDVRRKGWQTVDTTVKD-T 7835

Query: 794  KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 853
            K T+T L   +    RV A NA G S+       +L K+    P                
Sbjct: 7836 KCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTP---------------- 7879

Query: 854  GEAVNLVIPFQGKPRPELTW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYD 910
            G    L +    K   +L W   K DG    +  +  +     T    R  +   +   D
Sbjct: 7880 GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGT----RWVKAGKTAGPD 7935

Query: 911  LQVKVDKFVETASIDIQI-----------------------IDRPGPPQIVKIEDVWGEN 947
               +V   +E   +  Q+                          P PP  + + D   ++
Sbjct: 7936 CNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKH 7995

Query: 948  VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE--LVIGNEYYFRV 1005
            +A+ W PP+ +G + I GY ++     + +W  V     +      E  +V   EY  RV
Sbjct: 7996 IAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRV 8055

Query: 1006 FSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT 1065
             + N  G+SE + +++   V+A+D         E  D                I G   +
Sbjct: 8056 RAVNAIGVSEPSEISEN--VVAKDPDCKPTIDLETHDI-------------IVIEGEKLS 8100

Query: 1066 LNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDL 1125
            +    R  P P ++W K+   +    R  M ++     LE+ K    D G Y     N L
Sbjct: 8101 IPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKL 8160

Query: 1126 GTVEIECKLEVKVI 1139
            G+      + VKVI
Sbjct: 8161 GSA--TASINVKVI 8172



 Score =  136 bits (343), Expect = 1e-31
 Identities = 105/376 (27%), Positives = 169/376 (44%), Gaps = 13/376 (3%)

Query: 247  EEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQ 306
            + K+   F + L      +K     F  E ++P ++VKWYK+G E+    KY        
Sbjct: 2123 QAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKV 2182

Query: 307  RILFINNCQMTDDSEY-YVTAGDE--KCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
              L I     +D  +Y  V   DE  K + +L V    +   K+L+D         ELEC
Sbjct: 2183 HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC 2242

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS 423
             VS ++   KW+ N  E+      +Y I     +  L ++  TK D  EYS +  G +++
Sbjct: 2243 IVSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT 2300

Query: 424  AKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHK 482
             KL +  +P+ IL  L+DQ V  G  + L+ ++S E++ G W K+G  VQ SDR+ +V  
Sbjct: 2301 CKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID 2360

Query: 483  GRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNK 542
             + H L+I +   ED G+Y F   A  ++   +V V       +D +     V VI G K
Sbjct: 2361 KQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-----VDVITPLKDVNVIEGTK 2415

Query: 543  LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
              LE  +S        W   D+ I +   R++         LVI+     D G Y + + 
Sbjct: 2416 AVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2474

Query: 603  NEAGEAHASI-KVKVV 617
                  + S+ K+K++
Sbjct: 2475 RVETNCNLSVEKIKII 2490



 Score =  133 bits (335), Expect = 8e-31
 Identities = 197/836 (23%), Positives = 326/836 (38%), Gaps = 110/836 (13%)

Query: 337   VREPPIMVTKQLEDTTAY-CGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
             V  P I V  + +DT     GE   LE +VS      ++W K+G+E+     ++  I++ 
Sbjct: 15151 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL--EGTAKLEIKIA 15208

Query: 395   GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC 454
                  L+ + +T+ D+  Y++  T     AK   ++K L    P  +  + + +    KC
Sbjct: 15209 DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP-PEGPLAVTEVTSEKC 15267

Query: 455   EISENIP-----GKWTKNGLPVQESDRL---KVVHKGRIHKLVIANALTEDEGDY-VFAP 505
              +S   P      K     +  +E+ RL    V  + ++ KL +   L  +E  + V A 
Sbjct: 15268 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV 15327

Query: 506   DAYNVTLPAKVHVI---------DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             + Y V  P +   +         DPPK        +  VT I  + +   +   G P   
Sbjct: 15328 NKYGVGEPLESEPVLAVNPYGPPDPPK--------NPEVTTITKDSM---VVCWGHPDSD 15376

Query: 557   A-------MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                     +  R DKA      +   ++  D    V  + E  +   + I  +N AG   
Sbjct: 15377 GGSEIINYIVERRDKAGQRWI-KCNKKTLTDLRYKVSGLTEGHEYE-FRIMAENAAGISA 15434

Query: 607   EAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQS 663
              +  S   K  D    P PP  P V +       + W  P YDGGS I GY +E    + 
Sbjct: 15435 PSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEE 15494

Query: 664   SRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM-PSRPFVPLAVTSPP 721
               W  +      K T++    + E   Y++RI+A+N+ G+ +P++ P  P     +  P 
Sbjct: 15495 DEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPE 15554

Query: 722   TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAED 781
               L  D     T+         +   G     +++  +   S  ++     ++Y L    
Sbjct: 15555 IELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTL---- 15610

Query: 782   WIVANKDLIDKTKF--TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII----- 834
              IV N +  D  K+  T+         FV V+ ++  G        Q + VKE+      
Sbjct: 15611 LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPP------QDLKVKEVTKTSVT 15664

Query: 835   ---EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSE 891
                +PP +     +K  YI    E+             + +WK D  +           E
Sbjct: 15665 LTWDPPLLDGGSKIKN-YIVEKRESTRKAYSTVATNCHKTSWKVDQLQ-----------E 15712

Query: 892   TDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALT 951
               +  F   AE  +         +    ETA   ++  +RP PP  + + DV   +V+L+
Sbjct: 15713 GCSYYFRVLAENEYG--------IGLPAETAE-SVKASERPLPPGKITLMDVTRNSVSLS 15763

Query: 952   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMC 1011
             W  P+ DG + I GY ++   K S +W T       T ATIT L+ G EY FRV ++N  
Sbjct: 15764 WEKPEHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFRVSAQNEK 15822

Query: 1012  GLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSV 1070
             G+S+   ++    VIA+D  I              P   + L NT+ + AG +  ++   
Sbjct: 15823 GISDPRQLSVP--VIAKDLVI--------------PPAFKLLFNTFTVLAGEDLKVDVPF 15866

Query: 1071  RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
              G P P +TW K+ V +    R    S +    L I+     D G Y  K  N  G
Sbjct: 15867 IGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG 15922



 Score =  133 bits (335), Expect = 8e-31
 Identities = 89/320 (27%), Positives = 152/320 (47%), Gaps = 26/320 (8%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P   L G+  +  +T  AG+   +++PISG P PK  W   +  + E + R+   +  D 
Sbjct: 22340 PTADLTGI-TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE-TDRVSITTTKDR 22397

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             +TL +  + R DSG Y + L+N AG    S+ V V+  P P   P  V+ V  + C+++W
Sbjct: 22398 TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSW 22457

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P   GG+ I  Y +E+++  ++ W  +N  + K T  +   + + + Y  R+ + N  
Sbjct: 22458 GEPKDGGGTEITNYIVEKRESGTTAWQLVNSSV-KRTQIKVTHLTKYMEYSFRVSSENRF 22516

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+SKP + S P +   P    S PT   V  V+   +++RW  P H G + + GY +E  
Sbjct: 22517 GVSKP-LESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVE-- 22573

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                     + + N           W+  NK    +  + +TGL    +   R  A+NAAG
Sbjct: 22574 --------KKERNTIL--------WVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAG 22617

Query: 818   ASEPKYYSQPILVKEIIEPP 837
              S+    S+PI+ +  ++ P
Sbjct: 22618 VSKASEASRPIMAQNPVDAP 22637



 Score =  131 bits (329), Expect = 4e-30
 Identities = 159/630 (25%), Positives = 262/630 (41%), Gaps = 95/630 (15%)

Query: 267   GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
             GG +R  V +   P  EVKW K   EIR +   I +       L ++N    D  +Y +T
Sbjct: 16652 GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFTSLVLDNVNRYDSGKYTLT 16709

Query: 326   AGDEKCSTELFVR-------EPPI--MVTKQLEDTTAYCGERVELECE-------VSEDD 369
               +   +   FV         PP+   VT+  +D+ +   E   L+         V + +
Sbjct: 16710 LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKRE 16769

Query: 370   ANVKWF--------KNG---EEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
             A  K +        KN    +++  G    +R+  E +  I        A  A+   +  
Sbjct: 16770 ATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI-----GLPAQTADPIKVAE 16824

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESD 475
               Q   K++VD         +T  +V+L     E     +I + I     K+     E  
Sbjct: 16825 VPQPPGKITVD--------DVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA 16876

Query: 476   RLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN-----------VTLPAKVHVIDPPKI 524
             R+K +      + VI N LT+ E +Y+F   A N           V + AK  VI+P   
Sbjct: 16877 RVKSL------QAVITN-LTQGE-EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP--- 16925

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTL 584
               D   A ++ +V  G  L++E+PISG P P   W++ D   ++ + RI      D +TL
Sbjct: 16926 --DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTK-DGLPLKQTTRINVTDSLDLTTL 16982

Query: 585   VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPP 643
              I    +DD G Y I + N  G+  ASI++  +D PDPP  P    +V  +   ++W PP
Sbjct: 16983 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPP 17042

Query: 644   AYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
              Y GG  I  Y ++++   ++ W  ++  + + TT +  K+  G  Y+ RIFA N  G S
Sbjct: 17043 LYTGGCQITNYIVQKRDTTTTVWDVVSATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQS 17101

Query: 704   KPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
               ++ S P V   P     PP      +++  ++ ++W  P + G + + GY LE     
Sbjct: 17102 F-ALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLE----- 17155

Query: 761   STSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                  + + N           W   NK +I  T+F    L    +   RV A N  G  +
Sbjct: 17156 -----RKERNSIL--------WTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGK 17202

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYI 850
                 S+  + ++  +PP    P  +K+  I
Sbjct: 17203 ASKNSECYVARDPCDPPGTPEPIMVKRNEI 17232



 Score =  131 bits (329), Expect = 4e-30
 Identities = 92/316 (29%), Positives = 146/316 (46%), Gaps = 25/316 (7%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PPK  LD     + VT+ AG+ L L+  + G+P PK +W++GDK  ++   ++  +    
Sbjct: 22738 PPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKE-LDLCEKVSLQYTGK 22796

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              +T VI   +R DSG Y + +KN +G    S+ VKV+D P P    TV+ V  + C + W
Sbjct: 22797 RATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAW 22856

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGG+ I  Y +ER++     W+ +  + C   ++   ++I+   Y  R+ AVN  
Sbjct: 22857 SLPQEDGGAEITHYIVERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKY 22915

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P + S P V      + SPP +          + ++W  P+  G   +  Y+++  
Sbjct: 22916 GPGVP-VESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKR 22974

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAA 816
              + S                    W   NKD ++  T+  +T L        RV AVNAA
Sbjct: 22975 EKKSLR------------------WTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAA 23016

Query: 817   GASEPKYYSQPILVKE 832
             G SEP   S  I  +E
Sbjct: 23017 GNSEPSEASNFISCRE 23032



 Score =  130 bits (328), Expect = 5e-30
 Identities = 80/234 (34%), Positives = 120/234 (51%), Gaps = 8/234 (3%)

Query: 272  FVVELADPKLE-VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            F VEL  P ++ V+W KNG  +  + KY    KG    L I NC + D+S Y    G   
Sbjct: 2680 FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2739

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S  L V    + + K+ +D TA     V  E  VS D   VKWF    EI P  K  +R
Sbjct: 2740 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK--HR 2795

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            +  E K H L+++  + +DA EY+ +   GQ   K  + ++ L I   + +  V   K  
Sbjct: 2796 LVSERKVHKLMLQNISPSDAGEYTAVV--GQLECKAKLFVETLHITKTMKNIEVPETKTA 2853

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              +CE+S  N+P  W KNG+ ++ S++ K+V +G++H+L+I N  TED  +Y F
Sbjct: 2854 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF 2907



 Score =  130 bits (328), Expect = 5e-30
 Identities = 91/320 (28%), Positives = 147/320 (45%), Gaps = 24/320 (7%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P I+  G +  + + + +G  LR++  + G P P+  W + D   +E    +       S
Sbjct: 21650 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGS 21708

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             ++L +  A RD  GVY +  KN +G A A IKVKV D P   V P   T +  +   + W
Sbjct: 21709 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWW 21768

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             + P  DG +PI  Y IE+++     W  +  D C+  ++   K+I G  Y+ R+ AVN  
Sbjct: 21769 DAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNEYQFRVSAVNKF 21827

Query: 701   GISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
             G+ +P  S P    +   V   P +    ++T  ++T+ W  P+  G + +  Y+LE   
Sbjct: 21828 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERRE 21887

Query: 759   EGSTSAKQSDENGEAAYDLPAEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
             + ST                   W+ V +K  I +T+F +TGL    +    V A NAAG
Sbjct: 21888 KKSTR------------------WVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 21929

Query: 818   ASEPKYYSQPILVKEIIEPP 837
                    S+ I  +E + PP
Sbjct: 21930 VGPASGISRLIKCREPVNPP 21949



 Score =  128 bits (322), Expect = 3e-29
 Identities = 101/352 (28%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V +G    FV EL+  K+ V W+KN  ++  S   +   +G    L +    + D S+  
Sbjct: 5280 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 5339

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
                +   + +L V E     T +L D TA   + + L+CEVS+ D  VKWFK+GEEI+P
Sbjct: 5340 AQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWFKDGEEIVP 5398

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
             PK  Y I+ +G + IL I+ A   D  EY       ++ A ++V+ + +K+  PL    
Sbjct: 5399 SPK--YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVE 5456

Query: 444  VNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V +G+    + E+SE ++ G+W   G P+  S   +++  G+ H L++ N      G+  
Sbjct: 5457 VFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVS 5516

Query: 503  FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
            F   A N    A + V + P I +  L   + V V   ++ + E  +S E P    W +G
Sbjct: 5517 F--QAANAKSAANLKVKELPLIFITPL---SDVKVFEKDEAKFECEVSRE-PKTFRWLKG 5570

Query: 563  DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
             + I  G  R          ++VI  A  +D   Y      EA + H S K+
Sbjct: 5571 TQEI-TGDDRFELIKDGTKHSMVIKSAAFEDEAKYMF----EAEDKHTSGKL 5617



 Score =  127 bits (319), Expect = 6e-29
 Identities = 199/857 (23%), Positives = 322/857 (37%), Gaps = 121/857 (14%)

Query: 319   DSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAY-CGERVELECEV-SEDDANVKWFK 376
             DS   +TA DE       V  P I +  +  DT     GE   LE +V  +    ++W +
Sbjct: 17304 DSTGPITAKDE-------VELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 17356

Query: 377   NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL 436
               +EI     +R  I+    K +LI++ A + D  +Y +  +    S    V++K L   
Sbjct: 17357 GDKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 17414

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKL-------- 488
              P  +  V +      KC ++ + P +    G  +       VV K    +L        
Sbjct: 17415 GP-PEGPVQVTGVTSEKCSLTWSPPLQ--DGGSDISHY----VVEKRETSRLAWTVVASE 17467

Query: 489   VIANALTEDE----GDYVF---APDAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAG 540
             V+ N+L   +     +YVF   A + Y V  P +   V+     +L G      VT IA 
Sbjct: 17468 VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAK 17527

Query: 541   NKLRLEIPISGEPPPKAMWSRGDKA--------IMEGSGRIRTESYPDSSTLVIDIAER- 591
             + + +             W+R D          I+E   R        +   + D+  R 
Sbjct: 17528 DSMTV------------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 17575

Query: 592   -----DDSGVYHINLKNEAGEAH---ASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNW 640
                  D    + ++ +N AG      A++  K  D    P PP    + +   +   + W
Sbjct: 17576 TGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 17635

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNA 699
               P YDGGS ILGY +E  K     W  +      + T FE  K+ E   Y++R+ A+N 
Sbjct: 17636 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 17695

Query: 700   IGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             +G+ + +       P      P L  +DS     + +R        A G     + +   
Sbjct: 17696 VGLGEATSVPGTVKPEDKLEAPEL-DLDSELRKGIVVR--------AGGSARIHIPFKGR 17746

Query: 760   GSTSAKQSDENGEAAYDLPAEDWI------VANKDLIDKTKFTIT--GLPTDAKIFVRVK 811
              +     S E GE    +  E  +      + N D  D  K+ +           FV VK
Sbjct: 17747 PTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVK 17806

Query: 812   AVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 871
              ++  G        Q + VKE+ +     +    +   I    +  N VI  +   R   
Sbjct: 17807 VLDTPGPP------QNLAVKEVRKDSAFLV---WEPPIIDGGAKVKNYVIDKRESTRK-- 17855

Query: 872   TWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
              +    ++  K    + N     I + R    +  G       V   VET    ++  + 
Sbjct: 17856 AYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFG-------VGVPVETVDA-VKAAEP 17907

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
             P PP  V + DV   + +L W  P+ DG + + GY ++   K + +W  V E     +A 
Sbjct: 17908 PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAV 17966

Query: 992   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQ 1051
             +T L  G EY FRV + N  G S+   +     VIA+D  I              P    
Sbjct: 17967 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVP--VIAKDLTIQ-------------PSLKL 18011

Query: 1052  PLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPS 1110
             P  NTY+I AG +  +   V G P+P I+W+K+   +    R  +        L I++ +
Sbjct: 18012 PF-NTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGN 18070

Query: 1111  PYDGGTYCCKAVNDLGT 1127
               D G Y   A N  GT
Sbjct: 18071 KDDFGKYTVTATNSAGT 18087



 Score =  126 bits (316), Expect = 1e-28
 Identities = 125/552 (22%), Positives = 221/552 (40%), Gaps = 66/552 (11%)

Query: 597   YHINLKNEAG---EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             Y +  +N AG    +  S  ++  D    P PP  P + + G     + W  P +DGG+P
Sbjct: 19750 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19809

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
             I GY +E KK   + W + +    + T +    +  G  Y  R+ +VN +G S PS  S 
Sbjct: 19810 ITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 19868

Query: 711   PFVPLAVTSPP----------TLLTVDSVTDT-TVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             P +       P          TL+     + T TV  R RP  ++  +  D  +    + 
Sbjct: 19869 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYV 19928

Query: 760   GSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 819
              +T ++ S         L  E+   AN++   K   TI  + + A + + VK ++  G  
Sbjct: 19929 DTTDSRTS---------LTIEN---ANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPP 19976

Query: 820   EPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE 879
                     I V+++ +   +     L        G A       + +   +  W      
Sbjct: 19977 TN------ITVQDVTKESAV-----LSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNN 20025

Query: 880   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
              ++    + N +   I + R      SG+ +  V +    ET    ++I ++P PP+ + 
Sbjct: 20026 CNRLSYKVTNLQEGAIYYFRV-----SGENEFGVGIP--AETKE-GVKITEKPSPPEKLG 20077

Query: 940   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF--TVIEHYHRTSATITELVI 997
             +  +  ++V+LTW  P+ DG + I  Y ++  +K    W    V +  H   + + E   
Sbjct: 20078 VTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRE--- 20134

Query: 998   GNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTY 1057
              +EY+FRVF+EN  GLS+   +            +    + E  +  E  M   P    Y
Sbjct: 20135 NSEYFFRVFAENQAGLSDPREL------------LLPVLIKEQLEPPEIDMKNFPSHTVY 20182

Query: 1058  AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
               AG N  ++  + G P PK+T  ++ V +    R+         T+ +++    D G Y
Sbjct: 20183 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRY 20242

Query: 1118  CCKAVNDLGTVE 1129
                A N  GT +
Sbjct: 20243 EITAANSSGTTK 20254



 Score =  125 bits (315), Expect = 2e-28
 Identities = 87/266 (32%), Positives = 123/266 (46%), Gaps = 11/266 (4%)

Query: 247  EEKKSAAFAKIL--DPAYQV---DKGGRVRFVVEL---ADPKLEVKWYKNGQEIRPSTKY 298
            +E  S A  K+L  DP + V   DK    +  + L       + VKW+K+G+EI PS KY
Sbjct: 5343 KELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKY 5402

Query: 299  IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGER 358
              +  G +RIL I    + D  EY    G +K    + V    I V K L     + GE 
Sbjct: 5403 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGET 5462

Query: 359  VELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
               E E+SE D + +W   G+ +   P     I  +GKKHILI+         E S    
Sbjct: 5463 AHFEIELSEPDVHGQWKLKGQPLTASPDC--EIIEDGKKHILILHNCQLGMTGEVSFQAA 5520

Query: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
              +S+A L V   PL  +TPL+D  V    E   +CE+S E    +W K    +   DR 
Sbjct: 5521 NAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRF 5580

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVF 503
            +++  G  H +VI +A  EDE  Y+F
Sbjct: 5581 ELIKDGTKHSMVIKSAAFEDEAKYMF 5606



 Score =  124 bits (312), Expect = 4e-28
 Identities = 135/548 (24%), Positives = 203/548 (37%), Gaps = 95/548 (17%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETT 678
             P PP  P V +       ++W  PAYDGGSPI+GY +E K+  S  W+R N     ++T 
Sbjct: 13284 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13343

Query: 679   FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPP----------TLLTVDS 728
             FE   ++E   Y+ R++AVN IG S PS       P  +  PP          TL+    
Sbjct: 13344 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13403

Query: 729   VTDTT-VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANK 787
             VT    V ++ RPP                                    P   W   N 
Sbjct: 13404 VTMRLYVPVKGRPP------------------------------------PKITWSKPNV 13427

Query: 788   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE----------PKYYSQPILVKEIIEPP 837
             +L D+    I    TD   F+R + VN   A +           K Y+  + V +   PP
Sbjct: 13428 NLRDRIGLDIKS--TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPP 13485

Query: 838   -KIRIPRHLKQT--------YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIR 888
               + +    K +         I      +N V+  Q +     +W     E  K    + 
Sbjct: 13486 VNVTVKEISKDSAYVTWEPPIIDGGSPIINYVV--QKRDAERKSWSTVTTECSKTSFRVA 13543

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENV 948
             N E     F R    +  G  D     D         ++    PGP   +K+  V   + 
Sbjct: 13544 NLEEGKSYFFRVFAENEYGIGDPGETRDA--------VKASQTPGPVVDLKVRSVSKSSC 13595

Query: 949   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 1008
             ++ W  P  DG + I GY +    +++ +W  V++       +  +L  G EY FRV +E
Sbjct: 13596 SIGWKKPHSDGGSRIIGYVVDFLTEEN-KWQRVMKSLS-LQYSAKDLTEGKEYTFRVSAE 13653

Query: 1009  NMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNC 1068
             N  G    + +T    V+ARD     + V  D D    P          A    N  L  
Sbjct: 13654 NENGEGTPSEIT----VVARD-----DVVAPDLDLKGLPDLCY-----LAKENSNFRLKI 13699

Query: 1069  SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTV 1128
              ++G P P ++W K +  +  D R  + S+    TL +      D G Y     N  GT 
Sbjct: 13700 PIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 13759

Query: 1129  EIECKLEV 1136
             E    ++V
Sbjct: 13760 EGTISIKV 13767



 Score =  120 bits (301), Expect = 7e-27
 Identities = 130/513 (25%), Positives = 208/513 (40%), Gaps = 41/513 (7%)

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KG+W+    + GKHL L       S  +   + I   K +  G Y    TYK      S 
Sbjct: 2603 KGEWL----RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSA 2654

Query: 156  DLEVH--ESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWEL 213
             L+V   +   T  N+ +          +     +     +K   V +  E+  + V   
Sbjct: 2655 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV--- 2711

Query: 214  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVD--KGGRVR 271
                K + Y        I D      RL R+    +      KI+     V   +   V 
Sbjct: 2712 ----KGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVA 2767

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F V ++   + VKW+    EI+PS K+    +     L + N   +D  EY    G  +C
Sbjct: 2768 FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLEC 2827

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +LFV    + +TK +++      +    ECEVS  +    W KNG EI    K  ++I
Sbjct: 2828 KAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK--FKI 2883

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             V+GK H LII   +  D+AEY+ +    Q SA L+V   P+ I + L D  +N  ++  
Sbjct: 2884 VVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMITSMLKD--INAEEKDT 2939

Query: 452  LKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD-- 506
            +  E++ N  G   KW KNG+ ++ +D+ ++  K   H L I N    D  DY F     
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                TL  +   I+  K I D       + V+   +   E  +S EP     W + D+  
Sbjct: 3000 TSTATLYVEARHIEFRKHIKD-------IKVLEKKRAMFECEVS-EPDITVQWMKDDQE- 3050

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            ++ + RI+ +       L+I      D+G Y +
Sbjct: 3051 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3083



 Score =  120 bits (301), Expect = 7e-27
 Identities = 89/317 (28%), Positives = 143/317 (45%), Gaps = 11/317 (3%)

Query: 256  KILDPAYQVD--KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINN 313
            K++ P + V+  +    RF  E+++  +   W   G+ +  +     + +G    L ++N
Sbjct: 5803 KLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHN 5862

Query: 314  CQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVK 373
            C++         A + K S  L V+   I + + L+D T   GE    +CE+S +D  V+
Sbjct: 5863 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 5922

Query: 374  WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL 433
            W+  G+++ P  K     R EGK H L +      DA E  +     ++ A L V   P+
Sbjct: 5923 WYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPV 5980

Query: 434  KILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
            +   PL DQTV  G    L+CE+S EN   KW KNG  + +S + ++V  GR+ KLVI +
Sbjct: 5981 EFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 6040

Query: 493  ALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
               ED   Y    DA +      ++V+ P    L  L     + V      R E  +S E
Sbjct: 6041 CTPEDIKTYTC--DAKDFKTSCNLNVVPPHVEFLRPL---TDLQVREKEMARFECELSRE 6095

Query: 553  PPPKAMWSRGDKAIMEG 569
               K  W +    I +G
Sbjct: 6096 -NAKVKWFKDGAEIKKG 6111



 Score =  120 bits (301), Expect = 7e-27
 Identities = 124/479 (25%), Positives = 201/479 (41%), Gaps = 76/479 (15%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVID 520
             KWTK G  +  S R  +       +LVI  A   D G Y  V         +  KV VI 
Sbjct: 23864 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIG 23921

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP------------------PKAMWSRG 562
              P      L+ D+             + +S  PP                  PKA W   
Sbjct: 23922 SPNSPEGPLEYDDIQV--------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTI 23973

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKV- 616
             D        R+R       ++LV+   + +    + ++ +N+ G     ++   +  K  
Sbjct: 23974 DS-------RVR------GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP 24020

Query: 617   VDFPDPPV-APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
             ++ P+PP   P V +V      ++W  P  DGGS + GY+IERK+  + +W+R N     
Sbjct: 24021 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 24080

Query: 676   ETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDT 732
              T +    ++    Y+ RI A N +G+S+ S  S P V   P    S P  L + S++  
Sbjct: 24081 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 24140

Query: 733   TVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDK 792
             +VT++W  P+  G   + GY +EY            ++G++A       W  +NK+ I  
Sbjct: 24141 SVTLQWEKPECDGGKEILGYWVEY-----------RQSGDSA-------WKKSNKERIKD 24182

Query: 793   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII-EPPKIRIPRHLKQTYIR 851
              +FTI GL    +   RV A N  G S P+  +  I  K    E P IR  + +K     
Sbjct: 24183 KQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIR--KEMKDV-TT 24239

Query: 852   RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT-IIFIRKAERSHSGKY 909
             ++GEA  L     G+P P++ W + G E+ +++    +S+  T  + +   E+   G Y
Sbjct: 24240 KLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 24298



 Score =  118 bits (295), Expect = 4e-26
 Identities = 143/575 (24%), Positives = 215/575 (37%), Gaps = 93/575 (16%)

Query: 597   YHINLKNEAGEAHASIKVKVVDF------PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + ++ +NE G    S   K V        P PPV P   +   +   + W+PP +DGGS 
Sbjct: 10779 FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSK 10838

Query: 651   ILGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             ILGY +E +K     W R N   + C ET ++   + +G  Y+ R+ AVNA G S P+  
Sbjct: 10839 ILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHV 10898

Query: 709   SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSD 768
               P +      PP L     + D  +        HI     D   L    +G        
Sbjct: 10899 PEPVLVKDRLEPPEL-----ILDANMARE----QHIKVG--DTLRLSAIIKG-------- 10939

Query: 769   ENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG----ASEPKYY 824
                      P   W   ++D   K +  +T  P  +K+ +R  A    G      E    
Sbjct: 10940 ------VPFPKVTWKKEDRDAPTKARIDVT--PVGSKLEIRNAAHEDGGIYSLTVENPAG 10991

Query: 825   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK---DGAEID 881
             S+ + VK ++   K   PR L+ + IR              K    LTWK+   DG  + 
Sbjct: 10992 SKTVSVKVLVLD-KPGPPRDLEVSEIR--------------KDSCYLTWKEPLDDGGSVI 11036

Query: 882   KNQINIRNSETD---TIIFIRKAERSHSGKY-------------DLQVKVDKFVETASID 925
              N +  R        + +     ++SH  K+             + Q     FVET    
Sbjct: 11037 TNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPK-P 11095

Query: 926   IQIIDR---PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVI 982
             I+ +D    PGPP+ +   DV    V+L W  P  DG + ITGY ++  ++ + +W    
Sbjct: 11096 IKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-F 11154

Query: 983   EHYHRTSATITELVIGNEYYFRVFSENMCGLS-EDATMTKESAVIARDGKIYKNPVYEDF 1041
             +        +T L  G  Y FRV +EN+ GL   D T+  E        K+    V  D 
Sbjct: 11155 KTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIEC-----QEKLVPPSVELDV 11209

Query: 1042  DFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGV 1101
                E  +           AG        +RG P P   W  +   I  D  Y + ++   
Sbjct: 11210 KLIEGLVVK---------AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 11260

Query: 1102  CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               L I+     D G Y     N  G+  +   L V
Sbjct: 11261 SVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11295



 Score =  116 bits (290), Expect = 1e-25
 Identities = 185/884 (20%), Positives = 323/884 (36%), Gaps = 156/884 (17%)

Query: 313   NCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDA 370
             N     DS   +TA DE       +  P   +  + +D    + GE   LE ++  +   
Sbjct: 18380 NFSEPSDSSGAITARDE-------IDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIP 18432

Query: 371   NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSV 428
             +V W K+G+E+     +R  I+   +K  L+++   + D  +Y   +   GG  S  ++V
Sbjct: 18433 DVVWSKDGKEL-EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITV 18491

Query: 429   DLK--------PLKIL------------TPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
              +         PLK+              PL D   N+   I  K E S      WT+  
Sbjct: 18492 KVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL---SWTQVS 18548

Query: 469   LPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVHVID----- 520
               VQ  +        ++ KL+  N       +Y+F   A + Y +  P +   +      
Sbjct: 18549 TEVQALNY-------KVTKLLPGN-------EYIFRVMAVNKYGIGEPLESGPVTACNPY 18594

Query: 521   -----PPKIILDGLDADNTVTVIA------GNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
                  P    +  +  D+ V   A      G ++   I +         W++ +K  +  
Sbjct: 18595 KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI-LEKRDKEGVRWTKCNKKTLTD 18653

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE-AHASIKVKVVDF---PDPPVA 625
               R+R     +  +    +A  + +GV         GE +  S+  +  D    P PP  
Sbjct: 18654 L-RLRVTGLTEGHSYEFRVAAENAAGV---------GEPSEPSVFYRACDALYPPGPPSN 18703

Query: 626   PTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT------F 679
             P VT+       + W  P YDGG+P+ GY +E K+  +  W       C   T      F
Sbjct: 18704 PKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-----CTPPTGLQGKQF 18758

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTL-----------LTVDS 728
                K+ E   Y  RI A+N+ G+ +P+      V      PP +           L   +
Sbjct: 18759 TVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASA 18818

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
                  VT++ RP   +     +G + +      TS+                  ++ N  
Sbjct: 18819 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTM--------------LVIDNVT 18864

Query: 789   LIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLK 846
               D  ++ +T          FV V+ +++  A        P+ +  I E  K  +    +
Sbjct: 18865 RFDSGRYNLTLENNSGSKTAFVNVRVLDSPSA--------PVNLT-IREVKKDSVTLSWE 18915

Query: 847   QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHS 906
                I    +  N ++  +   R       +     K    I N +     + R      S
Sbjct: 18916 PPLIDGGAKITNYIVEKRETTRKAYATITNNCT--KTTFRIENLQEGCSYYFRVLA---S 18970

Query: 907   GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 966
              +Y + +  +      +  +++ + P PP  V + DV      + W  P+ DG + ITGY
Sbjct: 18971 NEYGIGLPAE-----TTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGY 19025

Query: 967   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1026
              ++   K S +W T  +      ATI+ L  G EY FRV + N  G S+   +     VI
Sbjct: 19026 VVEMQTKGSEKWSTCTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP--VI 19082

Query: 1027  ARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVA 1086
             ARD +I              P    P       A     ++   +G P+  + W K+   
Sbjct: 19083 ARDIEI-------------KPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQT 19129

Query: 1087  IVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1130
             + +  R  + S++ V +L I++ S  D GTY     N  G++ +
Sbjct: 19130 LKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITV 19173



 Score =  115 bits (288), Expect = 2e-25
 Identities = 180/802 (22%), Positives = 307/802 (38%), Gaps = 107/802 (13%)

Query: 373   KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKP 432
             KW  +G EI       Y +  +    +L I+   + D  EY +  +    S  ++V L  
Sbjct: 11238 KWTTDGSEI--KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11295

Query: 433   LKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESDRLK----VVHKGRI 485
             L +  P T     L    + + +  +  ++  G    N + V++ D  K    VV  G  
Sbjct: 11296 LDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYI-VEKQDTRKDTWGVVSSGSS 11354

Query: 486   H-KLVIANALTEDEGDYVFAPDAYNV---------TLPAKVHVIDPPKIILDGLDADNTV 535
               KL I +   +   +YVF   A N          T     H   PP            V
Sbjct: 11355 KTKLKIPHL--QKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP-----PGKPVV 11407

Query: 536   TVIAGNKLRLE--IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERD- 592
             T I  N   +   +P S    P   +    + +     R+      D    V  + E + 
Sbjct: 11408 TDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNT 11467

Query: 593   -DSGVYHINLKNEAGEAHASIKVKV---VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
              +  V+  NL   +  + +S  +K    +  P PP+ P + +   +   + W  P  DGG
Sbjct: 11468 YEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGG 11527

Query: 649   SPILGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM 707
             SPILGY +E +K  +++W R+N D L ++  F    +IEG  Y  RI A N +G  +P  
Sbjct: 11528 SPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRE 11587

Query: 708   PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA--GLDGYVLEYCFEGSTSAK 765
              +   +   +  PP +  +D      +T+R      I A   G     + +  EG    +
Sbjct: 11588 LAESVIAKDILHPPEV-ELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVR 11646

Query: 766   QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
             +  +  +   DLP  +  +      D  K+ I+             A N++G      ++
Sbjct: 11647 E--KRVDLIQDLPRVELQIKEAVRADHGKYIIS-------------AKNSSG------HA 11685

Query: 826   QPILVKEIIEPPKIRIPRHLKQTYIRRVG--------------EAVNLVIPFQGKPRPEL 871
             Q   +  +++ P     ++LK T + +                E  N ++ ++ KP  + 
Sbjct: 11686 QGSAIVNVLDRPGPC--QNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR-KPNQK- 11741

Query: 872   TWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--IDIQII 929
              W    +++ K  I       +   F   AE         +V V   +ET +  + I  I
Sbjct: 11742 GWSIVASDVTKRLIKANLLANNEYYFRVCAEN--------KVGVGPTIETKTPILAINPI 11793

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             DRPG P+ + I D     V L W  P  DG +    Y +++  K S +W  V +   + +
Sbjct: 11794 DRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET 11853

Query: 990   ATITELVIGNEYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPM 1048
               + +  + N+ Y FRV ++N  G S+   +  E  V+  D               + P+
Sbjct: 11854 HYMVDRCVENQIYEFRVQTKNEGGESD--WVKTEEVVVKED--------------LQKPV 11897

Query: 1049  FTQPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVA--IVDDPRYRMFSNQGVCTLE 1105
                 L     + AG    L   VRG P P++ W K+K A  +   PR ++ +        
Sbjct: 11898 LDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFS 11957

Query: 1106  IRKPSPYDGGTYCCKAVNDLGT 1127
             + K    DGG Y   A N  G+
Sbjct: 11958 LTKAKRSDGGKYVVTATNTAGS 11979



 Score =  115 bits (288), Expect = 2e-25
 Identities = 190/873 (21%), Positives = 328/873 (37%), Gaps = 153/873 (17%)

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDANVKWFKNGEEI 381
             +TA DE       V  P I +  + +DT   + GE  +++ ++  +    ++W K  +E+
Sbjct: 16227 ITARDE-------VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 16279

Query: 382   IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
                  +R  I+       L ++ A + D+  Y +          ++V++K L    P   
Sbjct: 16280 --SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 16337

Query: 442   QTVNLGKEICLKCEISENIPGKWTKNGLPVQE--SDRLKVVHKGR-----IHKLVIANAL 494
               V  G     KC ++      W     P+Q+  SD +  + + R     +  +V AN  
Sbjct: 16338 PVVISGVT-AEKCTLA------WKP---PLQDGGSDIINYIVERRETSRLVWTVVDANVQ 16387

Query: 495   TED-------EG-DYVF---APDAYNVTLPAKVH--VIDPPKIILDGLDADNTVTVIAGN 541
             T         EG +Y F   A + Y V  P +    V   P ++ D   A    TV   +
Sbjct: 16388 TLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDS 16447

Query: 542   KLRL-EIPISG------------EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDI 588
              + + E P S                    W+R  K ++ G  R+R          V  +
Sbjct: 16448 MIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLI-GELRLR----------VTGL 16496

Query: 589   AERDDSGVYHINLKNEAGEAHAS---IKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEP 642
              E  D   + ++ +N AG +  S      K  D    P PP  P V ++      ++W  
Sbjct: 16497 IENHDYE-FRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSK 16555

Query: 643   PAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIG 701
             P YDGG  I GY +E+       W          +T  E +K++E   Y  RI A+N  G
Sbjct: 16556 PIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAG 16615

Query: 702   ISKPSMPSRPFVPLAVTSPPTL-----------LTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + + +    P +       P +           +         V ++ RP   +    +D
Sbjct: 16616 VGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVD 16675

Query: 751   GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTIT--GLPTDAKIFV 808
             G + +      TS+  S               ++ N +  D  K+T+T          FV
Sbjct: 16676 GEIRDAAIIDVTSSFTS--------------LVLDNVNRYDSGKYTLTLENSSGTKSAFV 16721

Query: 809   RVKAVNAAGASEPKYYSQPILVKEII----EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
              V+ ++    S P       + K+ +    EPP +     +K   + +            
Sbjct: 16722 TVRVLDTP--SPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK------------ 16767

Query: 865   GKPRPELTWKKDGAEID---KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
                  E T K   A +    KN   I   +     + R    +  G       +    +T
Sbjct: 16768 ----REATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYG-------IGLPAQT 16816

Query: 922   ASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 981
             A   I++ + P PP  + ++DV   +V+L+WT P+ DG + I  Y ++   K S +W + 
Sbjct: 16817 AD-PIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW-SE 16874

Query: 982   IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDF 1041
                     A IT L  G EY FRV + N  G S+  ++     ++A+D  I  +      
Sbjct: 16875 CARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP--IVAKDLVIEPD------ 16926

Query: 1042  DFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1100
                      +P  ++Y++  G +  +   + G PKP ITW K+ + +    R  +  +  
Sbjct: 16927 --------VKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLD 16978

Query: 1101  VCTLEIRKPSPYDGGTYCCKAVNDLG--TVEIE 1131
             + TL I++    DGG Y     N +G  T  IE
Sbjct: 16979 LTTLSIKETHKDDGGQYGITVANVVGQKTASIE 17011



 Score =  115 bits (287), Expect = 3e-25
 Identities = 101/370 (27%), Positives = 158/370 (42%), Gaps = 34/370 (9%)

Query: 266  KGGRVRFVVELAD-----------------PKLEVKWYKNGQEIRPSTKYIFEHKGCQRI 308
            +G  V FV EL D                   +E KWY N  E++ + KY    +  ++ 
Sbjct: 2217 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2276

Query: 309  LFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            L + +    D  EY      +K + +L ++  PI + + L D     G+ V+LE +VS +
Sbjct: 2277 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE 2336

Query: 369  DANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
                 W K+G+E+   P  R  I ++ + H+L+IE  TK DA  YS        S    V
Sbjct: 2337 SVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV 2394

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIH 486
             +  + ++TPL D  V  G +  L+C++S  +    KW  N   ++  DR++ + KG   
Sbjct: 2395 SVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ 2454

Query: 487  KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLE 546
            +LVI      DEG Y              V  I     I+ GL  D T T        +E
Sbjct: 2455 RLVINRTHASDEGPYKLIVGRVETNCNLSVEKIK----IIRGL-RDLTCTETQNVVFEVE 2509

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            +  SG      +W+  DK I + S + + E++     L +    +DD G Y       AG
Sbjct: 2510 LSHSG---IDVLWNFKDKEI-KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAG 2561

Query: 607  EAHASIKVKV 616
            E   S K+ V
Sbjct: 2562 ENMTSGKLTV 2571



 Score =  111 bits (278), Expect = 3e-24
 Identities = 96/369 (26%), Positives = 166/369 (44%), Gaps = 22/369 (5%)

Query: 269  RVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGD 328
            R  F  E+++P + V+W K+ QE++ + +   + +     L I + +M+D  +Y V AG 
Sbjct: 3028 RAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG 3087

Query: 329  EKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               + +LFV    + +    ++      +R  +E EV+EDD +  W+K+G EI    + R
Sbjct: 3088 NVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER 3147

Query: 389  YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL-KPLKILTPLTDQTVNLG 447
            ++  VE + H + I    ++DA EY+ +    +SS  L V+  +P ++L  L   TV  G
Sbjct: 3148 HKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSG 3207

Query: 448  KEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF-A 504
            K       IS     K  W K    +    + K +H G+ + L++  A  ED   Y   A
Sbjct: 3208 KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEA 3267

Query: 505  PDAYNVTLPAKVHVIDPPKIILDGLD-----------ADNTVTVIAGNKLRLEIPISGEP 553
             + Y V   +    ++ P+++    +             +TVT   G   R +  +SG  
Sbjct: 3268 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVT-SEGQPARFQCRVSG-T 3325

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE----AH 609
              K  W   DK I + S   R   + D+  L I  A  +D G Y     N  G+    A+
Sbjct: 3326 DLKVSWYSKDKKI-KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3384

Query: 610  ASIKVKVVD 618
             S++V+ +D
Sbjct: 3385 LSLEVQALD 3393



 Score =  110 bits (276), Expect = 6e-24
 Identities = 178/830 (21%), Positives = 319/830 (38%), Gaps = 108/830 (13%)

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
             T   G  + L+  V  + +  + W K  +E+    K    ++  GK+   +I+   ++D+
Sbjct: 22753 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK--VSLQYTGKRATAVIKFCDRSDS 22810

Query: 411   AEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIP-----GKWT 465
              +Y++       +  +SV +K L    P    TV+   +   KC ++ ++P      + T
Sbjct: 22811 GKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQE--KCTLAWSLPQEDGGAEIT 22868

Query: 466   KNGLPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH---- 517
                +  +E+ RL  V+ +G    L           +Y+F   A + Y   +P +      
Sbjct: 22869 HYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA 22928

Query: 518   ----VIDPPKIILDGLDADNTVTVI--------AGNKLRLEIPISGEPPPKAMWSRGDKA 565
                  I  P  I + +       +I         GN++   + +         W+R +K 
Sbjct: 22929 RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYL-VDKREKKSLRWTRVNKD 22987

Query: 566   IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF-PDPPV 624
              +    R++  S  +       +   + +G       +E  EA   I  +   + P PP 
Sbjct: 22988 YVVYDTRLKVTSLMEGCDYQFRVTAVNAAG------NSEPSEASNFISCREPSYTPGPPS 23041

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC-KETTFEPKK 683
             AP V +       + W  P YDGG+ I+GY +E ++K + +W R++ +   + T F    
Sbjct: 23042 APRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPD 23101

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             +  G  Y  R+ AVN  G+S+ S       P+     P L   D +  T VT+R      
Sbjct: 23102 LKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKT-VTIRAGASLR 23160

Query: 744   --IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
               +  +G    V+ +  +G   A ++  +   +Y L     IV   +  D  K+TI    
Sbjct: 23161 LMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL----LIVDKVNRYDAGKYTI---- 23212

Query: 802   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTY-----IRRV 853
                      +A N +G       S  +LVK    P   P +++    + +      I  +
Sbjct: 23213 ---------EAENQSGKK-----SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTI 23258

Query: 854   --GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDL 911
               G  VN  I  + +      +K    +  K    I      T+ + R    +  G    
Sbjct: 23259 DGGAPVNNYI-VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYG---- 23313

Query: 912   QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 971
                + +  ET+   + + + P  P  +++ DV    V L W  P  DG + +TGY ++  
Sbjct: 23314 ---IGEPCETSDA-VLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEAC 23369

Query: 972   DKKSMEWF-------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1024
                +  W        TV+EH      T+T L  G +Y FR+ ++N  G+SE       +A
Sbjct: 23370 KAGTERWMKVVTLKPTVLEH------TVTSLNEGEQYLFRIRAQNEKGVSEPRETV--TA 23421

Query: 1025  VIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNK 1084
             V  +D ++         D S     T P    +  AG    L   + G P P  +W    
Sbjct: 23422 VTVQDLRVLPT-----IDLS-----TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAG 23471

Query: 1085  VAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
               + +  R  + ++  V  L IR+ +  D G Y  +  N  GT     K+
Sbjct: 23472 SKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKV 23521



 Score =  108 bits (270), Expect = 3e-23
 Identities = 103/437 (23%), Positives = 169/437 (38%), Gaps = 53/437 (12%)

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLP 778
             SP   L  D +   +V + WRPP   G A + GY+LE                    ++P
Sbjct: 23925 SPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILE------------------RREVP 23966

Query: 779   AEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
                W   +   +  T   + GL  + +   RV A N  G S+P    +P+  K  + PP+
Sbjct: 23967 KAAWYTIDSR-VRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPE 24025

Query: 839   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN----IRNSETD- 893
                P       +     +V+L      +P+ +   +  G  I++ + +    +R+++T  
Sbjct: 24026 ---PPSNPPEVLDVTKSSVSLS---WSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQI 24079

Query: 894   TIIFIRKAERSHSGKYDLQVKVDKFV---ETASIDIQII-----DRPGPPQIVKIEDVWG 945
             T             +Y  ++     V   ET+     ++     D+P  P  ++I  +  
Sbjct: 24080 TTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISK 24139

Query: 946   ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-TVIEHYHRTSATITELVIGNEYYFR 1004
             ++V L W  P+ DG   I GY ++        W  +  E       TI  L+   EY FR
Sbjct: 24140 DSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFR 24199

Query: 1005  VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNA 1064
             VF+EN  GLS               G              EAP   + + +     G  A
Sbjct: 24200 VFAENETGLSRPRRTAMSIKTKLTSG--------------EAPGIRKEMKDVTTKLGEAA 24245

Query: 1065  TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1124
              L+C + G P P I W +    ++   +Y+M S+    TL +      D G Y C A N+
Sbjct: 24246 QLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE 24305

Query: 1125  LGTVEIECKLEVKVIAQ 1141
             +G VE   KL ++   Q
Sbjct: 24306 VGEVETSSKLLLQATPQ 24322



 Score =  107 bits (268), Expect = 5e-23
 Identities = 123/468 (26%), Positives = 198/468 (42%), Gaps = 56/468 (11%)

Query: 196  RREVKQQEEE---PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA 252
            R + K++ EE     +   EL    K   YE++  +        +L   K +  EEKK+ 
Sbjct: 1952 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRK----TKDELLHWTKELTEEEKKAL 2007

Query: 253  AF-AKILDPAYQVDK-----------------------GGRVRFVVELAD-PKLEVKWYK 287
            A   KI  P ++ DK                       G    F V +   P  E +WYK
Sbjct: 2008 AEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYK 2067

Query: 288  NGQEIRPSTK---YIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTELFVREP 340
            NG +I  S +   Y  E   C+  L I +    D +   V     AG+      L V+  
Sbjct: 2068 NGVKIERSDRIYWYWPEDNVCE--LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2125

Query: 341  PIMV-TKQLEDTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             ++  T++L+D  A   + +   ECE SE    VKW+K+G E+  G K  YR+  + K H
Sbjct: 2126 QLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK--YRMHSDRKVH 2183

Query: 399  ILIIEGATKADAAEYS---VMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
             L I     +DA +YS   V     +++AKL V+   ++ +  L D  V       L+C 
Sbjct: 2184 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S ENI GKW  N + ++ + +  +  +     L + +   ED+G+Y F  D    T   
Sbjct: 2244 VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT--C 2301

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR 574
            K+ +   P  IL GL       V  G+ ++LE+ +S E   + +W + D   ++ S R+ 
Sbjct: 2302 KLKMKPRPIAILQGLSDQK---VCEGDIVQLEVKVSLE-SVEGVWMK-DGQEVQPSDRVH 2356

Query: 575  TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                  S  L+I+   ++D+G Y   +          + V  VD   P
Sbjct: 2357 IVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITP 2404



 Score =  107 bits (266), Expect = 8e-23
 Identities = 171/808 (21%), Positives = 305/808 (37%), Gaps = 106/808 (13%)

Query: 356   GERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHI--LIIEGATKADAAE 412
             G  V+L   +S   A  ++W+K+ +E+    ++   + VE    +  ++I+ A + ++  
Sbjct: 20582 GTSVKLRAGISGKPAPTIEWYKDDKEL----QTNALVCVENTTDLASILIKDADRLNSGC 20637

Query: 413   YSVMTTGGQSSAKLSVDL----KPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
             Y +       SA  ++ +    KP     P+  +TV   K   L    +++   K T   
Sbjct: 20638 YELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYI 20697

Query: 469   LPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH-VIDPPK 523
             +  +E+ R+   +    + + +I         +Y+F   A + Y +  P +   V+    
Sbjct: 20698 VEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNA 20757

Query: 524   IILDGLDADNTVTVIAGNKLRL----EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
              +  G      VT I  N + +     I   G         + DK  + G  ++  E+  
Sbjct: 20758 FVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSL-GWFKVLKETIR 20816

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGE---AHASIKVKVVDFPDPPVAPTVTEVGDDW- 635
             D+   V  + E  D   Y +   N AG+   +  S   K  D  DPP  P    + D   
Sbjct: 20817 DTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 20875

Query: 636   --CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETTFEPKKMIEGVAYEV 692
                 + W  P YDGGS + GY +E ++ +   W  ++     + T +    +  GV Y  
Sbjct: 20876 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 20935

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R+ AVN  G  +P   + P     +   P +       D  V +R      I  AG D  
Sbjct: 20936 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEI-------DLDVALR---TSVIAKAGEDVQ 20985

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             VL   F+G                 P   W    K+L    +++I    TD+   + +  
Sbjct: 20986 VL-IPFKGRPP--------------PTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQ 21028

Query: 813   VN-----------AAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTYIRRVGE--- 855
             V              G  EPK  S  + VK +  P    K+++ +H+ +  +  + +   
Sbjct: 21029 VTRNDTGKYILTIENGVGEPK--SSTVSVKVLDTPAACQKLQV-KHVSRGTVTLLWDPPL 21085

Query: 856   ------AVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKY 909
                    +N VI  + +   + TW     +       + +    T  F R    +  G  
Sbjct: 21086 IDGGSPIINYVI--EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIG-- 21141

Query: 910   DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
                  + +  ET    ++  + P P + + ++D    +V L+WT P  DG + IT Y ++
Sbjct: 21142 -----IGEPCETTE-PVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVE 21195

Query: 970   KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
             +  K    W +           +++L   +   FRVF++N  GLS+  T+          
Sbjct: 21196 RKGKGEQTW-SHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI---------- 21244

Query: 1030  GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
             G I    V E     E  +   P        G+N  L    +G PKP I+W+K+ + + +
Sbjct: 21245 GPI---TVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 21301

Query: 1090  DPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
                 R    +   TL I+      GG Y
Sbjct: 21302 SEFVRFSKTENKITLSIKNAKKEHGGKY 21329



 Score =  106 bits (265), Expect = 1e-22
 Identities = 117/456 (25%), Positives = 185/456 (40%), Gaps = 83/456 (18%)

Query: 597   YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
             Y +N    +  + AS  +   +  D P  P VT+V      + W  PAYDGGS ++GY I
Sbjct: 22611 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYII 22670

Query: 657   ERK---KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPF 712
             ERK   +    RW++ N+ +  +  F    + EG  YE R+ A NA G ISK S  + P 
Sbjct: 22671 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 22730

Query: 713   VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGE 772
                   +PP       +    VT+R         AG D  VL+    G    K     G+
Sbjct: 22731 TCRDEYAPPKAELDARLHGDLVTIR---------AGSD-LVLDAAVGGKPEPKIIWTKGD 22780

Query: 773   AAYDL----------PAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 822
                DL               ++   D  D  K+T+T               NA+G     
Sbjct: 22781 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLT-------------VKNASGTK--- 22824

Query: 823   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW----KKDGA 878
               +  ++VK +  P                 G    L +    + +  L W    +  GA
Sbjct: 22825 --AVSVMVKVLDSP-----------------GPCGKLTVSRVTQEKCTLAWSLPQEDGGA 22865

Query: 879   EI--------DKNQIN--IRNSETDTIIFIRKAERSHSGKYDLQVK-VDKFVETASIDIQ 927
             EI        + +++N  I   E  T+ ++       + +Y  +V+ V+K+     ++ +
Sbjct: 22866 EITHYIVERRETSRLNWVIVEGECPTLSYV-VTRLIKNNEYIFRVRAVNKYGPGVPVESE 22924

Query: 928   -IIDR-----PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 981
              I+ R     P PP I +      E++ + WT P+ DG   I+ Y + K +KKS+ W  V
Sbjct: 22925 PIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRV 22984

Query: 982   IEHY--HRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              + Y  + T   +T L+ G +Y FRV + N  G SE
Sbjct: 22985 NKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSE 23020



 Score =  106 bits (264), Expect = 1e-22
 Identities = 128/545 (23%), Positives = 211/545 (38%), Gaps = 64/545 (11%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP  P V +       + W+PPA DGGSPI GY +E +++ ++ W R+N      TT 
Sbjct: 9400 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 9459

Query: 680  E--PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMR 737
            E     + E   Y  R+ AVN  G S+PS  +       +   P +  +D      +  +
Sbjct: 9460 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVF-IDIGAQDCLVCK 9518

Query: 738  WRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTI 797
                  I A        +  +E    AK++ ++G   +D+P +    A  +  + +   I
Sbjct: 9519 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDG--VHDIPED----AQLETAENSSVII 9572

Query: 798  TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAV 857
              +P   +      ++ A   +  K  +  + V ++  PPK      LK + I R    +
Sbjct: 9573 --IPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRL 9625

Query: 858  NLVIP------------FQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR-KAERS 904
            +  +P             + +      W K   +       + +  ++   F R +AE  
Sbjct: 9626 SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAEN- 9684

Query: 905  HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT 964
               ++ +   V+    T + D   I  P PP  +KI  +    V L+W PPK+DG + +T
Sbjct: 9685 ---RFGIGPPVETIQRTTARDP--IYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVT 9739

Query: 965  GYTIQ-----KADKKSMEWFTVIEH-YHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1018
             Y ++         K   W    +        T+ +LV G EY FRV + N  G+S+ + 
Sbjct: 9740 HYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSA 9799

Query: 1019 MTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKI 1078
                      D      P  +  +F E               G N  +   ++G P P +
Sbjct: 9800 TVGPCDCQRPD----MPPSIDLKEFMEVE------------EGTNVNIVAKIKGVPFPTL 9843

Query: 1079 TWMK-------NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIE 1131
            TW K       NK  ++ D           CTL I +    D G Y   AVN+LGT   E
Sbjct: 9844 TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKE 9903

Query: 1132 CKLEV 1136
             +L V
Sbjct: 9904 MRLNV 9908



 Score =  105 bits (263), Expect = 2e-22
 Identities = 101/375 (26%), Positives = 158/375 (42%), Gaps = 21/375 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +G  V+  V+++   +E  W K+GQE++PS +          +L I +    D   Y
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDD-ANVKWFKNGEEI 381
              T      ST   V    + V   L+D     G +  LEC+VS  D  +VKW+ N E+I
Sbjct: 2380 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2439

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
               P  R +  V+G K  L+I     +D   Y ++    +++  LSV+   +KI+  L D
Sbjct: 2440 --KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRD 2495

Query: 442  QTVNLGKEICLKCEISEN-IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T    + +  + E+S + I   W      ++ S + K+   G+I+KL + N + +DEG 
Sbjct: 2496 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2555

Query: 501  YVF--APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAM 558
            Y F    +  +  L      I  P         D TV          E+     P  K  
Sbjct: 2556 YTFYAGENMTSGKLTVAGGAISKPL-------TDQTVAESQEAVFECEV---ANPDSKGE 2605

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            W R  K  +  +  IR+ES      L+I   + DD G Y    K    +  A +KV+ V 
Sbjct: 2606 WLRDGKH-LPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVK 2662

Query: 619  FPDPPVAPTVTEVGD 633
                    TVTE  D
Sbjct: 2663 IKKTLKNLTVTETQD 2677



 Score =  103 bits (258), Expect = 7e-22
 Identities = 110/456 (24%), Positives = 174/456 (38%), Gaps = 80/456 (17%)

Query: 702   ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             + KP +P+ P            +  D VT   +T++W PP   G + +  Y+LE      
Sbjct: 13768 VGKPGIPTGP------------IKFDEVTAEAMTLKWAPPKDDGGSEITNYILE------ 13809

Query: 762   TSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA--- 818
                K+   N +         W+      + KT F +T L    +   RV A N  G    
Sbjct: 13810 ---KRDSVNNK---------WVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEG 13856

Query: 819   --SEPKYYSQPILVKEIIEPPKIRIPRH----LKQTYIRRVGEAVNLVIPFQGKPRPELT 872
               SEP     P  V +   PP I   RH    L  T  ++ G +       + K R  L 
Sbjct: 13857 LKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL 13916

Query: 873   WKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------I 924
             WK+     +K  I +R+ +   +        +   +Y+ +V                  +
Sbjct: 13917 WKR----ANKTPIRMRDFKVTGL--------TEGLEYEFRVMAINLAGVGKPSLPSEPVV 13964

Query: 925   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE- 983
              +  ID PG P+++ I      +V L WT PK DG   +TGY ++K D  S  W      
Sbjct: 13965 ALDPIDPPGKPEVINITR---NSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHV 14021

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDF 1043
             +    + T+T+LV G +Y FR+ ++N  G     + + E+ +I +D            ++
Sbjct: 14022 NVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTET-IICKD------------EY 14068

Query: 1044  SEAPMFTQPLVNTYAI--AGYNATLNC-SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1100
                 +   P +       AG    LN  S+ G P PK +W K    I      ++ S   
Sbjct: 14069 EAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPT 14128

Query: 1101  VCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                L I+  +  D G Y   A N  GT     K+ V
Sbjct: 14129 SSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTV 14164



 Score =  102 bits (255), Expect = 2e-21
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 15/389 (3%)

Query: 248  EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK-GCQ 306
            E+    F K L+    V KG  +    EL + + +V W K+G+ +      I     G  
Sbjct: 4903 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 4961

Query: 307  RILFINNCQMTDDSEYYVT---AGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELE 362
            R L IN+   TD   Y VT   A + +CS+ + V E     + K + D            
Sbjct: 4962 RALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFA 5021

Query: 363  CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQS 422
            C++++D  N+KWFK  +EI   P  +  I  +G    L I+ A   D AEY+V   G + 
Sbjct: 5022 CDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRY 5081

Query: 423  SAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVH 481
             AKL++  + +++L P+ D T+   +      EISE +IPG+W   G  ++ S   ++  
Sbjct: 5082 PAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKA 5141

Query: 482  KGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGN 541
            +G    L +     +  G+ ++   A N    A   ++   +I LD       VTV    
Sbjct: 5142 EGGKRFLTLHKVKLDQAGEVLY--QALNAITTA---ILTVKEIELDFAVPLKDVTVPERR 5196

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINL 601
            + R E  ++ E     +WS+G   I++ S +    +      LVI+ ++ DD GVY   +
Sbjct: 5197 QARFECVLTRE--ANVIWSKGPD-IIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEV 5253

Query: 602  KNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
            + +   A   +    + F  P    TV E
Sbjct: 5254 EGKKTSARLFVTGIRLKFMSPLEDQTVKE 5282



 Score =  102 bits (254), Expect = 2e-21
 Identities = 85/281 (30%), Positives = 121/281 (43%), Gaps = 16/281 (5%)

Query: 283  VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
            V W K    I+ S K+     G + IL IN+ Q  D+  Y      +K S  LFV    +
Sbjct: 5210 VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRL 5269

Query: 343  MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                 LED T   GE     CE+S +  +V WFKN  ++         I  EGK H L +
Sbjct: 5270 KFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL--HTSRTVLISSEGKTHKLEM 5327

Query: 403  EGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG 462
            +  T  D ++         S+A+L V          L D+T     EI LKCE+S+++P 
Sbjct: 5328 KEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPV 5387

Query: 463  KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV----FAPDAYNVTLPAKVHV 518
            KW K+G  +  S +  +   G    L I  A  +D+G+YV          NVT+ A++  
Sbjct: 5388 KWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIK 5447

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
            ++ P   L G      V V  G     EI +S EP     W
Sbjct: 5448 VEKP---LYG------VEVFVGETAHFEIELS-EPDVHGQW 5478



 Score =  102 bits (254), Expect = 2e-21
 Identities = 179/762 (23%), Positives = 289/762 (37%), Gaps = 135/762 (17%)

Query: 340   PPIMVTKQLEDTTAYCGERVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             P I++ +Q+   T   G+++ +E  V  +     KW K  +E++    S   +       
Sbjct: 12595 PKILMPEQI---TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTS--SHLAVHKADSSS 12649

Query: 399   ILIIEGATKADAAEYSVMT--TGGQSSAKLSV--------------------DLKPLKIL 436
             ILII+  T+ D+  YS+    + G  + K+ V                    D   L   
Sbjct: 12650 ILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWH 12709

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKW-TKNGLPVQESDRLKVVHKGRIH--------K 487
              PL D   N+   I  KC++S    G W T      + S R+  +  G+ +        +
Sbjct: 12710 IPLEDGGSNITNYIVEKCDVSR---GDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENR 12766

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL--DGLDADNTVTVIAGNKLRL 545
               I+  LT  +    F     +    A+V  ++   I +  D  D+D    +I       
Sbjct: 12767 FGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG------ 12820

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
                I  +     +W + +  +      +R+  YP +   +++  E      + I   N+A
Sbjct: 12821 -YLIERKERNSLLWVKANDTL------VRSTEYPCAG--LVEGLEYS----FRIYALNKA 12867

Query: 606   GEAHASIKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
             G +  S   + V      DPP  P V +V      + W  P +DGGS I+GYF+E  K  
Sbjct: 12868 GSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLP 12927

Query: 663   SSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
               +W+R N       +  +    + E   Y+ R  A  A+ IS PS PS P   LA   P
Sbjct: 12928 GDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVP 12987

Query: 721   P---------TLLTVDSVT----DTTV------TMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             P         +LLTV + T    D TV      T+ W+          DG +L+   EG 
Sbjct: 12988 PRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKK---------DGTLLKPA-EGI 13037

Query: 762   TSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 821
               A Q +           E + V  KD  D T  T           +++K ++  G    
Sbjct: 13038 KMAMQRNL-------CTLELFSVNRKDSGDYT-ITAENSSGSKSATIKLKVLDKPGPPAS 13089

Query: 822   ----KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVG-EAVNLVIPFQGKPRPELTWKKD 876
                 K YS   ++    EPP            +   G E  N ++  +   RP   W + 
Sbjct: 13090 VKINKMYSDRAMLSW--EPP------------LEDGGSEITNYIVDKRETSRPN--WAQV 13133

Query: 877   GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 936
              A +     ++           R    +  G  D       F E A I     D PG   
Sbjct: 13134 SATVPITSCSVEKLIEGHEYQFRICAENKYGVGD-----PVFTEPA-IAKNPYDPPGRCD 13187

Query: 937   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI--TE 994
                I ++  +++ ++W PP DDG + ITGY ++K + +++ W T +        T+  T 
Sbjct: 13188 PPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNW-TKVNRKPIIERTLKATG 13246

Query: 995   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
             L  G EY FRV + N  G  + +  +K  A  ARD +    P
Sbjct: 13247 LQEGTEYEFRVTAINKAGPGKPSDASK--AAYARDPQYPPGP 13286



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 93/361 (25%), Positives = 149/361 (41%), Gaps = 12/361 (3%)

Query: 271  RFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            +F  E++      +W K  QEI    ++     G +  + I +    D+++Y   A D+ 
Sbjct: 5553 KFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH 5612

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S +L +    +     L+D TA   E      E+S D+  VKWFKN + +         
Sbjct: 5613 TSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL--HTTRSVS 5670

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            ++ EGK H +  +  +  D ++  V   G  S AKL+V          L D T     E+
Sbjct: 5671 MQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV 5730

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN 509
             L+CEIS+ + P KW K+G  ++ S    +   G+   L++  AL  D G Y    D   
Sbjct: 5731 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC--DCGT 5788

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS-RGDKAIME 568
                 K+ + D    ++  L   ++V V+     R E  IS E    A W  +G+  +  
Sbjct: 5789 DKTSGKLDIEDREIKLVRPL---HSVEVMETETARFETEIS-EDDIHANWKLKGEALLQT 5844

Query: 569  GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
                I+ E    S  LV+     D +G       N    AH  +K +V+    P    TV
Sbjct: 5845 PDCEIKEEGKIHS--LVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 5902

Query: 629  T 629
            T
Sbjct: 5903 T 5903



 Score = 97.1 bits (240), Expect = 9e-20
 Identities = 126/568 (22%), Positives = 206/568 (36%), Gaps = 75/568 (13%)

Query: 597   YHINLKNEAGEAHASIKVKVV---DFPDPPVAPTVTEVGDDW---CIMNWEPPAYDGGSP 650
             + +  +NE G    S+  + V   D  +PP  PT   V D       + W  P YDGG+P
Sbjct: 12163 FRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 12222

Query: 651   ILGYFIERKKKQSSR-----WMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             I+GY +E + K +       W R N         F    + E   YE R+ A N +GI +
Sbjct: 12223 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 12282

Query: 705   PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVT-----------MRWRPPDHIG--AAGLDG 751
             P+       P  +  PP +    S+    +            +R RP   +     G+D 
Sbjct: 12283 PAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDN 12342

Query: 752   YVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL-PTDAK-IFVR 809
              V +          Q D     A+       ++ N    D  K+++T + P   K +FV 
Sbjct: 12343 VVRK---------GQVDLVDTMAF------LVIPNSTRDDSGKYSLTLVNPAGEKAVFVN 12387

Query: 810   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 869
             V+ ++  G         P+   ++ +  K     H+        G +       + +   
Sbjct: 12388 VRVLDTPG---------PVSDLKVSDVTKTSC--HVSWAPPENDGGSQVTHYIVEKREAD 12436

Query: 870   ELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
               TW     E+ K   ++ N       + R    +  G       V   V    +    +
Sbjct: 12437 RKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGP-----GVPTDVPKPVLASDPL 12491

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY-TIQKADKKSMEWFTVIEHYHRT 988
               P PP+ +++ ++   +  L W PP  DG A I GY T  + +++  + +T        
Sbjct: 12492 SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDL 12551

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPM 1048
             S  +T L  G +Y FRV + N  G+S           + R+ +     VYE  +    P 
Sbjct: 12552 SLVVTGLKEGKKYKFRVAARNAVGVS-----------LPREAE----GVYEAKEQLLPPK 12596

Query: 1049  FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRK 1108
                P   T   AG    +   V G P P   W K +  +V      +        L I+ 
Sbjct: 12597 ILMPEQITIK-AGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 12655

Query: 1109  PSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              +  D G Y   A N  GT   + K+ V
Sbjct: 12656 VTRKDSGYYSLTAENSSGTDTQKIKVVV 12683



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 147/655 (22%), Positives = 260/655 (39%), Gaps = 108/655 (16%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E+ SK  E   +  K      T   E +A +  +S+  I  +   Q  TV       F  
Sbjct: 26511 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVI--VTGLQDTTVSSDSVAKFAV 26568

Query: 80    KVKAEDLLRKPTIKWFK--------GKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
             K   E    +PT  W K        GK+     K G  L++ +T    S +YT  ++   
Sbjct: 26569 KATGEP---RPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVK--- 26622

Query: 132   AKDNFAGNYR--CEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELD 189
                N AG+    C++T K   D+ +  +   +++  TP        K++   +E + +  
Sbjct: 26623 ---NSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQ-------KKAVVQEEISQKAL 26672

Query: 190   FSGLLKRREVKQQE------EEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKR 243
              S  +K  E K QE      E  +V + E +K +  +  EK      IT           
Sbjct: 26673 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTS-------- 26724

Query: 244   MRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
                EE ++ A  K       +++G R+     +A    +VKW  NG E+  S +Y +   
Sbjct: 26725 QASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVS 26783

Query: 304   GCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYC---- 355
             G  + L I      D+      +    G  KC  +L        ++K+L D  A+     
Sbjct: 26784 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDL-------TLSKELSDAPAFISQPR 26836

Query: 356   ------GERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
                   G+ V   CE+S E    ++WFKN   I     S   I      + L I  A+ +
Sbjct: 26837 SQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI--SISSNVSISRSRNVYSLEIRNASVS 26894

Query: 409   DAAEYSVMTTG--GQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTK 466
             D+ +Y++      GQ SA  S+      ++ PL ++     +E+ L+     ++ G ++ 
Sbjct: 26895 DSGKYTIKAKNFRGQCSATASL------MVLPLVEEP---SREVVLRTSGDTSLQGSFSS 26945

Query: 467   NGLPVQESDR-----------LKVVHKGRIHKLVIANALTEDEGDYVFAPDAY----NVT 511
               + +  S +              + + +   +   +  +  E     +  ++    N+T
Sbjct: 26946 QSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT 27005

Query: 512   ---------LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
                      L A +  I PPKI  + L +D  +++  G  L +    +GEP P+  WS G
Sbjct: 27006 QLESSTSKMLKAGIRGI-PPKI--EALPSD--ISIDEGKVLTVACAFTGEPTPEVTWSCG 27060

Query: 563   DKAI-MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              + I  +  GR   E+  D +TL+I   ++ D G+Y ++L NE G   A++ + +
Sbjct: 27061 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 93/416 (22%), Positives = 158/416 (37%), Gaps = 58/416 (13%)

Query: 728   SVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANK 787
             +VT   +T+ WRPP   G A +  Y++E             E     + + +E       
Sbjct: 20672 TVTAEKITLLWRPPADDGGAKITHYIVE-----------KRETSRVVWSMVSEH------ 20714

Query: 788   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 847
               +++   T T +    +   RV+AVN  G  EP      +     + P    IP   K 
Sbjct: 20715 --LEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKI 20772

Query: 848   T-------YIRRVGEAVNLVIPF--QGKPRPELTW---KKDGAEIDKNQINIRNSETDTI 895
             T       + R + +  + +  +  + + +  L W    K+     + ++      +D  
Sbjct: 20773 TKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ 20832

Query: 896   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 955
               +     +  G +    +  +F + A      ID PGPP  ++I D    ++ L W+ P
Sbjct: 20833 YRVCAVNAAGQGPFS---EPSEFYKAADP----IDPPGPPAKIRIADSTKSSITLGWSKP 20885

Query: 956   KDDGNAAITGYTIQKADKKSMEWFTVIE--HYHRTSATITELVIGNEYYFRVFSENMCGL 1013
               DG +A+TGY ++    +  EW TV        T   ++ L  G  YYFRV + N  G 
Sbjct: 20886 VYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQ 20945

Query: 1014  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV---NTYAIAGYNATLNCSV 1070
              E   M               N   +  D  EAP     +    +  A AG +  +    
Sbjct: 20946 GEPIEM---------------NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPF 20990

Query: 1071  RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
             +G P P +TW K++  +  D RY + +      L I + +  D G Y     N +G
Sbjct: 20991 KGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVG 21046



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 18/216 (8%)

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRT 988
             ++PG P    I  V  ++  + W PP  DG A I  Y ++K +KK  +W +V  E    T
Sbjct: 24518 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 24577

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFS-EAP 1047
               ++  L+ G EY FRV  EN+ G SE + +++              P+    D   +AP
Sbjct: 24578 VFSVKNLIEGLEYEFRVKCENLGGESEWSEISE--------------PITPKSDVPIQAP 24623

Query: 1048  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFS-NQGVCTLE 1105
              F + L N       NATL C V G+PKP + W +  K  I D  +YR+     G   L 
Sbjct: 24624 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 24683

Query: 1106  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1141
             I   +  D   Y  +A N  G+V     LEV+V A+
Sbjct: 24684 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAK 24719



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 99/438 (22%), Positives = 170/438 (38%), Gaps = 59/438 (13%)

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
             N+  ++  +  S  +  +D  DPP  P    +      + W  P Y GG  I  Y +E++
Sbjct: 15032 NMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKR 15091

Query: 660   KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVPLAVT 718
                + RW++ NF    E  F    + E  AYE R+ A NA G IS PS PS         
Sbjct: 15092 DLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDV 15151

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGA--AGLDGYVLEYCFEGSTSAKQSDENGEAAYD 776
               P  + VD     TV ++      + A  +G     +E+  +G       +  G A  +
Sbjct: 15152 EAPK-IKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDG------KELEGTAKLE 15204

Query: 777   LPAEDWI--VANKDLI--DKTKFTITGLPTD--AKIFVRVKAVNAAGASEPKYYSQPILV 830
             +   D+   + NKD    D   +T+T       AK    VK ++  G  E      P+ V
Sbjct: 15205 IKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-----GPLAV 15259

Query: 831   KEIIE--------PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK 882
              E+          PP            +   G  ++  I  Q +    L W    +E+  
Sbjct: 15260 TEVTSEKCVLSWFPP------------LDDGGAKIDHYI-VQKRETSRLAWTNVASEVQV 15306

Query: 883   NQINI-RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
              ++ + +  + +  IF   A   +     L+           + +     P PP+  ++ 
Sbjct: 15307 TKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-------SEPVLAVNPYGPPDPPKNPEVT 15359

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-----TVIEHYHRTSATITELV 996
              +  +++ + W  P  DG + I  Y +++ DK    W      T+ +  ++ S     L 
Sbjct: 15360 TITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSG----LT 15415

Query: 997   IGNEYYFRVFSENMCGLS 1014
              G+EY FR+ +EN  G+S
Sbjct: 15416 EGHEYEFRIMAENAAGIS 15433



 Score = 89.0 bits (219), Expect = 2e-17
 Identities = 61/198 (30%), Positives = 88/198 (44%), Gaps = 18/198 (9%)

Query: 932  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
            P PP+ VK  D    ++ LTW PPK+DG + I GY +++  + S +W    E    T   
Sbjct: 7283 PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKME 7342

Query: 992  ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP---M 1048
            +T L  G  Y +RV + N  G S+ +  T+E   +               D  EAP   +
Sbjct: 7343 VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAV---------------DTQEAPEIFL 7387

Query: 1049 FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRK 1108
              + L      AG    L  +V G P+PKITW K  + +  D R  + +     T+ I  
Sbjct: 7388 DVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVD 7447

Query: 1109 PSPYDGGTYCCKAVNDLG 1126
                D GTY  +AVN  G
Sbjct: 7448 SKRSDTGTYIIEAVNVCG 7465



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 112/510 (21%), Positives = 197/510 (38%), Gaps = 70/510 (13%)

Query: 648   GSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             G P+    + R        MR N ++  E  T   K+ +   A    I A N+ G +K  
Sbjct: 20197 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 20256

Query: 707   MPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
             +     V L    PPT  + +  +T+ +VT++W PP + G + +  Y+L    +  TS  
Sbjct: 20257 IN---IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIL---LKRETSTA 20310

Query: 766   QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
                E                    + +T   +  L T  +   R+KA N  G S+    S
Sbjct: 20311 VWTEVSAT----------------VARTMMKVMKLTTGEEYQFRIKAENRFGISD-HIDS 20353

Query: 826   QPILVK---EIIEPPKIRIPRHLKQTYI-----RRVGEAVNLVIPF--QGKPRPELTWKK 875
               + VK       PP      ++ +  I       V    + V+ +  + K R  + W+K
Sbjct: 20354 ACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK 20413

Query: 876   DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETA-----SIDIQIID 930
                    N++ IR +        +    S    Y+ +V  +           S  +  ID
Sbjct: 20414 ------ANKLVIRTTH------FKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAID 20461

Query: 931   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTS 989
                PP+ V+I D+   +V+L+W  P  DG + ITGY +++ D     W      +   T 
Sbjct: 20462 ACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQ 20521

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1049
               I+ L   ++Y FRVF+ N  G     +++  S V+         P+    D    P+ 
Sbjct: 20522 FIISGLTQNSQYEFRVFARNAVG-----SISNPSEVVG--------PI-TCIDSYGGPVI 20567

Query: 1050  TQPLVNTYAI---AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
               PL  T  +   AG +  L   + G P P I W K+   +  +    + +   + ++ I
Sbjct: 20568 DLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILI 20627

Query: 1107  RKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             +     + G Y  K  N +G+     ++++
Sbjct: 20628 KDADRLNSGCYELKLRNAMGSASATIRVQI 20657



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 94/359 (26%), Positives = 158/359 (44%), Gaps = 23/359 (6%)

Query: 285  WYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT---AGDEKCST-ELFVREP 340
            W K+G  IR S K+ F   G  R L I + Q++D  EY         EK ST +L V E 
Sbjct: 4846 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 4905

Query: 341  PIMVTKQL-EDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHI 399
            P+   K L E+ T   G+ + L CE+++ + +V W K+G+ ++  P  R    V G    
Sbjct: 4906 PVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKP-GRIVPGVIGLMRA 4963

Query: 400  LIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL-----TPLTDQTVNLGKEICLKC 454
            L I  A   DA  Y+V T    ++ + S  +K ++++      P+ DQ V         C
Sbjct: 4964 LTINDADDTDAGTYTV-TVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 5022

Query: 455  EISENIPG-KWTK--NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 511
            +I+++ P  KW K  + +P + +D+ +++  G    L I NA+ ED  +Y  A +     
Sbjct: 5023 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEY--AVEIEGKR 5080

Query: 512  LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             PAK+ + +    +L  ++    VT+        +  IS    P     +G+  ++  S 
Sbjct: 5081 YPAKLTLGEREVELLKPIE---DVTIYEKESASFDAEISEADIPGQWKLKGE--LLRPSP 5135

Query: 572  RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                ++      L +   + D +G       N    A  ++K   +DF  P    TV E
Sbjct: 5136 TCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPE 5194



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 78/292 (26%), Positives = 125/292 (42%), Gaps = 60/292 (20%)

Query: 265   DKGGRVRFV--VELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             ++GG V++V  +E  D   +V WY   +++  S KY   ++    IL++ +    DD  Y
Sbjct: 25275 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 25334

Query: 323   YVTA----GDEKCSTELFVR---------------------------EPPIMVTKQLEDT 351
                     G++    ELFV+                           E P   T  L + 
Sbjct: 25335 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 25394

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK-SRYRIRVEGKKHILIIEGATKAD 409
             TAY GE V     ++   + +V W+K+G++I PG    +Y    +   + L I   T  D
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25454

Query: 410   AAEYSVMTTG--GQSS--AKLSVDLKPLKILTPLTDQTV-------------NLGKEICL 452
              AEY+V+     G+ S  AKL+V L P     P TD T+               G+ +C 
Sbjct: 25455 DAEYTVVARNKYGEDSCKAKLTVTLHP-----PPTDSTLRPMFKRLLANAECQEGQSVCF 25509

Query: 453   KCEISENIPG--KWTKNGLPVQESDRLKVVHKG-RIHKLVIANALTEDEGDY 501
             +  +S   P   KW K+G P+     ++++H+G   + L I + L ED G Y
Sbjct: 25510 EIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 25561



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 115/472 (24%), Positives = 174/472 (36%), Gaps = 92/472 (19%)

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R  AVN   + KP  P+ P            L ++ +T    ++ W  P   G A +D Y
Sbjct: 19566 RSVAVNCKVLDKPGPPAGP------------LEINGLTAEKCSLSWGRPQEDGGADIDYY 19613

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             ++E             E    A       W +   +L   T   +T L    +   RV  
Sbjct: 19614 IVE-----------KRETSHLA-------WTICEGEL-QMTSCKVTKLLKGNEYIFRVTG 19654

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
             VN  G  EP    + + +K +        P  L+ T + +  E++ L        RPE  
Sbjct: 19655 VNKYGVGEPL---ESVAIKALDPFTVPSPPTSLEITSVTK--ESMTLCWS-----RPE-- 19702

Query: 873   WKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI---- 928
                 G+EI    I  R  E +++ ++R  ++     YDL+VK     E    + ++    
Sbjct: 19703 -SDGGSEISGYIIERR--EKNSLRWVRVNKKP---VYDLRVKSTGLREGCEYEYRVYAEN 19756

Query: 929   -------------------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
                                +  P PP   KI D     + + W  P  DG A ITGYT++
Sbjct: 19757 AAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVE 19816

Query: 970   KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
                    +W T I+    T  TI+ L  G EY FRV S N  G S+ +  +        D
Sbjct: 19817 YKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSS--------D 19868

Query: 1030  GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
              +I K    E     ++ M    +V     AG + T+    RG P P + W K       
Sbjct: 19869 PQIAKEREEEPLFDIDSEMRKTLIVK----AGASFTMTVPFRGRPVPNVLWSKPDT---- 19920

Query: 1090  DPRYRMF--SNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
             D R R +  +     +L I   +  D G Y     N L    +   L VKV+
Sbjct: 19921 DLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASL--TLVVKVL 19970



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 128/602 (21%), Positives = 222/602 (36%), Gaps = 112/602 (18%)

Query: 581   SSTLVIDIAERDDSGV--YHINLKNEAGEAH----ASIKVKV------VDFPDPPVAPTV 628
             S T  I++++  +  V  + +  KNE G +       I VK       VD  D P A   
Sbjct: 21210 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVT 21269

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEG 687
               +G +   ++ E P      P + +  +    + S ++R +    K T + +  K   G
Sbjct: 21270 VRIGHN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHG 21326

Query: 688   VAYEVRI--------FAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
               Y V +          +  I +  PS P  P            +  D +   +V + W 
Sbjct: 21327 GKYTVILDNAVCRIAVPITVITLGPPSKPKGP------------IRFDEIKADSVILSWD 21374

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P+  G   +  Y +E      T+ K    +                   + +T F +  
Sbjct: 21375 VPEDNGGGEITCYSIEKRETSQTNWKMVCSS-------------------VARTTFKVPN 21415

Query: 800   LPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 859
             L  DA+   RV+A N  G S      QP++   I+   + RIP           G+ V  
Sbjct: 21416 LVKDAEYQFRVRAENRYGVS------QPLVSSIIVAKHQFRIPGP--------PGKPVIY 21461

Query: 860   VIPFQGKPRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERSHSGK------- 908
              +   G     LTW       G+E+     ++   E ++I++ +      SG+       
Sbjct: 21462 NVTSDGM---SLTWDAPVYDGGSEV--TGFHVEKKERNSILWQKVNTSPISGREYRATGL 21516

Query: 909   -----YDLQVKVDKFVETAS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 955
                  Y  +V  +     +S        + +  +D PG P  +   DV  E + L W PP
Sbjct: 21517 VEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPP 21573

Query: 956   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
               DG + I GY+I+K                    T+T L  G+ Y FR+ + N  G   
Sbjct: 21574 LRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTIS 21633

Query: 1016  DATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPK 1075
               + +    ++ RD  +   P   +F     P +   L+     +G +  +   V+G P 
Sbjct: 21634 PPSQSS-GIIMTRDENV---PPIVEF----GPEYFDGLIIK---SGESLRIKALVQGRPV 21682

Query: 1076  PKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLE 1135
             P++TW K+ V I       +    G  +L +R  +    G Y  +A N  G+ + E K++
Sbjct: 21683 PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVK 21742

Query: 1136  VK 1137
             V+
Sbjct: 21743 VQ 21744



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 203/971 (20%), Positives = 332/971 (34%), Gaps = 208/971 (21%)

Query: 259   DPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMT 317
             D  Y   +    R  + +   P   V W K    +   T+   E       L + +CQ +
Sbjct: 13684 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 13743

Query: 318   DDSEYYVT----AGDEKCSTELFVREPPIMVTKQL--EDTTAYC------------GERV 359
             D  +Y +T    AG ++ +  + V   P + T  +  ++ TA              G  +
Sbjct: 13744 DAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEI 13803

Query: 360   ELECEVSEDDANVKWFKNGEEIIPGPKSRYRI-----------RVEGKKHILIIEGATKA 408
                     D  N KW      +    K+ +R+           RV  +    + EG    
Sbjct: 13804 TNYILEKRDSVNNKWVTCASAV---QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSE 13860

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC-LKCEISENIPGKWTK- 466
                                VD++   +    TD     G  I     E  E     W + 
Sbjct: 13861 PIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA 13920

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL 526
             N  P++  D  KV              LTE   +Y F   A N+    K  +   P + L
Sbjct: 13921 NKTPIRMRD-FKVT------------GLTEGL-EYEFRVMAINLAGVGKPSLPSEPVVAL 13966

Query: 527   DGLDAD----------NTVTVI-------AGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             D +D            N+VT+I        G+KL   I    + P K+ W + +      
Sbjct: 13967 DPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS-WMKANHV---- 14021

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYH--INLKNEAGEAHA-SIKVKVVDFPDPPVAP 626
                    + P+ +  V D+ E    G Y   I  KN AG   A S   + +   D   AP
Sbjct: 14022 -------NVPECAFTVTDLVE---GGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 14071

Query: 627   TVTEVGDDWCIMNWEPPAYDG-----GSPIL--GYFIERKKKQSSRWMRLNFDL----CK 675
             T+            +P   DG     G  I+     I  K    S W +   D+      
Sbjct: 14072 TIV----------LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDIT 14121

Query: 676   ETTFEPKKMIEGVAYEVR-------IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             + T  P   +  + Y  R       I A N  G     +       L V  PP  + + +
Sbjct: 14122 QITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPVEISN 14178

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
             V+    T+ W PP   G + +  Y+LE   +  TS                  W V ++D
Sbjct: 14179 VSAEKATLTWTPPLEDGGSPIKSYILE---KRETSRLL---------------WTVVSED 14220

Query: 789   LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT 848
              I   +   T L    +   RV AVN  G  EP   S+P+ + +   PP           
Sbjct: 14221 -IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEP-VQSEPVKMVDRFGPP----------- 14267

Query: 849   YIRRVGEAVNLVIPFQGKPRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERS 904
                  G      +    K    ++WK+     G+EI    +  R  E  ++ ++R  +  
Sbjct: 14268 -----GPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERR--EKKSLRWVRAIKTP 14320

Query: 905   HSGKYDLQVKVDKFVETASIDIQIIDR-----------------------PGPPQIVKIE 941
              S   DL+ KV    E ++ + ++                          PGPP    + 
Sbjct: 14321 VS---DLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVT 14377

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN-- 999
             D   ++ +L W  P  DG   ITGY ++        W   I+    T+  IT+ V+ +  
Sbjct: 14378 DTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAW---IKDTTGTALRITQFVVPDLQ 14434

Query: 1000  ---EYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
                +Y FR+ + N  G+ E A +         D +I +  +  DF+          L  T
Sbjct: 14435 TKEKYNFRISAINDAGVGEPAVIP--------DVEIVEREMAPDFELDAE------LRRT 14480

Query: 1057  YAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1115
               + AG +  +   ++G P P++TW K+ + + +  R  + + +    L I + + YD G
Sbjct: 14481 LVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTG 14538

Query: 1116  TYCCKAVNDLG 1126
              +     N  G
Sbjct: 14539 KFVMTIENPAG 14549



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 105/480 (21%), Positives = 179/480 (37%), Gaps = 70/480 (14%)

Query: 672   DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTD 731
             D C+E        +   A E  I  +N I + KP  P+ P            + +D VT 
Sbjct: 15904 DACREDVGHYVVKLTNSAGEA-IETLNVIVLDKPGPPTGP------------VKMDEVTA 15950

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLID 791
              ++T+ W PP + G + ++ Y++E                    D     W + +   + 
Sbjct: 15951 DSITLSWGPPKYDGGSSINNYIVE------------------KRDTSTTTWQIVSAT-VA 15991

Query: 792   KTKFTITGLPTDAKIFVRVKAVNAAGAS-----EPKYYSQPILVKEIIEPPKIRIPRH-- 844
             +T      L T  +   R+ A N  G S     EP     P  V      P + +     
Sbjct: 15992 RTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDS 16051

Query: 845   LKQTYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAE 902
             ++  +   + +  + VI +  + K R  + W K    ++K  I     +T  +    + E
Sbjct: 16052 MEVQWNEPISDGGSRVIGYHLERKERNSILWVK----LNKTPIPQTKFKTTGLEEGVEYE 16107

Query: 903   RSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAA 962
                S +  + +     V    +     D PG P+ + +      +V L W  P  DG + 
Sbjct: 16108 FRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTR---NSVTLQWKKPTYDGGSK 16164

Query: 963   ITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGL-SEDATMT 1020
             ITGY ++K +     W      +   T   +T LV  + Y FRV + N  G+ SE +  T
Sbjct: 16165 ITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSEST 16224

Query: 1021  KESAVIARDG----KIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1076
                A+ ARD     +I  +P Y+D                   AG +  ++  + G P P
Sbjct: 16225 --GAITARDEVDPPRISMDPKYKD--------------TIVVHAGESFKVDADIYGKPIP 16268

Query: 1077  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              I W+K    + +  R  + S     +L ++     D G Y  KA N  G   +   ++V
Sbjct: 16269 TIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 16328



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 100/435 (22%), Positives = 171/435 (39%), Gaps = 65/435 (14%)

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
             PP  + +D V+  ++T+ W PP++ G   +  Y++E     ST+                
Sbjct: 19185 PPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT---------------- 19228

Query: 780   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP-- 837
               W + ++  + +T   I  L T ++   RV A N  G S     S  ++ +    PP  
Sbjct: 19229 --WHIVSQ-AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGP 19284

Query: 838   --KIRIPRHLKQTYIRR----VGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRN 889
                 ++    K T +      V +  + VI +  + K R  + W K       N+I I  
Sbjct: 19285 PGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSK------ANKILI-- 19336

Query: 890   SETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII------DRPGPPQIVKIEDV 943
                DT + +   +     +Y +  +    +   S   + +      D PG P++  I   
Sbjct: 19337 --ADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITR- 19393

Query: 944   WGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYY 1002
               ++V+L W+ P  DG A ITGY +++ +     W      +   T   +TEL     Y 
Sbjct: 19394 --KSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYE 19451

Query: 1003  FRVFSENMC-GLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1061
             FRVF+ N    +SE +  T    +I +D  +    V  D  F +  +           AG
Sbjct: 19452 FRVFARNAADSVSEPSEST--GPIIVKDD-VEPPRVMMDVKFRDVIVVK---------AG 19499

Query: 1062  YNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1121
                 +N  + G P P I+W K+ + I +  R  + S      L ++     D G Y    
Sbjct: 19500 EVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTL 19559

Query: 1122  VNDLGT--VEIECKL 1134
              N  GT  V + CK+
Sbjct: 19560 KNVAGTRSVAVNCKV 19574



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 100/460 (21%), Positives = 169/460 (36%), Gaps = 78/460 (16%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  + +  P  P  PF             +  +     ++ W  P   G + +  Y++E 
Sbjct: 12679 IKVVVMDAPGPPQPPF------------DISDIDADACSLSWHIPLEDGGSNITNYIVEK 12726

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
             C                  D+   DW+ A    + KT   +  L    +   RV+A N  
Sbjct: 12727 C------------------DVSRGDWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRF 12767

Query: 817   GASEPKYYSQPILVKEI-----IEPPKIRIPRHLKQ----TYIRRVGEAVNLVIPF--QG 865
             G SEP   + P +V +       EP   R+ +  K      + R   +  + +I +  + 
Sbjct: 12768 GISEP--LTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIER 12825

Query: 866   KPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERS------HSGKYDLQVKVDKFV 919
             K R  L W K       N   +R++E      +   E S      +        K  ++V
Sbjct: 12826 KERNSLLWVK------ANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV 12879

Query: 920   ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
              TA + +   D PG P+++   DV    V+L W  PK DG + I GY ++       +W 
Sbjct: 12880 -TARMPV---DPPGKPEVI---DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWV 12932

Query: 980   ---TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
                T      +   T T L    +Y FR  +     +S  +  +    ++A +      P
Sbjct: 12933 RCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV-----P 12987

Query: 1037  VYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMF 1096
                D   +   + T         AG N  L+ +V G P P ++W K+   +      +M 
Sbjct: 12988 PRIDLSVAMKSLLTVK-------AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMA 13040

Query: 1097  SNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               + +CTLE+   +  D G Y   A N  G+     KL+V
Sbjct: 13041 MQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 13080



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 21/194 (10%)

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTE-------SYPDSSTLVIDIAERDDSGVYHI 599
            + +  EPP         + ++E   R+ T        + PD +  V D+ E  +   + +
Sbjct: 7895 VDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQ-FQV 7953

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPVAPT------VTEVGDDWCIMNWEPPAYDGGSPILG 653
              +NEAG  H S   +++   DP   P+      VT+ G     + W+PP  +GGSPI+G
Sbjct: 7954 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 8013

Query: 654  YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVA----YEVRIFAVNAIGISKPSMPS 709
            Y +E     + +WMR+N    K+  F   K+ EGV     Y +R+ AVNAIG+S+PS  S
Sbjct: 8014 YHVEMCPVGTEKWMRVNSRPIKDLKF---KVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 8070

Query: 710  RPFVPLAVTSPPTL 723
               V       PT+
Sbjct: 8071 ENVVAKDPDCKPTI 8084



 Score = 80.9 bits (198), Expect = 6e-15
 Identities = 77/261 (29%), Positives = 107/261 (40%), Gaps = 22/261 (8%)

Query: 464  WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
            W K+G  V+ SDRL + +      L +  ++  D G Y    +    + T    V VI  
Sbjct: 8115 WHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGL 8174

Query: 522  PKIILDGLDADNTVTVIAGNKLRLEIP--ISGEPPPKAMWSRGDKA------IMEGSGRI 573
            P    D   +D T    +  KL  E P    G P    +  R +        +M G  ++
Sbjct: 8175 PGPCKDIKASDITK---SSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKL 8231

Query: 574  R---TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                 +  P+        A     G  +I LKN        I       PDPPV   V  
Sbjct: 8232 SWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPV------IAQDPKQPPDPPVDVEVHN 8285

Query: 631  VGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAY 690
               +   + W+PP YDGGS I+GY IE+  K   RW R N  L    T+  K + EG  Y
Sbjct: 8286 PTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEY 8345

Query: 691  EVRIFAVNAIGISKPSMPSRP 711
            + R+ A NA GIS+PS  + P
Sbjct: 8346 QFRVRAENAAGISEPSRATPP 8366



 Score = 77.8 bits (190), Expect = 5e-14
 Identities = 66/264 (25%), Positives = 116/264 (43%), Gaps = 27/264 (10%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEI----RPSTKYIFEHKGCQRILFINNCQMTD 318
            QV +  R     E+ +  ++  WYK+G EI    +   KY+ E +     +FI+  + +D
Sbjct: 3111 QVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR--IHRMFISETRQSD 3168

Query: 319  DSEYYVTAGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFK 376
              EY   AG  + S  L+V  P P  V ++L+  T   G+       +S      + W+K
Sbjct: 3169 AGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYK 3228

Query: 377  NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA--------EYSVMTTGGQSSAKL-- 426
              + +  G K ++    +G+++ L++  A   DAA        +Y V TT    S ++  
Sbjct: 3229 EEQLLSTGFKCKF--LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286

Query: 427  ------SVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKV 479
                   + + P  I+TPL D   + G+    +C +S  ++   W      ++ S   ++
Sbjct: 3287 VVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3346

Query: 480  VHKGRIHKLVIANALTEDEGDYVF 503
                  ++L IA A  EDEG Y F
Sbjct: 3347 TQFEDTYQLEIAEAYPEDEGTYTF 3370



 Score = 77.8 bits (190), Expect = 5e-14
 Identities = 104/452 (23%), Positives = 164/452 (36%), Gaps = 62/452 (13%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             ++ I + KP  P  P            +  D V+   V + W PP + G   +  Y++E 
Sbjct: 18092 LSVIVLEKPGPPVGP------------VRFDEVSADFVVISWEPPAYTGGCQISNYIVE- 18138

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                                D     W + +   + +T   IT L T  +   R+ A N  
Sbjct: 18139 -----------------KRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRY 18180

Query: 817   GASEPKYYSQPILV----KEIIEPPKIRIPRHLKQTYIRRVGEAVN------LVIPFQGK 866
             G S P   S+ ++V    KE   P    +    K   + +  E VN      +    + K
Sbjct: 18181 GKSAP-LDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQK 18239

Query: 867   PRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDI 926
              +  + W K    ++K  I     +T  +    + E   S +  + +     V    +  
Sbjct: 18240 EKNSILWVK----LNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 18295

Query: 927   QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHY 985
                D PG P+ + I      NV L W  P  DG + ITGY ++K D     W      + 
Sbjct: 18296 DPCDPPGRPEAIVITR---NNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 18352

Query: 986   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1045
               T  T++ LV    Y FRV + N  G   + +     A+ ARD     N   +      
Sbjct: 18353 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPS-DSSGAITARDEIDAPNASLD------ 18405

Query: 1046  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-PRYRMFSNQGVCTL 1104
              P +   +V     AG    L   +RG P P + W K+   + +   R  + S     TL
Sbjct: 18406 -PKYKDVIV---VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTL 18461

Query: 1105  EIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              ++     DGG Y  K  N  GT  I   ++V
Sbjct: 18462 VVKDCIRTDGGQYILKLSNVGGTKSIPITVKV 18493



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 102/462 (22%), Positives = 169/462 (36%), Gaps = 81/462 (17%)

Query: 696   AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             ++  + + KP  P  P            +  D V+  ++T+ W PP + G   +  Y+++
Sbjct: 17009 SIEIVTLDKPDPPKGP------------VKFDDVSAESITLSWNPPLYTGGCQITNYIVQ 17056

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
                                 D     W V +   + +T   +T L T  +   R+ A N 
Sbjct: 17057 ------------------KRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFAENR 17097

Query: 816   AGASEPKYYSQPILVKEIIE---PPKIRIPRHL-KQTYIRRVGEAVN------LVIPFQG 865
              G S     S PI+ +   +   PP       + K + + +  E VN      +    + 
Sbjct: 17098 YGQSFA-LESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLER 17156

Query: 866   KPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG-KYDLQVKVDKFVETAS- 923
             K R  + W K    ++K  I+      DT     KA+    G +Y+ +V  +  V     
Sbjct: 17157 KERNSILWTK----VNKTIIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVGKA 17203

Query: 924   -------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                    +     D PG P+ + ++      + L WT P  DG + ITGY ++K D    
Sbjct: 17204 SKNSECYVARDPCDPPGTPEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLPDG 17260

Query: 977   EWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCG-LSEDATMTKESAVIARDGKIYK 1034
              W      +   T  T++ L     Y FRV ++N  G +S+ +  T         G I  
Sbjct: 17261 RWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDST---------GPITA 17311

Query: 1035  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
                 E    S  P F   +V     AG    L   V G P P I W++    I +  R  
Sbjct: 17312 KDEVELPRISMDPKFRDTIVVN---AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCE 17368

Query: 1095  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             + +      L ++     DGG Y  +A N  G+      ++V
Sbjct: 17369 IKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKV 17410



 Score = 77.0 bits (188), Expect = 9e-14
 Identities = 106/469 (22%), Positives = 169/469 (36%), Gaps = 97/469 (20%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  I + KP  P+ P            + +D +  T++T+ W PP+  G A L GYV+E 
Sbjct: 23519 IKVIILDKPGPPTGP------------IKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 23566

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                                D     W+  ++  + ++ F  T L    +   RV A N  
Sbjct: 23567 ------------------RDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRF 23607

Query: 817   GASEPKYYSQPILVKEIIE-PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW-- 873
             G           L  E+IE    IRIP           G    L I    +    LTW  
Sbjct: 23608 GIGS-------YLQSEVIECRSSIRIP-----------GPPETLQIFDVSRDGMTLTWYP 23649

Query: 874   -KKDGAE------IDKNQINIR-----NSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
              + DG        +++ ++        N    T+   R    +   +Y+ +V       +
Sbjct: 23650 PEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGS 23709

Query: 922   AS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                       + +  I  PG PQ  ++ D    +V+L W+ P+D+G + +TGY I+    
Sbjct: 23710 GKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKV 23769

Query: 974   KSMEWF------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIA 1027
                EW       T I  Y     T+T L  G EY FRV + N  G  E A        + 
Sbjct: 23770 DQHEWTKCNTTPTKIREY-----TLTHLPQGAEYRFRVLACNAGGPGEPAE-------VP 23817

Query: 1028  RDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAI 1087
                K+ +   Y D++  E     +     +   G    L   ++G P P   W K    I
Sbjct: 23818 GTVKVTEMLEYPDYELDE-----RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI 23872

Query: 1088  VDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                 R  + +++    L I++    D GTY     N  G   +  K+ V
Sbjct: 23873 --SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRV 23919



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 64/235 (27%), Positives = 91/235 (38%), Gaps = 46/235 (19%)

Query: 932  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT-SA 990
            P PP  V++ +   E + +TW PP  DG + I GY I+K  K    W    EH     + 
Sbjct: 8275 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 8334

Query: 991  TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1050
            T   L  G EY FRV +EN  G+SE +  T  +  +            +  D  +  + T
Sbjct: 8335 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAV------------DPIDAPKVILRT 8382

Query: 1051 QPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-------PRYRM-------- 1095
               V      G    L+ S+ G+P P ITW+K++  IV +       P  R         
Sbjct: 8383 SLEVKR----GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEE 8438

Query: 1096 --------------FSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                           S +G   L +R     D G Y  K  ND G  +  C + V
Sbjct: 8439 EPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8493



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 59/203 (29%), Positives = 83/203 (40%), Gaps = 14/203 (6%)

Query: 926   IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY 985
             ++  + P PP  + I D+    V+L W  PK DG + ITGY I+   K S +W T I   
Sbjct: 14654 VKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTV 14712

Query: 986   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1045
                   +  L  G EY F+V + N  G S      +ES  +     + +  +  + D   
Sbjct: 14713 KGLECVVRNLTEGEEYTFQVMAVNSAGRSAP----RESRPVI----VKEQTMLPELDLRG 14764

Query: 1046  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1105
                  Q LV   A AG N  +   V G PKP +TW K    +    R    +      L 
Sbjct: 14765 ---IYQKLV--IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILN 14819

Query: 1106  IRKPSPYDGGTYCCKAVNDLGTV 1128
             I +    D G Y   A N +G V
Sbjct: 14820 INECVRSDSGPYPLTARNIVGEV 14842



 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 13/197 (6%)

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             ++P PP+ + + D    +  L W  P  DG + ITGY ++   K S  W     H  + +
Sbjct: 22239 EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLT 22297

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1049
              T+  LV   EY FRV ++N  G SE       S+VI ++ +I           ++    
Sbjct: 22298 FTVERLVEKTEYEFRVKAKNDAGYSEPREAF--SSVIIKEPQIEPT--------ADLTGI 22347

Query: 1050  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1109
             T  L+   A  G   T++  + G P PK+TW   ++ + +  R  + + +   TL ++  
Sbjct: 22348 TNQLITCKA--GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22405

Query: 1110  SPYDGGTYCCKAVNDLG 1126
                D G Y     N  G
Sbjct: 22406 MRGDSGRYFLTLENTAG 22422



 Score = 72.4 bits (176), Expect = 2e-12
 Identities = 56/222 (25%), Positives = 101/222 (45%), Gaps = 17/222 (7%)

Query: 918   FVETASIDI--QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKS 975
             FVET+   +  + I  P  P+ +++++V    V LTW PPK DG + I  Y ++     +
Sbjct: 10396 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGT 10455

Query: 976   MEWFTVI-EHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
              ++  V  ++      T+  L  G+ Y +RV + N+ G  + +  TK    I    ++  
Sbjct: 10456 EKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKP---ITCKDELAP 10512

Query: 1035  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
               ++ DF        T  +   +A+ G  +       G PKPK++W K++  +++D R  
Sbjct: 10513 PTLHLDF----RDKLTIRVGEAFALTGRYS-------GKPKPKVSWFKDEADVLEDDRTH 10561

Query: 1095  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             + +      LE  K    D G YC    N  G+ +  C++ V
Sbjct: 10562 IKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 10603



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 134/663 (20%), Positives = 230/663 (34%), Gaps = 120/663 (18%)

Query: 2     PEPTKKEENEVPAP----APPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLS 57
             PEP  K    V +P    +P P  P       T P        TP  + Q    +     
Sbjct: 26364 PEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP--------TPTEKVQHLPVSAPPKI 26415

Query: 58    ILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFE 117
               F++       +  ++I  +  V    +LR   + W+K          GK L+    F+
Sbjct: 26416 TQFLK------AEASKEIAKLTCVVESSVLRAKEVTWYKD---------GKKLKENGHFQ 26460

Query: 118   RH-SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFK 176
              H S   T+E++I    ++  G Y CE+                                
Sbjct: 26461 FHYSADGTYELKINNLTESDQGEYVCEI-------------------------------- 26488

Query: 177   RSGEGQEDAGELDFSG---------LLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF 227
              SGEG      L F G         + K  E K+ +++       + +  +P   E I+ 
Sbjct: 26489 -SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTEST--VTRKTEPKAPEPIS- 26544

Query: 228   QYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYK 287
                                   K      + D     D   +   V    +P+    W K
Sbjct: 26545 ---------------------SKPVIVTGLQDTTVSSDSVAKFA-VKATGEPRPTAIWTK 26582

Query: 288   NGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT----AGDEKCSTELFVREPPIM 343
             +G+ I    KY          L I+    +D   Y  T    AG    S +L ++   I 
Sbjct: 26583 DGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--IK 26640

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
              T+  + +T    E    +  V +++ + K  ++ E  +   KS+ ++ ++ +   ++I 
Sbjct: 26641 DTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLIS 26700

Query: 404   GATKADAA---EYSVMTTGGQSSAKLSVDLKP-LKILTPLTDQTVNLGKEICLKCEISEN 459
                K  AA   E S++      +++ S +++   +I    T  ++N G+ + LK  I+  
Sbjct: 26701 EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA 26760

Query: 460   IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--------FAPDAYNVT 511
                KW  NG+ +  S+  +    G    L I  A   DEG                Y++T
Sbjct: 26761 TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLT 26820

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             L  ++   D P  I        +  +  G  +     ISGEP P+  W + +  I   S 
Sbjct: 26821 LSKELS--DAPAFI----SQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISS 26873

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
              +      +  +L I  A   DSG Y I  KN  G+  A+  + V+   + P    V   
Sbjct: 26874 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRT 26933

Query: 632   GDD 634
               D
Sbjct: 26934 SGD 26936



 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 107/465 (23%), Positives = 175/465 (37%), Gaps = 76/465 (16%)

Query: 696   AVNAIGISKPSMPSR-PFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVL 754
             A NA G +K  +  +    P  V  P   +   ++T   +T+ W  P + G A +  Y++
Sbjct: 21728 AKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWWDAPLNDGCAPITHYII 21784

Query: 755   EYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN 814
             E             E    A+ L         +D  +   +T   L    +   RV AVN
Sbjct: 21785 E-----------KRETSRLAWALI--------EDKCEAQSYTAIKLINGNEYQFRVSAVN 21825

Query: 815   AAGASEPKYYSQPILVK---EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 871
               G   P   S P++ +    + + P I  P ++        G ++ L        RPE 
Sbjct: 21826 KFGVGRP-LDSDPVVAQIQYTVPDAPGIPEPSNI-------TGNSITLTWA-----RPE- 21871

Query: 872   TWKKDGAEIDKNQINIRNSE-TDTIIFIRKAERSHS----------GKYDLQVKVDKF-- 918
                  G+EI +  +  R  + T  +  I K   S +           +Y+  V  +    
Sbjct: 21872 --SDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 21929

Query: 919   VETASIDIQII------DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 972
             V  AS   ++I      + PGPP +VK+ D     V+L W+ P  DG   I GY I+   
Sbjct: 21930 VGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCK 21989

Query: 973   KKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1031
                 +W  V  E   +T  T+T+L  G EY FRV + N  G  +   +T     I    +
Sbjct: 21990 ADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVT---GTIKAVDR 22046

Query: 1032  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1091
             +    +  D +F +  +           AG +  L  + +G P P   W K    +    
Sbjct: 22047 LTAPELDIDANFKQTHVVR---------AGASIRLFIAYQGRPTPTAVWSKPDSNL--SL 22095

Query: 1092  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             R  + +     TL +   +  D G Y     N+ G+  I   ++V
Sbjct: 22096 RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKV 22140



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 19/303 (6%)

Query: 341  PIMVTKQLEDT----TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
            P+   K+++D     + + G     EC VS   A   W K+G  I   PK  +R   +GK
Sbjct: 4809 PLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPK--HRFIADGK 4866

Query: 397  KHILIIEGATKADAAEYSVMTTGGQ----SSAKLSVDLKPLKILTPLTDQ-TVNLGKEIC 451
               L I     +DA EY+ +   G     S+AKL V+  P++ +  L ++ TV  G+ + 
Sbjct: 4867 DRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 4926

Query: 452  LKCEISENIPGKWTKNG-LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYN 509
            L CE+++     W K+G + V++  R+     G +  L I +A   D G Y V   +A N
Sbjct: 4927 LSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANN 4986

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
            +   + V V++   +I D L        +      +      +  P   W +G   I   
Sbjct: 4987 LECSSCVKVVE---VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI-PA 5042

Query: 570  SGRIRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
                +TE   D + L + I  A  +D   Y + ++ +   A  ++  + V+   P    T
Sbjct: 5043 EPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVT 5102

Query: 628  VTE 630
            + E
Sbjct: 5103 IYE 5105



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 31/92 (33%), Positives = 43/92 (46%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
            P     L N   I G + TL C + G P P +TW +    I     +++    G+  L I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1107 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
            R+    D G + C AVN+ GTV   C L V+V
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 988



 Score = 61.2 bits (147), Expect = 5e-09
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 931   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH-YHRTS 989
             RP PP++ K+     E + + W PP+ DG  +ITGY ++K +K S  W  V +       
Sbjct: 12093 RPDPPEVTKVSK---EEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERR 12149

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
               +  L+  +EY FRV +EN  G+ E +  ++   V+A+D
Sbjct: 12150 MKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR--PVVAKD 12187



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/324 (22%), Positives = 129/324 (39%), Gaps = 19/324 (5%)

Query: 829  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID----- 881
            L +E   P +   P  + +  ++++ E  ++V   Q  G P+P + WKK G  +      
Sbjct: 1023 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 882  KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
            K   N +  E   +I +  A+   +G+Y + V+ +K  ET S    +++      ++K +
Sbjct: 1083 KVSYNKQTGECKLVISMTFAD--DAGEYTIVVR-NKHGET-SASASLLEEADYELLMKSQ 1138

Query: 942  DVWGENVALTWTPPKDDGNAAITGYTIQKADKK-SMEWFTVIEHYHRTSATITELVIGNE 1000
                    +T    +        G+   + +K+   E   + +   + +  +   V   E
Sbjct: 1139 QEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQE 1198

Query: 1001 YYFRVFSENMCGLSEDATM-TKESAVIARDGKIYKNPVYEDFDFSEAPM--FTQPLVNTY 1057
            ++   F E +    E   + T    ++  DG+     +  D   SEA    F   + N  
Sbjct: 1199 FHISSFEERLIKEIEYRIIKTTLEELLEEDGE---EKMAVDISESEAVESGFDSRIKNYR 1255

Query: 1058 AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRM-FSNQGVCTLEIRKPSPYDGGT 1116
             + G   T +C + G P PKI W K+   I    RY+M F   G  +L I    P D G 
Sbjct: 1256 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1315

Query: 1117 YCCKAVNDLGTVEIECKLEVKVIA 1140
            Y   A N  G      KL V+  A
Sbjct: 1316 YTAFASNIKGNAICSGKLYVEPAA 1339



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 96/426 (22%), Positives = 148/426 (34%), Gaps = 58/426 (13%)

Query: 717   VTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAY 775
             +  PPT  +  D V+   VT  W PP++ G   +  YV+E     ST+            
Sbjct: 14853 IPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTT------------ 14900

Query: 776   DLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 835
                   W+     +I +T +  T L T  +   RVKA N  G   P   S  I+      
Sbjct: 14901 ------WVELATTVI-RTTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANY--- 14949

Query: 836   PPKIRIPRHLKQ-TYIRRVGEAVNLVIPF------------QGKPRPELTWKKDGAEIDK 882
             P K+  P    Q T + +    ++   P             + K R  + W+     +  
Sbjct: 14950 PFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVP 15009

Query: 883   NQINIRNSETDTIIF-IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
               I   +  TD I +  R    + +GK     K  K  E   + +  ID PG P  + I 
Sbjct: 15010 GNIFKSSGLTDGIAYEFRVIAENMAGKS----KPSKPSEPM-LALDPIDPPGKPVPLNIT 15064

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNE 1000
                   V L W  P+  G   IT Y ++K D  +  W      +      T++ L     
Sbjct: 15065 R---HTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAA 15121

Query: 1001  YYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIA 1060
             Y FRV ++N  G     +   ++     D +  K  V  D  F +  +           A
Sbjct: 15122 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKV--DVKFKDTVILK---------A 15170

Query: 1061  GYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1120
             G    L   V G P P + W K+   +    +  +        L  +  +  D G Y   
Sbjct: 15171 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 15230

Query: 1121  AVNDLG 1126
             A N  G
Sbjct: 15231 ATNPGG 15236



 Score = 57.4 bits (137), Expect = 8e-08
 Identities = 95/406 (23%), Positives = 148/406 (36%), Gaps = 54/406 (13%)

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             I AVN +G +   M       L    PP   +  +SV+   +T+ W PP   G + +  Y
Sbjct: 9891  ITAVNNLGTASKEMRLNV---LGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNY 9947

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             V+E                    +   + W+  + +  + T +TI  L    +   R+ A
Sbjct: 9948  VIE------------------KREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMA 9988

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP-FQGKPRPEL 871
              N  G  EP   S+P   + +   P    P     + + R    VN   P + G      
Sbjct: 9989  QNKYGIGEP-LDSEPETARNLFSVPGA--PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG 10045

Query: 872   TW--KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF----VETASID 925
              W   KD       ++N    +  T+    K      G  D Q +V       V  AS+ 
Sbjct: 10046 YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGS-DYQFRVYAINAAGVGPASLP 10104

Query: 926   IQI------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
                      I  PGPP   K+ D    +  L W+PP  DG + +TGY ++  ++   EW 
Sbjct: 10105 SDPATARDPIAPPGPP-FPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWE 10163

Query: 980   TVIEHYHR-TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1038
                +   R T   +T L  G  Y FRV + N+ G+ E   +T    VI    ++    + 
Sbjct: 10164 KGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD---VIEMKDRLVSPDLQ 10220

Query: 1039  EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNK 1084
              D    +              AG    +   V G P P +TW  N+
Sbjct: 10221 LDASVRD---------RIVVHAGGVIRIIAYVSGKPPPTVTWNMNE 10257



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 345 TKQLEDTTAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
           T+ L+      G     E  +S      V WF++G+ I        +I     +  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 404 GATKADAAEYSVMTTGGQSSAKLSVDL------KPLKILTPLTDQTVNLGKEICLKCEIS 457
             TKA++  YS+  T G   A  + +L       P   +  L   TV  G ++ L+  ++
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 458 ENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             IP    K+ ++G  +Q S   ++  +G ++ L+IA A  ED G Y
Sbjct: 129 -GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 39/140 (27%), Positives = 56/140 (40%), Gaps = 9/140 (6%)

Query: 1003  FRVFSENMCGLSEDATM---TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1059
             F+   E +  +SE       T ES V  +       P+      S  P+    L +T   
Sbjct: 26506 FKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI------SSKPVIVTGLQDTTVS 26559

Query: 1060  AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1119
             +   A       G P+P   W K+  AI    +Y++  ++G   LEI K    D G Y C
Sbjct: 26560 SDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTC 26619

Query: 1120  KAVNDLGTVEIECKLEVKVI 1139
                N  G+V   CKL +K I
Sbjct: 26620 TVKNSAGSVSSSCKLTIKAI 26639



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 74/348 (21%), Positives = 121/348 (34%), Gaps = 77/348 (22%)

Query: 865   GKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYD------------- 910
             G+PRP   W KDG  I +  +  +   +    + I K + S SG Y              
Sbjct: 26572 GEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSS 26631

Query: 911   --LQVKVDKFVETASIDIQIIDRPGPPQIVKIED------VWGENVALTWTPP------K 956
               L +K  K  E   +  Q      P +   +++      +  E + ++          K
Sbjct: 26632 CKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALK 26691

Query: 957   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS-------------ATITELVIGNEYYF 1003
             ++ +  +    ++K+   S+E   V E   +TS             A  T++ I NE   
Sbjct: 26692 EEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSI-NEGQR 26750

Query: 1004  RVFSENMCGLSE-----------------------DATMT------KESAVIARDGKIYK 1034
              V   N+ G ++                       D T+T      ++  ++    K  +
Sbjct: 26751 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 26810

Query: 1035  NPVYEDFDF------SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1088
               V   +D       S+AP F     +     G N    C + G P P+I W KN + I 
Sbjct: 26811 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 26870

Query: 1089  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                   +  ++ V +LEIR  S  D G Y  KA N  G       L V
Sbjct: 26871 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26918



 Score = 54.7 bits (130), Expect = 5e-07
 Identities = 52/221 (23%), Positives = 77/221 (34%), Gaps = 45/221 (20%)

Query: 920  ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
            +TA  D++++ RP P      E  W             DG   +  YT +          
Sbjct: 1426 QTARFDLKVVGRPMP------ETFWFH-----------DGQQIVNDYTHK---------- 1458

Query: 980  TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1039
             VI+     S  I      +   + V ++N  G S  + +    AV              
Sbjct: 1459 VVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV-------------- 1504

Query: 1040 DFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFS 1097
              +    PMF + L N     G    +     GNP P I W+KN   IV    P+ R+  
Sbjct: 1505 --EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEG 1562

Query: 1098 NQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
             +G   L+I      D   Y   A+N  G     CK+ V+V
Sbjct: 1563 TKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1603



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 56/305 (18%), Positives = 122/305 (40%), Gaps = 22/305 (7%)

Query: 842   PRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID-KNQINIRNSETDTIIFI 898
             P  + Q   + + E  N++   +  G+P PE+ W K+   I   + ++I  S     + I
Sbjct: 26829 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 26888

Query: 899   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDR-PGPPQIVKIEDVWGENVALTWTPPKD 957
             R A  S SGKY ++ K  +   +A+  + ++     P + V +      ++  +++    
Sbjct: 26889 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 26948

Query: 958   DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 1017
               +A+    +       S    T ++    ++ +++ +    E +  + S +  G+S   
Sbjct: 26949 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM---QESFVEMSSSSFMGISNMT 27005

Query: 1018  TMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKP 1076
              +   ++ + + G                P   + L +  +I  G   T+ C+  G P P
Sbjct: 27006 QLESSTSKMLKAG------------IRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTP 27053

Query: 1077  KITWM--KNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
             ++TW     K+   +  R+ + +   + TL I      DGG Y     N+ G+      +
Sbjct: 27054 EVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 27113

Query: 1135  EVKVI 1139
              ++ I
Sbjct: 27114 HIRSI 27118



 Score = 49.7 bits (117), Expect = 2e-05
 Identities = 111/565 (19%), Positives = 201/565 (35%), Gaps = 77/565 (13%)

Query: 110  LQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNI 169
            L++ E +      YTF       + +   N   EV   D+  S     +V ES  +    
Sbjct: 3355 LEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGK---DVRESAKSQAVA 3411

Query: 170  DIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQY 229
            D     + S   Q++     F G     EV+  E   Q  +      A   +  ++    
Sbjct: 3412 DSSFTKEESKISQKEIKS--FQGSSYEYEVQVFESVSQSSI----HTAASVQDTQLCHTA 3465

Query: 230  GITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPK-LEVKWYKN 288
             ++ +    +  K   +E    A    +      V  G   +F+  L D   ++V W   
Sbjct: 3466 SLSQIAESTELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHE 3525

Query: 289  GQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY----YVTAGDEKCSTELFVREPPIMV 344
            G +I  S +      G  + L I N Q+ D   Y    +   G+   S  L V   P  +
Sbjct: 3526 GAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESI 3585

Query: 345  TKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEG 404
                        ER+E E E+   + +  +    EE +   + +   ++     +L    
Sbjct: 3586 LH----------ERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLS-KINETLELL---- 3630

Query: 405  ATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG-- 462
                  +E  V  T   S  + +  +     +  +++  +++G    L   +   IP   
Sbjct: 3631 ------SESPVYPTKFDSEKEGTGPI----FIKEVSNADISMGDVATLSVTVI-GIPKPK 3679

Query: 463  -KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV-FAPDAYNVTLPAKVHVID 520
             +W  NG+ +  S   K V  G  H L+I     EDEG+Y   A + Y  T+ +    I+
Sbjct: 3680 IQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKIN 3739

Query: 521  PPKIILDGLDADNTVTVIAGNKLRL-------------------------EIPISGEPPP 555
                  +G     T + +A +  +L                         E  + GEP P
Sbjct: 3740 SKG---EGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAP 3796

Query: 556  KAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVK 615
               W + +K +          +   S T +++  +R+DSG+Y    +N  GE+  + ++ 
Sbjct: 3797 TVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELL 3856

Query: 616  VV----DFPDPPV-APTVTEVGDDW 635
            V+    D  D P  A +  E  +D+
Sbjct: 3857 VLLEDTDMTDTPCKAKSTPEAPEDF 3881



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 59/283 (20%), Positives = 97/283 (34%), Gaps = 70/283 (24%)

Query: 854  GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 913
            GE+V L     G P P +TW ++  +I+                                
Sbjct: 911  GESVTLECHISGYPSPTVTWYREDYQIE-------------------------------- 938

Query: 914  KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                    +SID QI  + G  +++  E    ++   T +   + G  + + Y   +   
Sbjct: 939  --------SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ--- 987

Query: 974  KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1033
                   V E + + +  +TE     E   + F E+   +  D ++T+E A        Y
Sbjct: 988  -------VSEEFEKETTAVTEKFTTEE---KRFVESRDVVMTDTSLTEEQAGPGEPAAPY 1037

Query: 1034 KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1093
                            T+P+V    + G +    C V GNPKP + W K+ V +    RY
Sbjct: 1038 --------------FITKPVVQKL-VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 1094 RMFSNQ--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
            ++  N+  G C L I      D G Y     N  G       L
Sbjct: 1083 KVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 86/372 (23%), Positives = 145/372 (38%), Gaps = 68/372 (18%)

Query: 784  VANKDLIDKTKFTITGLPTDAKIFVRV---KAVNAAGASE-PKYYSQPILVKEIIEPPKI 839
            V  +DL+ K    ++G+P + ++ +++   +A+ AA ASE P  +S+ +   E +E   +
Sbjct: 4201 VQGRDLLSKESL-LSGIPEEQRLNLKIQICRALQAAVASEQPGLFSEWLRNIEKVEVEAV 4259

Query: 840  RI---PRHLKQTYI----RRVGEAVNLVIPFQGKPRPELTWKKDGA--EIDKNQINIRNS 890
             I   PRH+   Y+    + V E V ++I         L  +   A   I   +I+I  +
Sbjct: 4260 NITQEPRHIMCMYLVTSAKSVTEEVTIIIEDVDPQMANLKMELRDALCAIIYEEIDILTA 4319

Query: 891  ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVA- 949
            E   I            K  LQ ++D F  +  ++           ++  E+V   NV  
Sbjct: 4320 EGPRI--------QQGAKTSLQEEMDSFSGSQKVEPITEPEVESKYLISTEEVSYFNVQS 4371

Query: 950  ----LTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 1005
                L  TP      +A+       +D+K  E     E    +S+               
Sbjct: 4372 RVKYLDATPVTKGVASAVV------SDEKQDESLKPSEEKEESSSE-------------- 4411

Query: 1006 FSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT 1065
                  G  E AT+  + A    +G + K          + PM   PLV+T +  G    
Sbjct: 4412 -----SGTEEVATVKIQEA----EGGLIKE---------DGPMIHTPLVDTVSEEGDIVH 4453

Query: 1066 LNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG-GTYCCKAVND 1124
            L  S+  N K ++ W      +  D +++   +Q   TL I K +  D  G Y C+A+ND
Sbjct: 4454 LTTSIT-NAK-EVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALND 4511

Query: 1125 LGTVEIECKLEV 1136
             G      KL V
Sbjct: 4512 SGKTATSAKLTV 4523



 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 51/213 (23%), Positives = 86/213 (40%), Gaps = 21/213 (9%)

Query: 932  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
            P  P+ +   +     + L W  P+ +G + I GY I+K      ++  V +    T++ 
Sbjct: 8990 PTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSF 9049

Query: 992  ITELVIGNEYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1050
            + E +  ++ Y FRV + N  G SE +       V+ +D ++               +  
Sbjct: 9050 LVENLDEHQMYEFRVKAVNEIGESEPSLPLN---VVIQDDEVPPT----------IKLRL 9096

Query: 1051 QPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAI------VDDPRYRMFSNQGVCT 1103
                +T  + AG    +   V G P PKI W KN+  I      +   +  +  ++    
Sbjct: 9097 SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTE 9156

Query: 1104 LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
            L I K    D GTY   A N LG+V     +EV
Sbjct: 9157 LSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 9189



 Score = 47.8 bits (112), Expect = 6e-05
 Identities = 61/279 (21%), Positives = 101/279 (36%), Gaps = 22/279 (7%)

Query: 266  KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
            +G   RF   ++   L+V WY   ++I+PS  +          L I      D+  Y   
Sbjct: 3312 EGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFV 3371

Query: 326  A----GDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEI 381
            A    G    +  L +    +      +D       +   +   +++++ +    + +EI
Sbjct: 3372 ASNAVGQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSSFTKEESKI----SQKEI 3427

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL----------K 431
                 S Y   V+  + +      T A   +  +  T   S    S +L          +
Sbjct: 3428 KSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQLCHTASLSQIAESTELSKECAKESTGE 3487

Query: 432  PLKILTPLTDQTVNLGKEICLKCEISEN--IPGKWTKNGLPVQESDRLKVVHKGRIHKLV 489
              KI   L D TV  G      C + ++  I   WT  G  ++ES+RLK    G I  L 
Sbjct: 3488 APKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFLT 3547

Query: 490  IANALTEDEGDY--VFAPDAYNVTLPAKVHVIDPPKIIL 526
            I N    D+G Y  +   D    T  A + V   P+ IL
Sbjct: 3548 ICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESIL 3586



 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 1044 SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFSNQGV 1101
            ++AP FTQPL +   + G  AT    + G P P+++W ++   I     P  ++  + G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1102 CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
              L I   +  + G Y  KA N  G      +L VK
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 36/105 (34%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 512 LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
           +PA V +   P  ++ GL     VTVI G  + LE  ISG P P   W R D  I E S 
Sbjct: 886 VPAPVEIPVTPPTLVSGL---KNVTVIEGESVTLECHISGYPSPTVTWYREDYQI-ESSI 941

Query: 572 RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
             +       + L+I  A  +DSG +  +  NEAG    S  + V
Sbjct: 942 DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 1047  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV---DDPRYRMFSNQGVCT 1103
             P FT PL N  A  G N     ++  +P+P +TW K+   I    +D +Y   S++G+  
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25444

Query: 1104  LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             L I   +  D   Y   A N  G    + KL V
Sbjct: 25445 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 1034 KNPVYEDFDFSE----APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
            ++PVY     SE     P+F + + N     G  ATL+ +V G PKPKI W  N V +  
Sbjct: 3632 ESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTP 3691

Query: 1090 DPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               Y+   +    +L I      D G Y C A ND G       L++
Sbjct: 3692 SADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3738



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 42/93 (45%)

Query: 1046 APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1105
            AP+  + +       G+ A   C ++  P  +  W K    I +  +  + S++ + +LE
Sbjct: 4528 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLE 4587

Query: 1106 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
            I +    D G Y CKA N+ G+V     L V V
Sbjct: 4588 ILRTQVVDCGEYTCKASNEYGSVSCTATLTVTV 4620



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 3/96 (3%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN-QGVCTLE 1105
            P F + L       G  A    +V G P P +TW K    +     Y +  N  G  T  
Sbjct: 3767 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3826

Query: 1106 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1141
            +  P   D G Y CKA N LG  E  C  E+ V+ +
Sbjct: 3827 VNDPQREDSGLYICKAENMLG--ESTCAAELLVLLE 3860



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH--YHRTS 989
             P  P    + +V  ++  +TW  P D G   IT Y ++K +  S  W  V +   +  T 
Sbjct: 10707 PDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETMSKRWARVTKDPIHPYTK 10765

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
               + +L+ G +Y FRV +EN  G+ + +  +K   V A+D
Sbjct: 10766 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK--PVFAKD 10803



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 62/284 (21%), Positives = 105/284 (36%), Gaps = 51/284 (17%)

Query: 869  PELT--WKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDL----QVKVDK-FVE 920
            P++T  W KD  E+   ++I I+  +    + I     S +GKY +     V   K FVE
Sbjct: 3038 PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3097

Query: 921  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA------AITGYTIQKADKK 974
               + I+ I +       +++ +  +   + +   +DD +A          + +Q+  K 
Sbjct: 3098 GRDVRIRSIKK-------EVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK- 3149

Query: 975  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
                + V    HR   + T      EY F V   N   ++                 +Y 
Sbjct: 3150 ----YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVT-----------------LYV 3187

Query: 1035 NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
            N         E P   Q L      +G  A     + G P+PKI+W K +  +    + +
Sbjct: 3188 NA-------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3240

Query: 1095 MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
               +    TL + +  P D   Y C+A ND G       L V+V
Sbjct: 3241 FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV 3284



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
           ++TV  G+++RL++ ++G P P   + R D A ++ S   +     D  +L+I  A  +D
Sbjct: 112 SMTVRQGSQVRLQVRVTGIPTPVVKFYR-DGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170

Query: 594 SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
           SG Y +N  N  G A ++ ++ V    + P   T T V
Sbjct: 171 SGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIV 208



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 64/320 (20%), Positives = 110/320 (34%), Gaps = 40/320 (12%)

Query: 315   QMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SEDDANVK 373
             Q T + +Y      E  S + F  +    +T ++      CG+       V S+  A VK
Sbjct: 26048 QKTSERKY------EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVK 26101

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT-------------KADAAEYSVM-TTG 419
             W+ NG E+    K  Y     G   + I++  T             K +A++Y+ +  TG
Sbjct: 26102 WYHNGVELQESSKIHYT-NTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG 26160

Query: 420   GQSSAKLSV---DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDR 476
             G  +   S    +  P  +   LT              E+  +   +  K+ +       
Sbjct: 26161 GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESL 26220

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                 H       + + AL E   +          TL A++            L    ++T
Sbjct: 26221 SSYEHSASAE--MKSAALEEKSLEEKSTTRKIKTTLAARI------------LTKPRSMT 26266

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
             V  G   R      GEP P   W R  + ++  S R +  +    ST  I   +  D G 
Sbjct: 26267 VYEGESARFSCDTDGEPVPTVTWLRKGQ-VLSTSARHQVTTTKYKSTFEISSVQASDEGN 26325

Query: 597   YHINLKNEAGEAHASIKVKV 616
             Y + ++N  G+  A   + +
Sbjct: 26326 YSVVVENSEGKQEAEFTLTI 26345



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 94/440 (21%), Positives = 160/440 (36%), Gaps = 71/440 (16%)

Query: 246  REEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKG 304
            ++EK+        +P  +V +G   RF   +   P+ +V WY NGQ IR S ++   + G
Sbjct: 1789 QKEKQKPDIVLYPEPV-RVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG 1847

Query: 305  CQRILFINNCQMTDDSEYYVTAG------DEKCSTELFVREP------------------ 340
                L I +C+  D  E  VTA       + K   E+  RE                   
Sbjct: 1848 I-HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH 1906

Query: 341  --------------PIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGE-----EI 381
                          P+  T+  E       ER+  E    E +     FK        E 
Sbjct: 1907 EPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEA 1966

Query: 382  IPGPKSRYRIRVEGKKHIL-------------IIEGATKADAAEYSV-MTTGGQSSAKLS 427
            I   + + R + E  + +L             + E   KA A E  + + T      +LS
Sbjct: 1967 ITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELS 2026

Query: 428  VDLKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLK-VVHKGR 484
              ++  KI   +  QTV  G +   +  +    +   +W KNG+ ++ SDR+     +  
Sbjct: 2027 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2086

Query: 485  IHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH---VIDPPKIILDGLDADNTVTVIAGN 541
            + +LVI +   ED    +    A N+      H   ++   ++I    +  + V      
Sbjct: 2087 VCELVIRDVTAEDSASIMV--KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2144

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE-SYPDSSTLVIDIAERDDSGVYHI 599
                E   S EP  K  W +    + EG   R+ ++      S L ID ++ +D     +
Sbjct: 2145 MATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2203

Query: 600  NLKNEAGEAHASIKVKVVDF 619
              +N    A   ++  VV+F
Sbjct: 2204 EDENVKTTAKLIVEGAVVEF 2223



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1059 IAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1118
            + G  A   C V G P+PK+ W  N   I    R+R+    G+  L+I     YD G   
Sbjct: 1807 LEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVK 1865

Query: 1119 CKAVNDLGTVEIECKLEVK 1137
              A N  G +E + KLE++
Sbjct: 1866 VTAENPEGVIEHKVKLEIQ 1884



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 59/286 (20%), Positives = 102/286 (35%), Gaps = 24/286 (8%)

Query: 854   GEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 912
             G+    ++  Q KP  E+ W  +G E+ + ++I+  N+     + I       SG Y  +
Sbjct: 26083 GQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY--R 26140

Query: 913   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 972
                  +   AS D   +D  G            E V  +  P      A    Y +    
Sbjct: 26141 AVCTNYKGEAS-DYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA----YAVSSFK 26195

Query: 973   KKS-MEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1031
             K S ME  + +       + +TE             E++      A+   +SA +     
Sbjct: 26196 KTSEMEASSSVRE---VKSQMTET-----------RESLSSYEHSASAEMKSAALEEKSL 26241

Query: 1032  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1091
               K+   +      A + T+P   T    G +A  +C   G P P +TW++    +    
Sbjct: 26242 EEKSTTRKIKTTLAARILTKPRSMT-VYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 26300

Query: 1092  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             R+++ + +   T EI      D G Y     N  G  E E  L ++
Sbjct: 26301 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 26346



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 61/263 (23%), Positives = 104/263 (39%), Gaps = 35/263 (13%)

Query: 261   AYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDD 319
             +++V  G   RF++ + + P  EVKWY NG E++ S+K  + +      L I +C  TDD
Sbjct: 26077 SHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCH-TDD 26135

Query: 320   SEYY------------------VTAGD-EKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
             S  Y                  VT GD    +++    E P  V  +L  T AY     +
Sbjct: 26136 SGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFK 26195

Query: 361   LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
                E+ E  ++V+  K+         +  R  +   +H      + +  +A     +   
Sbjct: 26196 KTSEM-EASSSVREVKS-------QMTETRESLSSYEH----SASAEMKSAALEEKSLEE 26243

Query: 421   QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLK 478
             +S+ +        +ILT     TV  G+     C+   E +P   W + G  +  S R +
Sbjct: 26244 KSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQ 26303

Query: 479   VVHKGRIHKLVIANALTEDEGDY 501
             V          I++    DEG+Y
Sbjct: 26304 VTTTKYKSTFEISSVQASDEGNY 26326



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 41/170 (24%), Positives = 67/170 (39%), Gaps = 16/170 (9%)

Query: 464  WTKNGLPVQESDRLKVVHK-GRIHKLVIANALTEDEGDYVFAPD--------AYNVTLPA 514
            W  +G  +      KVV K      L+I  A   D G++             +  +T+ A
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1503

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS-GRI 573
              H + P  +     +    V +  G++L +++  +G P P  +W +    I+     +I
Sbjct: 1504 VEHQVKPMFV-----EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKI 1558

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV-VDFPDP 622
            R E     + L ID     DS  Y     N+AG      KV V V+F +P
Sbjct: 1559 RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEP 1608



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 67/327 (20%), Positives = 116/327 (35%), Gaps = 65/327 (19%)

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDAN--VKWFKNGEEIIPGPKSRYRIRVEGKKHILI 401
             V+ Q+       G  V+  C++   D +  V W+    ++    K  Y I  E    IL 
Sbjct: 25265 VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEK--YEITYEDGVAILY 25322

Query: 402   IEGATKADAAEY--SVMTTGGQSSAKLSVDLK---------------------------- 431
             ++  TK D   Y   V+   G+ S+   + +K                            
Sbjct: 25323 VKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLE 25382

Query: 432   -PLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVV----HKGR 484
              P +   PL ++T  +G+ +     I+ +      W K+G  ++  D  K       KG 
Sbjct: 25383 RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG- 25441

Query: 485   IHKLVIANALTEDEGDYV------FAPDAYNVTLPAKVHVIDPP---------KIILDGL 529
             +++L I +  T+D+ +Y       +  D+    L   +H   PP         K +L   
Sbjct: 25442 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH--PPPTDSTLRPMFKRLLANA 25499

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             +         G  +  EI +SG PPP   W +  + +  G          D   L I   
Sbjct: 25500 ECQE------GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT 25553

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKV 616
               +D+G Y +   N AG       ++V
Sbjct: 25554 LPEDTGYYRVTATNTAGSTSCQAHLQV 25580



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 5/111 (4%)

Query: 1021 KESAVIARDGKI----YKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1076
            +E   +A +GKI    +K    E     EAP   + + +     G +A     V G P P
Sbjct: 2002 EEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDP 2061

Query: 1077 KITWMKNKVAIVDDPR-YRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
            +  W KN V I    R Y  +    VC L IR  +  D  +   KA+N  G
Sbjct: 2062 ECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2112



 Score = 42.4 bits (98), Expect = 0.003
 Identities = 75/321 (23%), Positives = 117/321 (36%), Gaps = 33/321 (10%)

Query: 831  KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ-GKPRPELTWKKDGAEIDKNQINIRN 889
            K  +E   +RI    K+    +V E    V+ F+  +   +  W KDG EI+        
Sbjct: 3093 KLFVEGRDVRIRSIKKEV---QVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK 3149

Query: 890  SETDTII---FIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGE 946
               +  I   FI +  +S +G+Y      ++   T       ++ P PPQ+++      E
Sbjct: 3150 YVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL-----YVNAPEPPQVLQ------E 3198

Query: 947  NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY---YF 1003
               +T    K     A+    I    +  + W+   E    T      L  G EY     
Sbjct: 3199 LQPVTVQSGKPARFCAV----ISGRPQPKISWYKE-EQLLSTGFKCKFLHDGQEYTLLLI 3253

Query: 1004 RVFSENM----CGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1059
              F E+     C    D  +   SA ++ +     +P  E   +   P    PL +T   
Sbjct: 3254 EAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP--PAIITPLQDTVTS 3311

Query: 1060 AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1119
             G  A   C V G    K++W      I     +RM   +    LEI +  P D GTY  
Sbjct: 3312 EGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTF 3370

Query: 1120 KAVNDLGTVEIECKLEVKVIA 1140
             A N +G V     L ++V A
Sbjct: 3371 VASNAVGQVSSTANLSLEVQA 3391



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 1022 ESAVIARDGKIYKNPVYEDFDFSEAPM-FTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1080
            E  + A+D K + N   +     E P+ FT+PL +     G  A L C V      K+ W
Sbjct: 5959 EVQLTAKDFKTHANLFVK-----EPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKVKW 6012

Query: 1081 MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1121
             KN   I+   +Y + ++  V  L I   +P D  TY C A
Sbjct: 6013 FKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 6053



 Score = 40.0 bits (92), Expect = 0.013
 Identities = 44/211 (20%), Positives = 95/211 (45%), Gaps = 28/211 (13%)

Query: 245  RREEKKSAAFAKILDPAYQVD-------KGGRVRFVVELAD-PKLEVKWYKNGQEIRP-- 294
            R EE   +   ++  P + +        +G   RF +++   P  E  W+ +GQ+I    
Sbjct: 1396 RLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY 1455

Query: 295  STKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFV--------REPPIMVTK 346
            + K + +  G Q ++ +     +D  E+ V A +    + + V         +   M  +
Sbjct: 1456 THKVVIKEDGTQSLIIVP-ATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1514

Query: 347  QLEDTTAYCGERVELECEVSED-DANVKWFKNGEEIIPGPKSRY-RIRVEGKK--HILII 402
            +L++     G R+E++   + + + ++ W KN + I+P    +Y +IR+EG K    L I
Sbjct: 1515 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVP---HKYPKIRIEGTKGEAALKI 1571

Query: 403  EGATKADAAEY--SVMTTGGQSSAKLSVDLK 431
            +     D+A Y  + +   G+ + +  V+++
Sbjct: 1572 DSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602



 Score = 40.0 bits (92), Expect = 0.013
 Identities = 96/465 (20%), Positives = 165/465 (35%), Gaps = 92/465 (19%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E  S  + + +   K   L E    E+   +   + L+   + KP+  TV  GE   F  
Sbjct: 26218 ESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSC 26277

Query: 80    KVKAEDLLRKPTIKWF-KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAG 138
                 E +   PT+ W  KG+   + S + +H      ++      TFE+  ++A D   G
Sbjct: 26278 DTDGEPV---PTVTWLRKGQ---VLSTSARHQVTTTKYKS-----TFEISSVQASDE--G 26324

Query: 139   NYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRRE 198
             NY   V   +      F L + ++  T   +      K S E +  + E     +   + 
Sbjct: 26325 NYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVK-SPEPRVKSPE----AVKSPKR 26379

Query: 199   VKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKIL 258
             VK  E      V       KP+  EK+        +    K  + ++ E  K  A     
Sbjct: 26380 VKSPEPSHPKAVSP--TETKPTPTEKVQH----LPVSAPPKITQFLKAEASKEIA----- 26428

Query: 259   DPAYQVDKGGRVRFVVELADPKL-EVKWYKNGQEIRPSTKYIFEHKGCQRI-LFINNCQM 316
                       ++  VVE +  +  EV WYK+G++++ +  + F +       L INN   
Sbjct: 26429 ----------KLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 26478

Query: 317   TDDSEYY---------------------------------VTAGDEKCSTELFVR--EP- 340
             +D  EY                                      D+K +     R  EP 
Sbjct: 26479 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 26538

Query: 341   --------PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRI 391
                     P++VT  L+DTT       +   + + E      W K+G+ I  G K  Y++
Sbjct: 26539 APEPISSKPVIVT-GLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGK--YKL 26595

Query: 392   RVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSVDLKPLK 434
               +     L I     +D+  Y  +V  + G  S+   + +K +K
Sbjct: 26596 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIK 26640



 Score = 39.7 bits (91), Expect = 0.017
 Identities = 25/98 (25%), Positives = 37/98 (37%)

Query: 1039  EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN 1098
             + F    AP  T  + +     G N     +V+  P  ++ W  N V + +  +    + 
Sbjct: 26061 QPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNT 26120

Query: 1099  QGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              GV TLEI      D GTY     N  G       L+V
Sbjct: 26121 SGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 39.3 bits (90), Expect = 0.022
 Identities = 58/327 (17%), Positives = 107/327 (32%), Gaps = 45/327 (13%)

Query: 854  GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSGKYD 910
            G+     +   G+P PE  W  DG +I  +   ++ I+   T ++I +  A  S SG++ 
Sbjct: 1425 GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIV-PATPSDSGEWT 1483

Query: 911  L--QVKVDKFVETASIDIQIIDRPGPPQIV----------------KIEDVWGENVALTW 952
            +  Q +  +   +  + ++ ++    P  V                K+      N  + W
Sbjct: 1484 VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1543

Query: 953  TPPKD------------DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 1000
                D            +G        I     +   W+T     ++     T   +  E
Sbjct: 1544 LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATA-INKAGRDTTRCKVNVE 1602

Query: 1001 YYFR--------VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQP 1052
              F         +         E A    E   +    + ++     D +  + P F + 
Sbjct: 1603 VEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKK 1662

Query: 1053 LVNTYAIAGYNATLNCSVR--GNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPS 1110
            L +        A   C +   G+P   + W+ +   +    R RM +  G C+L+     
Sbjct: 1663 LTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAY 1722

Query: 1111 PYDGGTYCCKAVNDLGTVEIECKLEVK 1137
              D G   C+A N  GT      L VK
Sbjct: 1723 SRDSGIITCRATNKYGTDHTSATLIVK 1749



 Score = 38.9 bits (89), Expect = 0.028
 Identities = 44/162 (27%), Positives = 69/162 (42%), Gaps = 13/162 (8%)

Query: 279 PKLEVKWYKNGQEIRPST--KYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
           P  EV W+++GQ I  ST           +  L I      +   Y + A    G    +
Sbjct: 33  PVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATST 92

Query: 333 TELFVR---EPPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGPKSR 388
            EL V+    PP  V ++L+  T   G +V L+  V+      VK++++G EI       
Sbjct: 93  AELLVKAETAPPNFV-QRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEI--QSSLD 149

Query: 389 YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL 430
           ++I  EG  + L+I  A   D+  YSV  T     A  + +L
Sbjct: 150 FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAEL 191



 Score = 38.5 bits (88), Expect = 0.037
 Identities = 75/342 (21%), Positives = 130/342 (38%), Gaps = 50/342 (14%)

Query: 316  MTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDA-NVKW 374
            MTD S     AG  + +   F+ +P  +V K +E      G  V   C+V  +   +V W
Sbjct: 1018 MTDTSLTEEQAGPGEPAAPYFITKP--VVQKLVE------GGSVVFGCQVGGNPKPHVYW 1069

Query: 375  FKNGEEIIPGPKSRYRIRVEGKKHI----LIIEGATKADAAEYSVMTTG--GQSSAKLSV 428
             K+G  +  G    YR +V   K      L+I      DA EY+++     G++SA  S+
Sbjct: 1070 KKSGVPLTTG----YRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125

Query: 429  DLKPLKILTPLTDQTVNLGKEICL---KCEISENIPGKWTKNGLPVQESDRLKVVHKGRI 485
              +    L   + Q +    ++     + ++ E  PG +  +    +      ++ K   
Sbjct: 1126 LEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPG-FVYSEYEKEYEKEQALIRKKMA 1184

Query: 486  HKLVIANALTEDEGDYVFAPDA----------YNVTLPAKVHVIDPPKIILD-------- 527
               V+     ED+  ++ + +              TL   +      K+ +D        
Sbjct: 1185 KDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVE 1244

Query: 528  -GLDAD-NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STL 584
             G D+      ++ G  +     +SG P PK  W +  K I  G  R + +   D  ++L
Sbjct: 1245 SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGE-RYQMDFLQDGRASL 1303

Query: 585  VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAP 626
             I +   +D G+Y     N  G A  S K+ V      P AP
Sbjct: 1304 RIPVVLPEDEGIYTAFASNIKGNAICSGKLYV-----EPAAP 1340



 Score = 38.1 bits (87), Expect = 0.048
 Identities = 38/173 (21%), Positives = 68/173 (39%), Gaps = 11/173 (6%)

Query: 337  VREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
            ++E   M+   L DT +  G+ V L   ++       +F+N  +++P  + +++   +  
Sbjct: 4430 IKEDGPMIHTPLVDTVSEEGDIVHLTTSITNAKEVNWYFEN--KLVPSDE-KFKCLQDQN 4486

Query: 397  KHILIIEGATKAD-AAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN-----LGKEI 450
             + L+I+     D   EY             S  L  +K   P+  + +      LG   
Sbjct: 4487 TYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGHLA 4546

Query: 451  CLKCEISE--NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
               CEI    N+  +W K G  + ESD+  +     I  L I      D G+Y
Sbjct: 4547 KFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEY 4599



 Score = 38.1 bits (87), Expect = 0.048
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 3/98 (3%)

Query: 1042  DFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGV 1101
             D +  PMF + L N     G +      V G P P + W K+   +   P   +  ++G+
Sbjct: 25485 DSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEII-HEGL 25543

Query: 1102  --CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
                 L IR   P D G Y   A N  G+   +  L+V+
Sbjct: 25544 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 25581



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 26/83 (31%), Positives = 34/83 (40%), Gaps = 5/83 (6%)

Query: 264   VDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             V  G  VRF   +   P    KW  +G EI+    Y  E      +L I NC   D  EY
Sbjct: 11217 VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEY 11276

Query: 323   YVT----AGDEKCSTELFVREPP 341
              +T    AG +  +  L V + P
Sbjct: 11277 QITVSNAAGSKTVAVHLTVLDVP 11299



 Score = 37.7 bits (86), Expect = 0.063
 Identities = 19/65 (29%), Positives = 31/65 (47%)

Query: 1077  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             ++TW      + +  +Y +    GV  L ++  +  D GTY CK VND G      +L V
Sbjct: 25294 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25353

Query: 1137  KVIAQ 1141
             K + +
Sbjct: 25354 KGVRE 25358



 Score = 37.0 bits (84), Expect = 0.11
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 1/94 (1%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR-MFSNQGVCTLE 1105
            P+F    V+   + G  A  +  V G P P+  W  +   IV+D  ++ +    G  +L 
Sbjct: 1411 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1470

Query: 1106 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
            I   +P D G +   A N  G   I   L V+ +
Sbjct: 1471 IVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV 1504



 Score = 36.6 bits (83), Expect = 0.14
 Identities = 53/275 (19%), Positives = 95/275 (34%), Gaps = 51/275 (18%)

Query: 340  PPIMVTKQLEDTTAYCGERVELECEVSE-DDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
            PP +V+  L++ T   GE V LEC +S      V W++   +I       ++I  +    
Sbjct: 896  PPTLVSG-LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQI--ESSIDFQITFQSGIA 952

Query: 399  ILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE 458
             L+I  A   D+  +                          T   VN    +   C ++ 
Sbjct: 953  RLMIREAFAEDSGRF--------------------------TCSAVNEAGTVSTSCYLAV 986

Query: 459  NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN-ALTEDEGDYVFAPDAYNVTLPAKVH 517
             +  ++ K    V E    +         +V+ + +LTE++         Y +T P    
Sbjct: 987  QVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQK 1046

Query: 518  VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE 576
            +++                   G  +     + G P P   W +    +  G   ++   
Sbjct: 1047 LVE-------------------GGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYN 1087

Query: 577  SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                   LVI +   DD+G Y I ++N+ GE  AS
Sbjct: 1088 KQTGECKLVISMTFADDAGEYTIVVRNKHGETSAS 1122



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 45/250 (18%), Positives = 92/250 (36%), Gaps = 31/250 (12%)

Query: 873  WKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
            W KDG EI  + + +I+      I+ I+KA+    G+Y      DK     +++ ++I  
Sbjct: 5389 WFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKV 5448

Query: 932  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
              P   V++      +  +  + P   G   + G  +                   T++ 
Sbjct: 5449 EKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPL-------------------TASP 5489

Query: 992  ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQ 1051
              E++   + +  +      G++ + +    +A  A + K+ + P+          +F  
Sbjct: 5490 DCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPL----------IFIT 5539

Query: 1052 PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1111
            PL +        A   C V   PK    W+K    I  D R+ +  +    ++ I+  + 
Sbjct: 5540 PLSDVKVFEKDEAKFECEVSREPK-TFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAF 5598

Query: 1112 YDGGTYCCKA 1121
             D   Y  +A
Sbjct: 5599 EDEAKYMFEA 5608



 Score = 36.2 bits (82), Expect = 0.18
 Identities = 39/146 (26%), Positives = 56/146 (38%), Gaps = 11/146 (7%)

Query: 276   LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTEL 335
             L  PK  V W K  Q ++ + +  FE      IL IN C  +D   Y +TA +       
Sbjct: 14785 LGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARN------- 14837

Query: 336   FVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEG 395
              V E   ++T Q+ D        ++ + EVS D     W    E     P S Y + +  
Sbjct: 14838 IVGEVGDVITIQVHDIPGPPTGPIKFD-EVSSDFVTFSW-DPPENDGGVPISNYVVEMRQ 14895

Query: 396   KKHILIIEGATKADAAEYSV--MTTG 419
                   +E AT      Y    +TTG
Sbjct: 14896 TDSTTWVELATTVIRTTYKATRLTTG 14921



 Score = 35.8 bits (81), Expect = 0.24
 Identities = 25/91 (27%), Positives = 42/91 (46%), Gaps = 1/91 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS-STLVIDIAERD 592
           +V V+ G+    E  ISG P P+  W R  + I   +      S+ D  + L I    + 
Sbjct: 14  SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73

Query: 593 DSGVYHINLKNEAGEAHASIKVKVVDFPDPP 623
           +SG Y +   N +G+A ++ ++ V     PP
Sbjct: 74  NSGRYSLKATNGSGQATSTAELLVKAETAPP 104



 Score = 35.8 bits (81), Expect = 0.24
 Identities = 23/89 (25%), Positives = 34/89 (38%), Gaps = 2/89 (2%)

Query: 536   TVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG--RIRTESYPDSSTLVIDIAERDD 593
             T   G  +R  + I+  P P   W +  + I  G    +   ES      L I+    DD
Sbjct: 25395 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25454

Query: 594   SGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                Y +  +N+ GE     K+ V   P P
Sbjct: 25455 DAEYTVVARNKYGEDSCKAKLTVTLHPPP 25483



 Score = 35.0 bits (79), Expect = 0.41
 Identities = 23/91 (25%), Positives = 37/91 (40%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
            P F Q L +     G    L   V G P P + + ++   I     +++     + +L I
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163

Query: 1107 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             +  P D GTY   A N +G      +L V+
Sbjct: 164  AEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194



 Score = 35.0 bits (79), Expect = 0.41
 Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 4/90 (4%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
            P FT  L +  A+     TL C V  +   K  W K+   IV  P+Y + ++     L+I
Sbjct: 5358 PYFTVKLHDKTAVEKDEITLKCEVSKDVPVK--WFKDGEEIVPSPKYSIKADGLRRILKI 5415

Query: 1107 RKPSPYDGGTYCCKAVND--LGTVEIECKL 1134
            +K    D G Y C    D     V +E +L
Sbjct: 5416 KKADLKDKGEYVCDCGTDKTKANVTVEARL 5445



 Score = 33.9 bits (76), Expect = 0.91
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 11/119 (9%)

Query: 393 VEGKKHILIIEGATKADAAEYSVM-------TTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
           VE KK + +    T      + V+       T   +  A + + + P  +++ L + TV 
Sbjct: 850 VEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVI 909

Query: 446 LGKEICLKCEISENIPGK---WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
            G+ + L+C IS   P     W +    ++ S   ++  +  I +L+I  A  ED G +
Sbjct: 910 EGESVTLECHIS-GYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRF 967



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 35/140 (25%), Positives = 63/140 (45%), Gaps = 11/140 (7%)

Query: 792 KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 851
           + K TI  +         +KA N +G +     +  +LVK    PP     + L+   +R
Sbjct: 62  RAKLTIPAVTKANSGRYSLKATNGSGQATS---TAELLVKAETAPPNF--VQRLQSMTVR 116

Query: 852 RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTI--IFIRKAERSHSGKY 909
           + G  V L +   G P P + + +DGAEI ++ ++ + S+   +  + I +A    SG Y
Sbjct: 117 Q-GSQVRLQVRVTGIPTPVVKFYRDGAEI-QSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174

Query: 910 DLQV--KVDKFVETASIDIQ 927
            +     V +   TA + +Q
Sbjct: 175 SVNATNSVGRATSTAELLVQ 194



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 105/543 (19%), Positives = 203/543 (37%), Gaps = 71/543 (13%)

Query: 3     EPTKKEENEVP-APAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFI 61
             +P K EE   P  P  PPE PS   E         +L  + P     K +  S+++  +I
Sbjct: 24007 KPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRP-----KDDGGSRVTGYYI 24061

Query: 62    EKPQGGTVK-VGEDITFIAKVKAEDLLRKPTIKWF------KGKWMDLASKAGKHLQLKE 114
             E+ +  T K V  + T I           P  ++           +   S A + +  K+
Sbjct: 24062 ERKETSTDKWVRHNKTQITTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKD 24121

Query: 115   TFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSA 174
              F++ S+    E+  I                    DS +   E  E  G    +     
Sbjct: 24122 PFDKPSQPGELEILSISK------------------DSVTLQWEKPECDGGKEILGYWVE 24163

Query: 175   FKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF---QYGI 231
             +++SG+               ++  K++ ++ Q  +  LL+    +EYE   F   + G+
Sbjct: 24164 YRQSGDSAW------------KKSNKERIKDKQFTIGGLLE---ATEYEFRVFAENETGL 24208

Query: 232   TDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQE 291
             +  R     +K      +      ++ D   ++ +  ++   + +  P  ++KWY+ G+E
Sbjct: 24209 SRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQI-VGRPLPDIKWYRFGKE 24267

Query: 292   IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVT-- 345
             +  S KY     G    L +   +  D+  Y   A    G+ + S++L ++  P      
Sbjct: 24268 LIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGY 24327

Query: 346   KQLEDTTAYCGERVELE-CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEG 404
                E      G  + L    +      + WF +G++++   ++      E   H+++   
Sbjct: 24328 PLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-HGQKLLQNSENITIENTEHYTHLVMKNV 24386

Query: 405   ATKADAAEYSVMTTG--GQSSAKLSVDL--KPLKILTPLTDQTVNLGKEICLKCEISENI 460
               K  A +Y V  +   G   A L V++  KP K   P+  + + L     +  +   + 
Sbjct: 24387 QRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEAL-LKNSAVISWKPPADD 24445

Query: 461   PGKWTKNGL----PVQESDRLKVVHKG-RIHKLVIANALTEDEGDY--VFAPDAYNVTLP 513
              G W  N +      +E    ++V     +    I N LTE+ G Y  V A + + ++ P
Sbjct: 24446 GGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVN-LTENAGYYFRVSAQNTFGISDP 24504

Query: 514   AKV 516
              +V
Sbjct: 24505 LEV 24507



 Score = 33.5 bits (75), Expect = 1.2
 Identities = 43/147 (29%), Positives = 59/147 (40%), Gaps = 10/147 (6%)

Query: 279   PKLEVKWYKNGQE-IRPSTKY-IFEHKGCQRILFINNCQMTDDSEYYVTA----GDEKCS 332
             PK  VKWY+ G+E I    KY I E KG    L I +    D + Y V A    G    +
Sbjct: 24650 PKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGT 24709

Query: 333   TELFVREP-PIMVTKQLED---TTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               L V  P  I + K LE      A  GE V ++   S     V  ++ G+++I      
Sbjct: 24710 ASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHY 24769

Query: 389   YRIRVEGKKHILIIEGATKADAAEYSV 415
               I       ++   G  + DA  Y V
Sbjct: 24770 QVIVTRSFTSLVFPNGVERKDAGFYVV 24796



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 21/96 (21%), Positives = 41/96 (42%), Gaps = 3/96 (3%)

Query: 847 QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ---INIRNSETDTIIFIRKAER 903
           Q+ +   G          G P PE++W +DG  I  +    + I  S+    + I    +
Sbjct: 13  QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72

Query: 904 SHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
           ++SG+Y L+        T++ ++ +     PP  V+
Sbjct: 73  ANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQ 108



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 21/93 (22%), Positives = 39/93 (41%), Gaps = 1/93 (1%)

Query: 538  IAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
            + G   R ++ + G P P+  W    + I+             + +L+I  A   DSG +
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEW 1482

Query: 598  HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             +  +N AG +  S+ +  V+  +  V P   E
Sbjct: 1483 TVVAQNRAGRSSISV-ILTVEAVEHQVKPMFVE 1514



 Score = 33.1 bits (74), Expect = 1.5
 Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 1064 ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVN 1123
            AT  C     P  K+ W K+ + + +  +YRM S++ V  L I      D   Y C  V 
Sbjct: 2146 ATFECET-SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2204

Query: 1124 D 1124
            D
Sbjct: 2205 D 2205



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 105  KAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTG 164
            KAG+ +   +     S  Y   ++I++ +    G Y C+ + +    SC+  L V     
Sbjct: 4564 KAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV----- 4618

Query: 165  TTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPS 220
            T P  + +          E   E+    +L++R    +EEEP+V+  +L K  KP+
Sbjct: 4619 TVPGGEKKVRKLLPERKPEPKEEVVLKSVLRKR---PEEEEPKVEPKKLEKVKKPA 4671



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 27/117 (23%), Positives = 42/117 (35%), Gaps = 9/117 (7%)

Query: 1004 RVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYN 1063
            R+   N C L ++A  + E       G +            E  +FT+ L N        
Sbjct: 6123 RILVINKCLLDDEAEYSCEVRTARTSGMLTV--------LEEEAVFTKNLANIEVSETDT 6174

Query: 1064 ATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1120
              L C V   P  ++ W K    I++  RY + +      L I+     D G Y C+
Sbjct: 6175 IKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCR 6230



 Score = 32.3 bits (72), Expect = 2.6
 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%)

Query: 836   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
             PP+  +P + K  Y   VGE V   +     P P +TW K G +I
Sbjct: 25384 PPEFTLPLYNKTAY---VGENVRFGVTITVHPEPHVTWYKSGQKI 25425



 Score = 32.0 bits (71), Expect = 3.4
 Identities = 27/97 (27%), Positives = 39/97 (40%), Gaps = 5/97 (5%)

Query: 249  KKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQR 307
            K++A   K      +V  G   +F  E+   P +  +W+K G+EI  S K          
Sbjct: 4525 KRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYIS 4584

Query: 308  ILFINNCQMTDDSEYYVTAGDE----KCSTELFVREP 340
             L I   Q+ D  EY   A +E     C+  L V  P
Sbjct: 4585 SLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVP 4621



 Score = 31.6 bits (70), Expect = 4.5
 Identities = 26/88 (29%), Positives = 33/88 (37%), Gaps = 4/88 (4%)

Query: 1052 PLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSP 1111
            PL +   I G  A L C V       + W  N   I  D R +         L I +   
Sbjct: 2404 PLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHA 2463

Query: 1112 YDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
             D G Y  K +  +G VE  C L V+ I
Sbjct: 2464 SDEGPY--KLI--VGRVETNCNLSVEKI 2487



 Score = 31.2 bits (69), Expect = 5.9
 Identities = 23/93 (24%), Positives = 32/93 (34%)

Query: 1045 EAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTL 1104
            EAP     L +     G  A   C ++ +    +TW      I +  R +   N  +  L
Sbjct: 3487 EAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFL 3546

Query: 1105 EIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             I      D G Y C   ND G       L V+
Sbjct: 3547 TICNVQLVDQGLYSCIVHNDCGERTTSAVLSVE 3579



 Score = 31.2 bits (69), Expect = 5.9
 Identities = 15/66 (22%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 262   YQVDKGGRVRFVVE-LADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDS 320
             Y +  G  ++  +  +  P+  + W K+G+ ++ +T+   E      +L I      D  
Sbjct: 18016 YSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFG 18075

Query: 321   EYYVTA 326
             +Y VTA
Sbjct: 18076 KYTVTA 18081


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  288 bits (738), Expect = 2e-77
 Identities = 218/774 (28%), Positives = 346/774 (44%), Gaps = 70/774 (9%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F  +L+  K  VKWY+NG+EI+   KY FE  G    L I +C++ D+ EY     D K 
Sbjct: 6470 FSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKS 6529

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
               LFV E P+ + +  +D     G  V    E+++D   V+W +N   ++ G K  +++
Sbjct: 6530 RARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDK--HQM 6587

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
              EGK H L I      D  EY  +    ++ AKL +   P KI T   D  V++GK + 
Sbjct: 6588 MSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVGKPLT 6646

Query: 452  LKC--EISENIPGKWTKNGLPV----------QESDRL---KVVHKGRIHKLVIANALTE 496
            +    +       +W K   P+          Q S R+   K   KGR +K+V+ N   +
Sbjct: 6647 MVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILEAKKGDKGR-YKIVLQNKHGK 6705

Query: 497  DEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             EG                + VID P  + +    + T T      L  E P++      
Sbjct: 6706 AEGFI-------------NLKVIDVPGPVRN---LEVTETFDGEVSLAWEEPLTDGGSKI 6749

Query: 557  AMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHAS 611
              +    + I   +  + T+        V  + +     ++ ++ +N  G     E    
Sbjct: 6750 IGYVVERRDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNP 6809

Query: 612  IKVKV-VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLN 670
            ++ +   D P PP+  T+T+V      + WEPP YDGG+ I  Y IE + K S RW    
Sbjct: 6810 VEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 6869

Query: 671  FDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTSPPTLLTV 726
                ++ +     ++EG  Y  R+ A N IG+ KPS  + PFV    P+   SPP  LT 
Sbjct: 6870 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAAT-PFVKVADPIERPSPPVNLTS 6928

Query: 727  DSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVAN 786
               T ++V ++W PP   G + + GY++E C EG                   ++WI  N
Sbjct: 6929 SDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGK------------------DNWIRCN 6970

Query: 787  KDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLK 846
              L+ +  + +TGL    K   RV A N AG S+P     P+   +    P + +    K
Sbjct: 6971 MKLVPELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSA-FK 7029

Query: 847  QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSH 905
                  V   + +++P  G PRP  TW      ++  +++ ++       + I  +ERS 
Sbjct: 7030 DGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSD 7089

Query: 906  SGKYDLQVKVDKFVETAS--IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAI 963
             G Y L  K++  V+T S  ID+ +I RP  P+ +K  D+  ++V LTW PP DDG + +
Sbjct: 7090 KGIYTL--KLENRVKTISGEIDVNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPL 7147

Query: 964  TGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 1017
            TGY ++K +     W  V++       T+ +LV G EY F+V + N CG  E A
Sbjct: 7148 TGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 7201



 Score =  278 bits (711), Expect = 2e-74
 Identities = 166/521 (31%), Positives = 269/521 (51%), Gaps = 35/521 (6%)

Query: 511   TLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
             TLP  V     I+PP+I LD  D    V + A   LRL + I G P P+  W + +  + 
Sbjct: 18719 TLPGSVVAQERIEPPEIELDA-DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT 18777

Query: 568   EGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
             +   R + E     + LVID   R DSG Y++ L+N +G   A + V+V+D P  PV  T
Sbjct: 18778 D---RAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLT 18834

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             + EV  D   ++WEPP  DGG+ I  Y +E+++     +  +  + C +TTF  + + EG
Sbjct: 18835 IREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITNN-CTKTTFRIENLQEG 18893

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
              +Y  R+ A N  GI  P+  + P        PP  +T+  VT  T T++W  P+  G +
Sbjct: 18894 CSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGS 18953

Query: 748   GLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIF 807
              + GYV+E   +GS                  E W    +  +   + TI+GL    +  
Sbjct: 18954 KITGYVVEMQTKGS------------------EKWSTCTQ--VKTLEATISGLTAGEEYV 18993

Query: 808   VRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKP 867
              RV AVN  G S+P+    P++ ++I   P + +P H   T+  +  E + + +PF+G+P
Sbjct: 18994 FRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFH---TFNVKAREQLKIDVPFKGRP 19050

Query: 868   RPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDI 926
             +  + W+KDG  + +  ++N+ +S+T T + I++A +   G Y+L V       T  I I
Sbjct: 19051 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITI 19110

Query: 927   QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYH 986
              ++DRPGPP  ++I++V  +++ ++W PP+ DG   I+ Y ++K +  S  W  V +   
Sbjct: 19111 IVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTTWHIVSQAVA 19170

Query: 987   RTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIA 1027
             RTS  I  L  G+EY FRV +EN  G S   + ++ SAV+A
Sbjct: 19171 RTSIKIVRLTTGSEYQFRVCAENRYGKS---SYSESSAVVA 19208



 Score =  270 bits (691), Expect = 4e-72
 Identities = 179/588 (30%), Positives = 288/588 (48%), Gaps = 53/588 (9%)

Query: 438   PLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQ------ESDRLKVVHKGRIHKLVIA 491
             P+ D    +   I  KC++S    G+WT    P        E ++L   H+       I 
Sbjct: 16489 PIYDGGCEIQGYIVEKCDVSV---GEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAIN 16545

Query: 492   NALTEDEGDYVFAPDAYNVTLPAKVHV---IDPPKIILDGLDADNTVTVIAGNKLRLEIP 548
              A   +  D           +P  + V   ++ P I LD L+    + + AG  LRL +P
Sbjct: 16546 KAGVGEHAD-----------VPGPIIVEEKLEAPDIDLD-LELRKIINIRAGGSLRLFVP 16593

Query: 549   ISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEA 608
             I G P P+  W + D  I + +    T S+   ++LV+D   R DSG Y + L+N +G  
Sbjct: 16594 IKGRPTPEVKWGKVDGEIRDAAIIDVTSSF---TSLVLDNVNRYDSGKYTLTLENSSGTK 16650

Query: 609   HASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
              A + V+V+D P PPV   VTE+  D   + WEPP  DGGS I  Y +E+++     +  
Sbjct: 16651 SAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAA 16710

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             +  + C + +++  ++ EG +Y  R+ A N  GI  P+  + P     V  PP  +TVD 
Sbjct: 16711 VVTN-CHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKITVDD 16769

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
             VT  +V++ W  P+H G + +  Y++E        AK S++  E A              
Sbjct: 16770 VTRNSVSLSWTKPEHDGGSKIIQYIVE------MQAKHSEKWSECA-------------- 16809

Query: 789   LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT 848
              +   +  IT L    +   RV AVN  G S+P+  + PI+ K+++  P +   +    +
Sbjct: 16810 RVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDV---KPAFSS 16866

Query: 849   YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSG 907
             Y  +VG+ + + +P  G+P+P +TW KDG  + +  +IN+ +S   T + I++  +   G
Sbjct: 16867 YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGG 16926

Query: 908   KYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGY 966
             +Y + V      +TASI+I  +D+P PP+  VK +DV  E++ L+W PP   G   IT Y
Sbjct: 16927 QYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNY 16986

Query: 967   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
              +QK D  +  W  V     RT+  +T+L  G EY FR+F+EN  G S
Sbjct: 16987 IVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS 17034



 Score =  259 bits (662), Expect = 1e-68
 Identities = 158/580 (27%), Positives = 280/580 (48%), Gaps = 37/580 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++ P++ LD  +    + V AG   R+ IP  G P P+  WSR +    E + +++ E  
Sbjct: 17647 LEAPELDLDS-ELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEG---EFTDKVQIEKG 17702

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
              + + L ID  +R+D+G Y + L+N +G   A + VKV+D P PP    V EV  D   +
Sbjct: 17703 VNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFL 17762

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              WEPP  DGG+ +  Y I++++     +  ++   C +T+F+ + + EG  Y  R+ A N
Sbjct: 17763 VWEPPIIDGGAKVKNYVIDKRESTRKAYANVS-SKCSKTSFKVENLTEGAIYYFRVMAEN 17821

Query: 699   AIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
               G+  P             SPP  +T+  V+ T+ ++ W  P+H G + + GYV+E   
Sbjct: 17822 EFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQP 17881

Query: 759   EGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA 818
             +G+                  E W +  +  +      +TGL +  +   RVKA N  G 
Sbjct: 17882 KGT------------------EKWSIVAESKV--CNAVVTGLSSGQEYQFRVKAYNEKGK 17921

Query: 819   SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGA 878
             S+P+    P++ K++   P +++P +   TY  + GE + + IP  G+PRP ++W KDG 
Sbjct: 17922 SDPRVLGVPVIAKDLTIQPSLKLPFN---TYSIQAGEDLKIEIPVIGRPRPNISWVKDGE 17978

Query: 879   EIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPP-Q 936
              + +  ++N+  + T T++ I++  +   GKY +         T ++ + ++++PGPP  
Sbjct: 17979 PLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVG 18038

Query: 937   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELV 996
              V+ ++V  + V ++W PP   G   I+ Y ++K D  +  W  V     RT+  IT+L 
Sbjct: 18039 PVRFDEVSADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLK 18098

Query: 997   IGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
              G EY FR+F+EN  G S  A +  ++ ++      +K P      F  +    Q LV  
Sbjct: 18099 TGTEYQFRIFAENRYGKS--APLDSKAVIVQYP---FKEPGPPGTPFVTSISKDQMLVQW 18153

Query: 1057  YAIAGYNAT--LNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
             +       T  +   +    K  I W+K     + D +++
Sbjct: 18154 HEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFK 18193



 Score =  248 bits (632), Expect = 3e-65
 Identities = 149/496 (30%), Positives = 252/496 (50%), Gaps = 30/496 (6%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PP+I LD  D    VT+ A   LRL +PI G P P+  W+R     ++ +    T SY  
Sbjct: 15485 PPEIELDA-DLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSY-- 15541

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              + L++    R DSG Y + ++N +G   A + V+V+D P PP    V EV      + W
Sbjct: 15542 -TLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTW 15600

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGGS I  Y +E+++     +  +  + C +T+++  ++ EG +Y  R+ A N  
Sbjct: 15601 DPPLLDGGSKIKNYIVEKRESTRKAYSTVATN-CHKTSWKVDQLQEGCSYYFRVLAENEY 15659

Query: 701   GISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
             GI  P+  +          PP  +T+  VT  +V++ W  P+H G + + GY++E   +G
Sbjct: 15660 GIGLPAETAESVKASERPLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKG 15719

Query: 761   STSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
             S                  + W  A    +  T+ TITGL    +   RV A N  G S+
Sbjct: 15720 S------------------DKW--ATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISD 15759

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
             P+  S P++ K+++ PP  ++   L  T+    GE + + +PF G+P P +TW KD   +
Sbjct: 15760 PRQLSVPVIAKDLVIPPAFKL---LFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPL 15816

Query: 881   DK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IV 938
              +  ++N  ++E ++++ I+ A R   G Y +++         ++++ ++D+PGPP   V
Sbjct: 15817 KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPV 15876

Query: 939   KIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIG 998
             K+++V  +++ L+W PPK DG ++I  Y ++K D  +  W  V     RT+     L  G
Sbjct: 15877 KMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTG 15936

Query: 999   NEYYFRVFSENMCGLS 1014
              EY FR+ +EN  G S
Sbjct: 15937 CEYQFRIAAENRYGKS 15952



 Score =  244 bits (624), Expect = 3e-64
 Identities = 156/511 (30%), Positives = 243/511 (47%), Gaps = 35/511 (6%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG--DKAIMEGSGRIRT 575
             +++PP+I LD       V V AG  +RL   + G P PK  W +   D  + +G    + 
Sbjct: 12228 ILEPPEIDLDA-SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG----QV 12282

Query: 576   ESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
             +     + LVI  + RDDSG Y + L N AGE    + V+V+D P P     V++V    
Sbjct: 12283 DLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTS 12342

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++W PP  DGGS +  Y +E+++     W  +  ++ K+T+F    ++ G  Y  R+ 
Sbjct: 12343 CHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEV-KKTSFHVTNLVPGNEYYFRVT 12401

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             AVN  G   P+   +P +   PL+   PP  L V  +T  + T+ W PP   G A +DGY
Sbjct: 12402 AVNEYGPGVPTDVPKPVLASDPLSEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGY 12461

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             +  Y  E                + PA+ W      ++      +TGL    K   RV A
Sbjct: 12462 ITSYREE----------------EQPADRW--TEYSVVKDLSLVVTGLKEGKKYKFRVAA 12503

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
              NA G S P+        KE + PPKI +P  +      + G+ + +     GKP P   
Sbjct: 12504 RNAVGVSLPREAEGVYEAKEQLLPPKILMPEQI----TIKAGKKLRIEAHVYGKPHPTCK 12559

Query: 873   WKKDGAE-IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
             WKK   E +  + + +  +++ +I+ I+   R  SG Y L  +     +T  I + ++D 
Sbjct: 12560 WKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDA 12619

Query: 932   PGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSA 990
             PGPPQ    I D+  +  +L+W  P +DG + IT Y ++K D    +W T +    +TS 
Sbjct: 12620 PGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSC 12679

Query: 991   TITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
              + +L+ G EY FRV +EN  G+SE  T  K
Sbjct: 12680 RVGKLIPGQEYIFRVRAENRFGISEPLTSPK 12710



 Score =  244 bits (623), Expect = 3e-64
 Identities = 143/488 (29%), Positives = 242/488 (49%), Gaps = 34/488 (6%)

Query: 534   TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSS----TLVIDIA 589
             T+ V AG    + +P  G P P  +WS+ D  +       RT +Y D++    +L I+ A
Sbjct: 19823 TLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDL-------RTRAYVDTTDSRTSLTIENA 19875

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R+DSG Y + ++N    A  ++ VKV+D P PP   TV +V  +  +++W+ P  DGG+
Sbjct: 19876 NRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGA 19935

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y IE+++     W+ +  + C   +++   + EG  Y  R+   N  G+  P+   
Sbjct: 19936 PVKNYHIEKREASKKAWVSVT-NNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETK 19994

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
                      SPP  L V S++  +V++ W  P+H G + +  YV+E   +G         
Sbjct: 19995 EGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQ-------- 20046

Query: 770   NGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPIL 829
                       ++W+     +   T   ++GL  +++ F RV A N AG S+P+    P+L
Sbjct: 20047 ----------KNWVKC--AVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVL 20094

Query: 830   VKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIR 888
             +KE +EPP+I +      T   R G  + + IP  GKP P++T  +DG  +    + N  
Sbjct: 20095 IKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTE 20154

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGEN 947
              +  +  I ++++  + +G+Y++          A I+I ++DRPGPP   V I D+  E+
Sbjct: 20155 ITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEES 20214

Query: 948   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 1007
             V L W PPK DG + +T Y + K +  +  W  V     RT   + +L  G EY FR+ +
Sbjct: 20215 VTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKA 20274

Query: 1008  ENMCGLSE 1015
             EN  G+S+
Sbjct: 20275 ENRFGISD 20282



 Score =  244 bits (622), Expect = 4e-64
 Identities = 157/500 (31%), Positives = 254/500 (50%), Gaps = 31/500 (6%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P + LD    D  V V AG  +R+   +SG+PPP   W+  ++ + + +     E+   S
Sbjct: 10150 PDLQLDASVRDRIV-VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAIS 10205

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE-VGDDWCIMNW 640
             S++VI   +R   GVY +  KNEAGE   +I V V+D P P   P +   + ++ C + W
Sbjct: 10206 SSMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTW 10265

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGGSPI  Y IE+++     W  + + + ++     + +I+G AY  RI A N+I
Sbjct: 10266 FSPEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNA-TVQGLIQGKAYFFRIAAENSI 10324

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+      S   V   P+ V   P  L V  VT  TVT+ W PP + G + +  YVLE  
Sbjct: 10325 GMGPFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESR 10384

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
               G+    +                 V N +L+ + K+T+ GL        RV AVN  G
Sbjct: 10385 LIGTEKFHK-----------------VTNDNLLSR-KYTVKGLKEGDTYEYRVSAVNIVG 10426

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDG 877
               +P + ++PI  K+ + PP + +    K T   RVGEA  L   + GKP+P+++W KD 
Sbjct: 10427 QGKPSFCTKPITCKDELAPPTLHLDFRDKLTI--RVGEAFALTGRYSGKPKPKVSWFKDE 10484

Query: 878   AEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 936
             A++ + ++ +I+ +     +   KA+RS SGKY + V+           + ++DRPGPP 
Sbjct: 10485 ADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPV 10544

Query: 937   -IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITEL 995
               V  ++V  + + ++W PP DDG + IT Y I+K +     W  V     +T+  +++L
Sbjct: 10545 GPVSFDEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKL 10604

Query: 996   VIGNEYYFRVFSENMCGLSE 1015
             + G +Y FR+ +EN+ G+S+
Sbjct: 10605 LEGKDYIFRIHAENLYGISD 10624



 Score =  239 bits (611), Expect = 8e-63
 Identities = 151/488 (30%), Positives = 240/488 (49%), Gaps = 28/488 (5%)

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             D   TVT+ AG  LRL + +SG PPP   WS+    +   +    TESY   S L++D  
Sbjct: 23079 DLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESY---SLLIVDKV 23135

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
              R D+G Y I  +N++G+  A++ VKV D P P  +  V EV  D   + WE P  DGG+
Sbjct: 23136 NRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGA 23195

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P+  Y +E K++ + R  +     C +T +    ++EG  Y  R+   N  GI +P   S
Sbjct: 23196 PVNNYIVE-KREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETS 23254

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
                +   V   P  L V  VT +TVT+ W  P + G + L GYVLE C  G+        
Sbjct: 23255 DAVLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGT-------- 23306

Query: 770   NGEAAYDLPAEDW--IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQP 827
                       E W  +V  K  +   + T+T L    +   R++A N  G SEP+     
Sbjct: 23307 ----------ERWMKVVTLKPTV--LEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTA 23354

Query: 828   ILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQIN 886
             + V+++   P I +    ++T     G  V LVIP  G+P P  +W   G+++ +  ++ 
Sbjct: 23355 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 23414

Query: 887   IRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWG 945
             +        + IR+     +G+Y L++K      + +I + I+D+PGPP   +KI+++  
Sbjct: 23415 VETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDA 23474

Query: 946   ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 1005
              ++ ++W PP+ DG A ++GY +++ D     W  V E   R++   T L  GNEY FRV
Sbjct: 23475 TSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRV 23534

Query: 1006  FSENMCGL 1013
              + N  G+
Sbjct: 23535 AATNRFGI 23542



 Score =  239 bits (610), Expect = 1e-62
 Identities = 152/526 (28%), Positives = 245/526 (46%), Gaps = 40/526 (7%)

Query: 508  YNVTLPAKVHVIDPPKIILDGLDADNT--------------VTVIAGNKLRLEIPISGEP 553
            Y V+   K  V DP +I L  L AD+               + VI  N + + +P +G P
Sbjct: 6992 YRVSAENKAGVSDPSEI-LGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYP 7050

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
             P A W  GDK ++E   R++ ++    + LVI  +ER D G+Y + L+N        I 
Sbjct: 7051 RPTATWCFGDK-VLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEID 7109

Query: 614  VKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL 673
            V V+  P  P      ++  D   + WEPP  DGGSP+ GY +E+++     W ++  D 
Sbjct: 7110 VNVIARPSAPKELKFGDITKDSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKV-MDF 7168

Query: 674  CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPF---VPLAVTSPPTLLTVDSVT 730
              +  F    +++G  Y  ++ A N  G  +P+    P     P  V  PP  +     T
Sbjct: 7169 VTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPAYVDEPVNMSTPATVPDPPENVKWRDRT 7228

Query: 731  DTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLI 790
              ++ + W PP + G + + GY++E C  GS                  + W+   +  +
Sbjct: 7229 ANSIFLTWDPPKNDGGSRIKGYIVERCPRGS------------------DKWVACGEP-V 7269

Query: 791  DKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYI 850
             +TK  +TGL        RVKA+N  GAS+P   ++ I   +  E P+I +   L     
Sbjct: 7270 AETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLT 7329

Query: 851  RRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKY 909
             + G  + L     GKP P++TW K    + ++ +I I N    + + I  ++RS +G Y
Sbjct: 7330 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 7389

Query: 910  DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
             ++        TA +++ ++D+PGPP    I DV  E+  LTW PP+DDG + IT Y ++
Sbjct: 7390 IIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVE 7449

Query: 970  KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
            +    S  W  +      T+   T+L+   EY FRV +ENM G+ E
Sbjct: 7450 RRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGE 7495



 Score =  239 bits (610), Expect = 1e-62
 Identities = 138/399 (34%), Positives = 201/399 (50%), Gaps = 21/399 (5%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT V  D   ++W  P  DGGSPILGY +ERK++    W  ++  L     F
Sbjct: 14887 PGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIF 14946

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   + +G+AYE R+ A N  G SKPS PS P + L    PP      ++T  TVT++W 
Sbjct: 14947 KSSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWA 15006

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P++ G   +  Y++E                    DLP   W+ AN   I + +FT++G
Sbjct: 15007 KPEYTGGFKITSYIVE------------------KRDLPNGRWLKANFSNILENEFTVSG 15048

Query: 800   LPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVN 858
             L  DA    RV A NAAGA S P   S  I  ++ +E PKI++    K T I + GEA  
Sbjct: 15049 LTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFR 15108

Query: 859   LVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDK 917
             L     G+P P + W KDG E++   ++ I+ ++  T +  + + R  SG Y L      
Sbjct: 15109 LEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLTATNPG 15168

Query: 918   FVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                    +++++DRPGPP+  + + +V  E   L+W PP DDG A I  Y +QK +   +
Sbjct: 15169 GFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGGAKIDHYIVQKRETSRL 15228

Query: 977   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              W  V      T   +T+L+ GNEY FRV + N  G+ E
Sbjct: 15229 AWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGE 15267



 Score =  239 bits (610), Expect = 1e-62
 Identities = 162/609 (26%), Positives = 285/609 (46%), Gaps = 58/609 (9%)

Query: 429   DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIH 486
             D+KP       +  +V +G+++ ++  IS        WTK+GLP++++ R+ V     + 
Sbjct: 16859 DVKPA-----FSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT 16913

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPK--IILDGLDADNTVTVIA 539
              L I     +D G Y            A + ++     DPPK  +  D + A++      
Sbjct: 16914 TLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAES------ 16967

Query: 540   GNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRT-----ESYPDSSTLVIDIAERDDS 594
                    I +S  PP      +    I++      T      +    +TL +   +    
Sbjct: 16968 -------ITLSWNPPLYTGGCQITNYIVQKRDTTTTVWDVVSATVARTTLKVTKLKTGTE 17020

Query: 595   GVYHINLKNEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGS 649
               + I  +N  G++ A     +V       P PP  P  T +  D  ++ W  P  +GGS
Sbjct: 17021 YQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGS 17080

Query: 650   PILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPS 709
             P++GY +ERK++ S  W ++N  +  +T F+ + + EG+ YE R++A N +G+ K S  S
Sbjct: 17081 PVIGYHLERKERNSILWTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNS 17140

Query: 710   RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDE 769
               +V      PP       V    +T++W  P + G + + GY++E              
Sbjct: 17141 ECYVARDPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVE-------------- 17186

Query: 770   NGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA-SEPKYYSQPI 828
                   DLP   W+ A+   + +T+FT++GL  D +   RV A NAAGA S+P   + PI
Sbjct: 17187 ----KRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPI 17242

Query: 829   LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINI 887
               K+ +E P+I +    + T +   GE   L     GKP P + W +   EI+++ +  I
Sbjct: 17243 TAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEI 17302

Query: 888   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGE 946
             +N++   ++ ++ A R   G+Y L+       ++  ++++++DRPGPP+  V++  V  E
Sbjct: 17303 KNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSE 17362

Query: 947   NVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVF 1006
               +LTW+PP  DG + I+ Y ++K +   + W  V       S  +T+L+ GNEY FR+ 
Sbjct: 17363 KCSLTWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIM 17422

Query: 1007  SENMCGLSE 1015
             + N  G+ E
Sbjct: 17423 AVNKYGVGE 17431



 Score =  239 bits (610), Expect = 1e-62
 Identities = 171/602 (28%), Positives = 283/602 (47%), Gaps = 51/602 (8%)

Query: 436   LTPLTDQTVNL--GKEICLKCEISENIP--GKWTKNGLPVQESDRLKVVHKGRIHKLVIA 491
             L+ +  +T+++  G+ + L   I+   P    W   G  ++ES+R+ V    ++ KL I 
Sbjct: 23368 LSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIR 23427

Query: 492   NALTEDEGDYVFAPDAYNVTLPA----KVHVIDPP-----KIILDGLDADNTVTVIAGNK 542
                  D G+Y    +  NVT       KV ++D P      I +D +DA +        +
Sbjct: 23428 ETTIRDTGEYTL--ELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEPPE 23485

Query: 543   LRLEIPISG-----EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVY 597
             L    P+SG         +  W    +++   + +    +  +     +    R   G Y
Sbjct: 23486 LDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIGSY 23545

Query: 598   HINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
                L++E  E  +SI++     P PP    + +V  D   + W PP  DGGS + GY +E
Sbjct: 23546 ---LQSEVIECRSSIRI-----PGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVE 23597

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK+ ++ RW+R+N      T +    + EG+ YE R+ A+NA G  KPS PS+P V +  
Sbjct: 23598 RKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDP 23657

Query: 718   TSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAA 774
              +PP       VTDTT   V++ W  P+  G + + GY++E         ++ D++    
Sbjct: 23658 IAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIE--------MQKVDQH---- 23705

Query: 775   YDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII 834
                   +W   N       ++T+T LP  A+   RV A NA G  EP      + V E++
Sbjct: 23706 ------EWTKCNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEML 23759

Query: 835   EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT 894
             E P   +    ++    R G  + L IP +GKP P   W K+G +I K  + I  SET T
Sbjct: 23760 EYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAM-IATSETHT 23818

Query: 895   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWT 953
              + I++A+R  SG YDL ++     +   I +++I  P  P+  ++ +D+   +V ++W 
Sbjct: 23819 ELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPLEYDDIQVRSVRVSWR 23878

Query: 954   PPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGL 1013
             PP DDG A I GY +++ +     W+T+      TS  +  L    EY+FRV +EN  G+
Sbjct: 23879 PPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGI 23938

Query: 1014  SE 1015
             S+
Sbjct: 23939 SK 23940



 Score =  238 bits (607), Expect = 2e-62
 Identities = 169/578 (29%), Positives = 277/578 (47%), Gaps = 44/578 (7%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH--VIDP 521
             W K+G+ ++E  R +++       L + + +  D G YV        T    V+  V+D 
Sbjct: 19451 WAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 19510

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + ++GL A+         +      I      K   S     I EG  ++   
Sbjct: 19511 PGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQM--- 19567

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEV 631
                 +S  V  + + ++  ++ +   N+   GE   S+ +K +D    P PP +  +T V
Sbjct: 19568 ----TSCKVTKLLKGNEY-IFRVTGVNKYGVGEPLESVAIKALDPFTVPSPPTSLEITSV 19622

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               +   + W  P  DGGS I GY IER++K S RW+R+N     +   +   + EG  YE
Sbjct: 19623 TKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLRVKSTGLREGCEYE 19682

Query: 692   VRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAG 748
              R++A NA G+S PS  S   R   P+ + SPP+   +     TT+T+ W  P   G A 
Sbjct: 19683 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19742

Query: 749   LDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFV 808
             + GY +EY        K+SD+           DW  + + L   T++TI+GL T A+   
Sbjct: 19743 ITGYTVEY--------KKSDDT----------DWKTSIQSLRG-TEYTISGLTTGAEYVF 19783

Query: 809   RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPR 868
             RVK+VN  GAS+P   S P + KE  E P   I   +++T I + G +  + +PF+G+P 
Sbjct: 19784 RVKSVNKVGASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPV 19843

Query: 869   PELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI 928
             P + W K   ++ + +  +  +++ T + I  A R+ SGKY L ++      + ++ +++
Sbjct: 19844 PNVLWSKPDTDL-RTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKV 19902

Query: 929   IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT 988
             +D PGPP  + ++DV  E+  L+W  P++DG A +  Y I+K +     W +V  + +R 
Sbjct: 19903 LDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNNCNRL 19962

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1026
             S  +T L  G  YYFRV  EN  G+   A  TKE   I
Sbjct: 19963 SYKVTNLQEGAIYYFRVSGENEFGVGIPAE-TKEGVKI 19999



 Score =  236 bits (603), Expect = 7e-62
 Identities = 153/533 (28%), Positives = 261/533 (48%), Gaps = 43/533 (8%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP+  LD  D   T+ + AG  +RL +P+ G PPPK  WS+ +  + +  G +  +S
Sbjct: 13315 ILIPPEGELDA-DLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIG-LDIKS 13372

Query: 578   YPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCI 637
                 + L  +   + D+G Y + L+N  G+   +I VKV+D P PPV  TV E+  D   
Sbjct: 13373 TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAY 13432

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + WEPP  DGGSPI+ Y ++++  +   W  +  + C +T+F    + EG +Y  R+FA 
Sbjct: 13433 VTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTE-CSKTSFRVANLEEGKSYFFRVFAE 13491

Query: 698   NAIGISKPSMPSRPFVPLAVTSPPTL-LTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             N  GI  P   +R  V  + T  P + L V SV+ ++ ++ W+ P   G + + GYV+++
Sbjct: 13492 NEYGIGDPG-ETRDAVKASQTPGPVVDLKVRSVSKSSCSIGWKKPHSDGGSRIIGYVVDF 13550

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                       ++EN           W    K L    +++   L    +   RV A N  
Sbjct: 13551 L---------TEEN----------KWQRVMKSL--SLQYSAKDLTEGKEYTFRVSAENEN 13589

Query: 817   GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK- 875
             G   P   +  ++ ++ +  P + +       Y+ +      L IP +GKP P ++WKK 
Sbjct: 13590 GEGTPSEIT--VVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKG 13647

Query: 876   DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPG-P 934
             +       ++++ +S  +T + +   ++S +GKY + +K     +  +I I+++ +PG P
Sbjct: 13648 EDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIP 13707

Query: 935   PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE 994
                +K ++V  E + L W PPKDDG + IT Y ++K D  + +W T      +T+  +T 
Sbjct: 13708 TGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTR 13767

Query: 995   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP 1047
             L  G EY FRV +EN  G+ E     K   ++AR            FD  +AP
Sbjct: 13768 LHEGMEYTFRVSAENKYGVGEG---LKSEPIVAR----------HPFDVPDAP 13807



 Score =  236 bits (603), Expect = 7e-62
 Identities = 185/698 (26%), Positives = 312/698 (44%), Gaps = 80/698 (11%)

Query: 364   EVSEDDANVKWFK----NGEEII-------PGPKSRYRIRVEGKKHILIIEGATKADAAE 412
             +VS+  A++ W K     G  ++       P    ++ I  E K    ++ G +     +
Sbjct: 17851 DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQ 17910

Query: 413   YSVMTTG--GQSSAKL--------SVDLKPLKILTPLTDQTVNLGKEICLKCEI----SE 458
             + V      G+S  ++         + ++P  +  P    ++  G+++ ++  +      
Sbjct: 17911 FRVKAYNEKGKSDPRVLGVPVIAKDLTIQP-SLKLPFNTYSIQAGEDLKIEIPVIGRPRP 17969

Query: 459   NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAP--DAYNVTLPAKV 516
             NI   W K+G P++++ R+ V        L I     +D G Y       A   T    V
Sbjct: 17970 NI--SWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSV 18027

Query: 517   HVIDPP-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
              V++ P      +  D + AD  V             IS EPP      +    I+E   
Sbjct: 18028 IVLEKPGPPVGPVRFDEVSADFVV-------------ISWEPPAYTGGCQISNYIVEKRD 18074

Query: 572   RIRTESYPDSSTLV---IDIAERDDSGVYHINL--KNEAGE-AHASIKVKVVDFP----D 621
                T  +  S+T+    I I +      Y   +  +N  G+ A    K  +V +P     
Sbjct: 18075 TTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFKEPG 18134

Query: 622   PPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEP 681
             PP  P VT +  D  ++ W  P  DGG+ I+GY +E+K+K S  W++LN    ++T F+ 
Sbjct: 18135 PPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKT 18194

Query: 682   KKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
               + EG+ YE ++ A N +GI KPS  S  FV      PP       +T   VT++W+ P
Sbjct: 18195 TGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVITRNNVTLKWKKP 18254

Query: 742   DHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
              + G + + GY++E                    DLP   W+ A+   + +T+FT++GL 
Sbjct: 18255 AYDGGSKITGYIVE------------------KKDLPDGRWMKASFTNVLETEFTVSGLV 18296

Query: 802   TDAKIFVRVKAVNAAG-ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
              D +   RV A NAAG  SEP   S  I  ++ I+ P   +    K   +   GE   L 
Sbjct: 18297 EDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLE 18356

Query: 861   IPFQGKPRPELTWKKDGAEIDKN--QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 918
                +GKP P++ W KDG E+++   ++ I+++   T + ++   R+  G+Y L++     
Sbjct: 18357 ADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 18416

Query: 919   VETASIDIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
              ++  I ++++DRPGPP+  +K+  V  E   L W PP  DG A I+ Y I+K +   + 
Sbjct: 18417 TKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLS 18476

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V       +  +T+L+ GNEY FRV + N  G+ E
Sbjct: 18477 WTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGE 18514



 Score =  234 bits (596), Expect = 5e-61
 Identities = 171/604 (28%), Positives = 285/604 (47%), Gaps = 46/604 (7%)

Query: 428   VDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             +DLK   +LT     T+ L  E  ++ +    +     K+   +  S R+K+  +    K
Sbjct: 11831 LDLKLSGVLTVKAGDTIRL--EAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11888

Query: 488   LVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL 545
               +  A   D G YV      A +    A V+V+D P     G   +  +  ++ ++   
Sbjct: 11889 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKP-----GPVRNLKIVDVSSDRCT- 11942

Query: 546   EIPISGEPPPKAMWSRGDKAIMEG--SGRIRTESYPDS----STLVIDIAERDDSGVYHI 599
                +  +PP           I+E   + R+   +Y  +     T V  + E ++  ++ +
Sbjct: 11943 ---VCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEY-IFRV 11998

Query: 600   NLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGY 654
               +N+ G     E+   I     D P  P  P VT+V  +   + W PP YDGG  I GY
Sbjct: 11999 RAENKIGTGPPTESKPVIAKTKYDKPGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGY 12058

Query: 655   FIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV- 713
             F+E+K+K S+RW+ +N     E   + + ++    Y+ R+ A N IGI +PS+PSRP V 
Sbjct: 12059 FLEKKEKHSTRWVPVNKSAIPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSRPVVA 12118

Query: 714   --PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENG 771
               P+    PPT   V   T  ++T+ W  P + G A + GYV+E         K +D + 
Sbjct: 12119 KDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEM------RPKIADAS- 12171

Query: 772   EAAYDLPAEDWIVANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 830
                   P E W   N    + + +FT+T L  + +   RV A N  G   P    + I  
Sbjct: 12172 ------PDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKP 12225

Query: 831   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE--IDKNQINIR 888
             KEI+EPP+I +   +++  I R G  + L    +G+P P++TW+K G +  + K Q+++ 
Sbjct: 12226 KEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDL- 12284

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENV 948
               +T   + I  + R  SGKY L +      +   ++++++D PGP   +K+ DV   + 
Sbjct: 12285 -VDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVTKTSC 12343

Query: 949   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 1008
              ++W PP++DG + +T Y ++K +     W TV     +TS  +T LV GNEYYFRV + 
Sbjct: 12344 HVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAV 12403

Query: 1009  NMCG 1012
             N  G
Sbjct: 12404 NEYG 12407



 Score =  233 bits (594), Expect = 8e-61
 Identities = 202/725 (27%), Positives = 321/725 (44%), Gaps = 83/725 (11%)

Query: 332   STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKW----FKNGEEIIP---- 383
             S  L +REP I V ++ ED        +E++ EV+++   + W    +  G EII     
Sbjct: 10333 SEALVIREP-ITVPERPED--------LEVK-EVTKNTVTLTWNPPKYDGGSEIINYVLE 10382

Query: 384   ----GPKSRYRIRVEGK-KHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTP 438
                 G +  +++  +        ++G  + D  EY V         K S   KP+     
Sbjct: 10383 SRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDE 10442

Query: 439   LTDQTVNLGKEICLKCEISE------NIPGK------WTKNGLPVQESDRLKVVHKGRIH 486
             L   T++L     L   + E         GK      W K+   V E DR  +       
Sbjct: 10443 LAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATL 10502

Query: 487   KLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVIDPPKIILDGLDADNTVTVIAGNK 542
              L    A   D G Y    +  N T   K    V+V+D P   +  +  D          
Sbjct: 10503 ALEKIKAKRSDSGKYCVVVE--NSTGSRKGFCQVNVVDRPGPPVGPVSFDEVT------- 10553

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR------TESYPDSSTLVIDIAERDDSGV 596
              +  + IS +PP     S+    I+E     +      T +   ++  V  + E  D  +
Sbjct: 10554 -KDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDY-I 10611

Query: 597   YHINLKNEAG--EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPI 651
             + I+ +N  G  +   S  +K  D    PD P  P VTEV  D  ++ W  P +DGG PI
Sbjct: 10612 FRIHAENLYGISDPLVSDSMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKP-HDGGKPI 10670

Query: 652   LGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
               Y +E+++  S RW R+  D +   T F    ++EG  YE R+ A N IGI  PS PS+
Sbjct: 10671 TNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK 10730

Query: 711   PFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQS 767
             P     P+A  SPP        T  +V + W+PP H G + + GY++EY        K  
Sbjct: 10731 PVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEY-------QKVG 10783

Query: 768   DENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQP 827
             DE    A   P         +   +TK+ +TGL        RV AVNAAG S+P +  +P
Sbjct: 10784 DEEWRRANHTP---------ESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEP 10834

Query: 828   ILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINI 887
             +LVK+ +EPP++ +  ++ +    +VG+ + L    +G P P++TWKK+  +    +  I
Sbjct: 10835 VLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAP-TKARI 10893

Query: 888   RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGEN 947
               +   + + IR A     G Y L V+     +T S+ + ++D+PGPP+ +++ ++  ++
Sbjct: 10894 DVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDS 10953

Query: 948   VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFS 1007
               LTW  P DDG + IT Y +++ D  S +W  +     + S     L  GN+Y FRV +
Sbjct: 10954 CYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAA 11013

Query: 1008  ENMCG 1012
             EN  G
Sbjct: 11014 ENQYG 11018



 Score =  233 bits (593), Expect = 1e-60
 Identities = 172/611 (28%), Positives = 288/611 (47%), Gaps = 45/611 (7%)

Query: 241  LKRMRREEKKSAAFA-------KILDPAYQVDKGGR--VRFVVELADPKLEVKWYKNGQE 291
            L   R E  KSAA         +I++P   ++   +  V F  ++    + +KW KNG+E
Sbjct: 6341 LTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEE 6400

Query: 292  IRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT 351
            +    +  +     + +L I +C   D+ EY VTAG +K   EL + E P    + LED 
Sbjct: 6401 VPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQ 6460

Query: 352  TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA 411
            T    +     C++S + ANVKW++NG EI  G K  Y+   +G  H LII+     D  
Sbjct: 6461 TVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKK--YKFEKDGSIHRLIIKDCRLDDEC 6518

Query: 412  EYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLP 470
            EY+      +S A+L V+  P++I+ P  D     G ++    E++ + +  +W +N + 
Sbjct: 6519 EYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMV 6578

Query: 471  VQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD 530
            V + D+ +++ +G+IH+L I +    D+G+Y F   A +    AK+ +   PKI      
Sbjct: 6579 VVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFI--AKDKEARAKLELAAAPKI----KT 6632

Query: 531  ADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAE 590
            AD  + V  G  L + +P    P  +A W + ++ +   +     ++  + ++  I  A+
Sbjct: 6633 ADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT----IDTTAEQTSFRILEAK 6688

Query: 591  RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
            + D G Y I L+N+ G+A   I +KV+D P P     VTE  D    + WE P  DGGS 
Sbjct: 6689 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSK 6748

Query: 651  ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE-GVAYEVRIFAVNAIGISKPSMPS 709
            I+GY +ER+  +   W+ L  D  +   F    + + GV Y  R+ A N +G  +P    
Sbjct: 6749 IIGYVVERRDIKRKTWV-LATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETD 6807

Query: 710  RPFVPLA---VTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
             P    +   V  PP  +T+  V    V++ W PP++ G A +  YV+E      TS + 
Sbjct: 6808 NPVEARSKYDVPGPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIE--LRDKTSIR- 6864

Query: 767  SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
                 + A  + AED      D+++  +++            RV+A N  G  +P   + 
Sbjct: 6865 ----WDTAMTVRAEDLSATVTDVVEGQEYSF-----------RVRAQNRIGVGKPSAATP 6909

Query: 827  PILVKEIIEPP 837
             + V + IE P
Sbjct: 6910 FVKVADPIERP 6920



 Score =  232 bits (592), Expect = 1e-60
 Identities = 158/525 (30%), Positives = 252/525 (48%), Gaps = 40/525 (7%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS---RGDKAIMEGSGRI--- 573
            + P++ +D + A + +   AG+++R+   I G P PK+ W    +  KA+ +G   I   
Sbjct: 9434 EEPEVFID-IGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPED 9492

Query: 574  -RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVG 632
             + E+  +SS ++I   +R  +G Y I  KN+AG+  A+ +VKV+D P PP    V+++ 
Sbjct: 9493 AQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDIT 9552

Query: 633  DDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEV 692
               C ++W+ P  DGG  I GY IE++      W ++N D C  TTF    ++    Y  
Sbjct: 9553 RGSCRLSWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPD-CGSTTFVVPDLLSEQQYFF 9611

Query: 693  RIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGL 749
            R+ A N  GI  P    +      P+    PP  L +  +T  TV + W+PP + G + +
Sbjct: 9612 RVRAENRFGIGPPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPV 9671

Query: 750  DGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVR 809
              Y++E      T  K+             E W   NK  +++ +FT+  L    +   R
Sbjct: 9672 THYIVECLAWDPTGTKK-------------EAWRQCNKRDVEELQFTVEDLVEGGEYEFR 9718

Query: 810  VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 869
            VKAVNAAG S+P     P   +    PP I     LK+      G  VN+V   +G P P
Sbjct: 9719 VKAVNAAGVSKPSATVGPCDCQRPDMPPSI----DLKEFMEVEEGTNVNIVAKIKGVPFP 9774

Query: 870  ELTW------KKDGAE---IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
             LTW      K D  E    D +   +   +T T++ I ++ RS +G Y +    +    
Sbjct: 9775 TLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLV-IPQSRRSDTGLYTITAVNNLGTA 9833

Query: 921  TASIDIQIIDRPGPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
            +  + + ++ RPGPP   +K E V  + + L+W PPKDDG + IT Y I+K +     W 
Sbjct: 9834 SKEMRLNVLGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNYVIEKREANRKTWV 9893

Query: 980  TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1024
             V       + TI +L+ G+EY FR+ ++N  G+ E      E+A
Sbjct: 9894 HVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETA 9938



 Score =  232 bits (591), Expect = 2e-60
 Identities = 174/651 (26%), Positives = 304/651 (46%), Gaps = 60/651 (9%)

Query: 386   KSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVN 445
             K++Y+ R   +  + I   +  +D    +++         LSV +K L         TV 
Sbjct: 12887 KAQYQFRAIARTAVNISPPSEPSDPV--TILAENVPPRIDLSVAMKSLL--------TVK 12936

Query: 446   LGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              G  +CL   +  + +P   W K+G  ++ ++ +K+  +  +  L + +   +D GDY  
Sbjct: 12937 AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTI 12996

Query: 504   APDAYNVTLPA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSR 561
               +  + +  A  K+ V+D P     G  A   +  +  ++  L    S EPP +   S 
Sbjct: 12997 TAENSSGSKSATIKLKVLDKP-----GPPASVKINKMYSDRAML----SWEPPLEDGGSE 13047

Query: 562   GDKAIMEGSGRIRTESYPDSSTLVI---DIAERDDSGVYHINL--KNEAGEA-----HAS 611
                 I++     R      S+T+ I    + +  +   Y   +  +N+ G         +
Sbjct: 13048 ITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPA 13107

Query: 612   IKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR 668
             I     D P   DPPV   +T+   D   ++W+PPA DGGSPI GY +E+++ Q+  W +
Sbjct: 13108 IAKNPYDPPGRCDPPVISNITK---DHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTK 13164

Query: 669   LNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLT 725
             +N     E T +   + EG  YE R+ A+N  G  KPS  S+      P     PP    
Sbjct: 13165 VNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPPGPPAFPK 13224

Query: 726   VDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVA 785
             V   T ++V++ W  P + G + + GY++E         K++D +     +LP       
Sbjct: 13225 VYDTTRSSVSLSWGKPAYDGGSPIIGYLVE--------VKRADSDNWVRCNLPQN----- 13271

Query: 786   NKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHL 845
                 + KT+F +TGL  D +   RV AVN  G S+P         K+I+ PP+  +   L
Sbjct: 13272 ----LQKTRFEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADL 13327

Query: 846   KQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERS 904
             ++T I R G  + L +P +G+P P++TW K    + D+  ++I++++ DT +      + 
Sbjct: 13328 RKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKY 13387

Query: 905   HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT 964
              +GKY L ++     +  +I ++++D PGPP  V ++++  ++  +TW PP  DG + I 
Sbjct: 13388 DAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNVTVKEISKDSAYVTWEPPIIDGGSPII 13447

Query: 965   GYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              Y +QK D +   W TV     +TS  +  L  G  Y+FRVF+EN  G+ +
Sbjct: 13448 NYVVQKRDAERKSWSTVTTECSKTSFRVANLEEGKSYFFRVFAENEYGIGD 13498



 Score =  229 bits (585), Expect = 9e-60
 Identities = 149/513 (29%), Positives = 245/513 (47%), Gaps = 28/513 (5%)

Query: 506   DAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D+  VT   K V  +  P++ +D  +   T  V AG  +RL I   G P P A+WS+ D 
Sbjct: 21966 DSCEVTGTIKAVDRLTAPELDIDA-NFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDS 22024

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
              +   +    T+S+   STL ++   R+D+G Y + ++N +G    +  VKV+D P PP 
Sbjct: 22025 NLSLRADIHTTDSF---STLTVENCNRNDAGKYTLTVENNSGSKSITFTVKVLDTPGPPG 22081

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKM 684
               T  +V      + W+ P  DGG+ I  Y +E+++     W  ++ + C    F+   +
Sbjct: 22082 PITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVIS-EKCTRQIFKVNDL 22140

Query: 685   IEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
              EGV Y  R+ AVN  G+ +P     P V     +PP  L V   + ++  + W  PDH 
Sbjct: 22141 AEGVPYYFRVSAVNEYGVGEPYEMPEPIVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHD 22200

Query: 745   GAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDA 804
             G + + GY+LE   +GS                  + W+ A      +  FT+  L    
Sbjct: 22201 GGSRITGYLLEMRQKGS------------------DFWVEAGH--TKQLTFTVERLVEKT 22240

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   RVKA N AG SEP+     +++KE    P   +     Q    + G    + +P  
Sbjct: 22241 EYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPIS 22300

Query: 865   GKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 923
             G+P P++TWK +   + + ++++I  ++  T + ++ + R  SG+Y L ++    V+T S
Sbjct: 22301 GRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFS 22360

Query: 924   IDIQIIDRPGP-PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVI 982
             + + +I RPGP    +++  V  E+  L+W  PKD G   IT Y ++K +  +  W  V 
Sbjct: 22361 VTVVVIGRPGPVTGPIEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVN 22420

Query: 983   EHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
                 RT   +T L    EY FRV SEN  G+S+
Sbjct: 22421 SSVKRTQIKVTHLTKYMEYSFRVSSENRFGVSK 22453



 Score =  229 bits (584), Expect = 1e-59
 Identities = 159/586 (27%), Positives = 270/586 (46%), Gaps = 42/586 (7%)

Query: 465   TKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKI 524
             +++G+P++ + R           + +  ++T D G Y       + T  A ++++     
Sbjct: 20139 SRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIV----- 20193

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM---EGSGRIRTESYPDS 581
             +LD      T  V+  +     + +  EPP     S+    I+   E S  + TE     
Sbjct: 20194 VLDR-PGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATV 20252

Query: 582   STLVIDIAERDDSGVYHINLKNE--------AGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             +  ++ + +      Y   +K E           A  ++K+     P PP  P VT V  
Sbjct: 20253 ARTMMKVMKLTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTT-PGPPSTPWVTNVTR 20311

Query: 634   DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
             +   + W  P  +GGS ++GY +E K + S  W + N  + + T F+   +  G+ YE R
Sbjct: 20312 ESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEFR 20371

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYV 753
             ++A NA G+ KPS PS P + +    PP  + +  ++  +V++ W+ P   G + + GY+
Sbjct: 20372 VYAENAAGVGKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYI 20431

Query: 754   LEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAV 813
             +E                    DLP   W  A+   + +T+F I+GL  +++   RV A 
Sbjct: 20432 VE------------------RRDLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFAR 20473

Query: 814   NAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
             NA G+ S P     PI   +    P I +P    +    R G +V L     GKP P + 
Sbjct: 20474 NAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIE 20533

Query: 873   WKKDGAEIDKNQINIRNSETD-TIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
             W KD  E+  N +    + TD   I I+ A+R +SG Y+L+++      +A+I +QI+D+
Sbjct: 20534 WYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDK 20593

Query: 932   PGPP-QIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSA 990
             PGPP   ++ + V  E + L W PP DDG A IT Y ++K +   + W  V EH      
Sbjct: 20594 PGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYIVEKRETSRVVWSMVSEHLEECII 20653

Query: 991   TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
             T T+++ GNEY FRV + N  G+ E     +  +V+A++  +   P
Sbjct: 20654 TTTKIIKGNEYIFRVRAVNKYGIGEP---LESDSVVAKNAFVTPGP 20696



 Score =  228 bits (581), Expect = 3e-59
 Identities = 172/638 (26%), Positives = 274/638 (42%), Gaps = 44/638 (6%)

Query: 394   EGKKHILIIEGATKADAAEYSVMTTGGQSSAKL-SVDLKPLKILTPLTDQTVNLGKEICL 452
             EGK++   +    +      S +T   +       +DLK L  L  L  +  N   +I +
Sbjct: 13575 EGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPI 13634

Query: 453   KCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTL 512
             K + + ++   W K   P+    R+ V        L++ +    D G Y         T 
Sbjct: 13635 KGKPAPSV--SWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 13692

Query: 513   PA--KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
                  + V+  P I    +  D  VT  A       + +   PP     S     I+E  
Sbjct: 13693 EGTISIKVVGKPGIPTGPIKFDE-VTAEA-------MTLKWAPPKDDGGSEITNYILEKR 13744

Query: 571   GRIRTE-----SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV-----DFP 620
               +  +     S    +T  +          + ++ +N+ G         +V     D P
Sbjct: 13745 DSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSEPIVARHPFDVP 13804

Query: 621   DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFE 680
             D P  P + +V  D   + W  P   GGSPI GY +E K++ S  W R N    +   F+
Sbjct: 13805 DAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRANKTPIRMRDFK 13864

Query: 681   PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRP 740
                + EG+ YE R+ A+N  G+ KPS+PS P V L    PP    V ++T  +VT+ W  
Sbjct: 13865 VTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPPGKPEVINITRNSVTLIWTE 13924

Query: 741   PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
             P + G   L GY++E                    DLP++ W+ AN   + +  FT+T L
Sbjct: 13925 PKYDGGHKLTGYIVE------------------KRDLPSKSWMKANHVNVPECAFTVTDL 13966

Query: 801   PTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 859
                 K   R++A N AGA S P   ++ I+ K+  E P I +   +K     + G+ + L
Sbjct: 13967 VEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAGDTIVL 14026

Query: 860   -VIPFQGKPRPELTWKKDGAEIDKNQI-NIRNSETDTIIFIRKAERSHSGKYDLQVKVDK 917
               I   GKP P+ +W K G +I  + I  I ++ T +++ I+ A R  +G+Y +      
Sbjct: 14027 NAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPF 14086

Query: 918   FVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
               +   + + ++D PGPP  V+I +V  E   LTWTPP +DG + I  Y ++K +   + 
Sbjct: 14087 GTKVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKRETSRLL 14146

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V E         T+L+ GNEY FRV + N  G  E
Sbjct: 14147 WTVVSEDIQSCRHVATKLIQGNEYIFRVSAVNHYGKGE 14184



 Score =  227 bits (579), Expect = 4e-59
 Identities = 156/571 (27%), Positives = 260/571 (45%), Gaps = 50/571 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF--APDAYNVTLPAKVHVIDP 521
             W K+G  ++E+ R+ V     +  L I  A  ED G Y    +  A ++T+P  + V+D 
Sbjct: 19056 WRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19115

Query: 522   P----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             P     I +D +  D+             I IS  PP      +    I+E      T  
Sbjct: 19116 PGPPGPIRIDEVSCDS-------------ITISWNPPEYDGGCQISNYIVEKKETTSTTW 19162

Query: 578   YPDSSTLV---IDIAERDDSGVYHINL-------KNEAGEAHASIKVKVVDFPDPPVAPT 627
             +  S  +    I I        Y   +       K+   E+ A +       P PP  P 
Sbjct: 19163 HIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGTPK 19222

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEG 687
             V        ++ W+ P  DGGS ++GY +E K++ S  W + N  L  +T  +   + EG
Sbjct: 19223 VVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLDEG 19282

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA 747
             + YE R++A N  GI K S    P        PP    V ++T  +V+++W  P + G A
Sbjct: 19283 LMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGA 19342

Query: 748   GLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIF 807
              + GY++E                    +LP   W+  N   I +T F +T L  D +  
Sbjct: 19343 KITGYIVE------------------RRELPDGRWLKCNYTNIQETYFEVTELTEDQRYE 19384

Query: 808   VRVKAVNAA-GASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGK 866
              RV A NAA   SEP   + PI+VK+ +EPP++ +    +   + + GE + +     G+
Sbjct: 19385 FRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGR 19444

Query: 867   PRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASID 925
             P P ++W KDG EI++  +  I +++  T++ ++   R  +G+Y L +K      + +++
Sbjct: 19445 PLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVN 19504

Query: 926   IQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 984
              +++D+PGPP   ++I  +  E  +L+W  P++DG A I  Y ++K +   + W      
Sbjct: 19505 CKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDYYIVEKRETSHLAWTICEGE 19564

Query: 985   YHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
                TS  +T+L+ GNEY FRV   N  G+ E
Sbjct: 19565 LQMTSCKVTKLLKGNEYIFRVTGVNKYGVGE 19595



 Score =  226 bits (575), Expect = 1e-58
 Identities = 154/509 (30%), Positives = 238/509 (46%), Gaps = 33/509 (6%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ++PP++ILD   A     +  G+ LRL   I G P PK  W + D+   +   + R +  
Sbjct: 10841 LEPPELILDANMAREQ-HIKVGDTLRLSAIIKGVPFPKVTWKKEDR---DAPTKARIDVT 10896

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIM 638
             P  S L I  A  +D G+Y + ++N AG    S+KV V+D P PP    V+E+  D C +
Sbjct: 10897 PVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYL 10956

Query: 639   NWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVN 698
              W+ P  DGGS I  Y +ER+   S++W  L+    K++ F  K + EG  Y  R+ A N
Sbjct: 10957 TWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHF-AKHLNEGNQYLFRVAAEN 11015

Query: 699   AIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
               G     +   P +   PL    PP  L    V  T V++ W  PD  G + + GY++E
Sbjct: 11016 QYGRGPFVETPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVE 11075

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
             Y  EG+                  +DWI      +   +  +TGL        RVKA N 
Sbjct: 11076 YQEEGT------------------QDWI--KFKTVTNLECVVTGLQQGKTYRFRVKAENI 11115

Query: 816   AGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK 875
              G   P   + PI  +E + PP + +   L +  + + G  V      +G P P   W  
Sbjct: 11116 VGLGLPD-TTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTT 11174

Query: 876   DGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGP 934
             DG+EI  ++   +      +++ I+   R  +G+Y + V      +T ++ + ++D PGP
Sbjct: 11175 DGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGP 11234

Query: 935   PQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATIT 993
             P   + I DV  E++ ++W PPKDDG + +  Y ++K D +   W  V     +T   I 
Sbjct: 11235 PTGPINILDVTPEHMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIP 11294

Query: 994   ELVIGNEYYFRVFSENMCGLSE--DATMT 1020
              L  G EY FRV +EN  G+    D+T T
Sbjct: 11295 HLQKGCEYVFRVRAENKIGVGPPLDSTPT 11323



 Score =  224 bits (572), Expect = 3e-58
 Identities = 142/494 (28%), Positives = 240/494 (48%), Gaps = 29/494 (5%)

Query: 529   LDAD--NTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
             LDA+   T+ V AG  +R+ +PI G P P+  W++ +  +   +    TES+   + L+I
Sbjct: 14406 LDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESF---TLLII 14462

Query: 587   DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
                 R D+G + + ++N AG+    + V+V+D P P +    T++  D   ++W+ P  D
Sbjct: 14463 PECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLID 14522

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I  Y +E+++     +       C + T++   + EG  Y  R+ A N  GI +P+
Sbjct: 14523 GGSRITNYIVEKREATRKSYSTATTK-CHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPT 14581

Query: 707   MPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQ 766
               + P       SPP  L +  +T +TV++ W  P H G + + GYV+E   +GS     
Sbjct: 14582 ETTEPVKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGS----- 14636

Query: 767   SDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQ 826
                          + W   +   +   +  +  L    +   +V AVN+AG S P+  S+
Sbjct: 14637 -------------DQW--THITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESR 14680

Query: 827   PILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-I 885
             P++VKE    P++ +    ++  I + G+ + + IP  G+P+P +TWKK    + + Q +
Sbjct: 14681 PVIVKEQTMLPELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRV 14740

Query: 886   NIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ-IVKIEDVW 944
             N   + T TI+ I +  RS SG Y L  +         I IQ+ D PGPP   +K ++V 
Sbjct: 14741 NFETTATSTILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVS 14800

Query: 945   GENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFR 1004
              + V  +W PP++DG   I+ Y ++     S  W  +     RT+   T L  G EY FR
Sbjct: 14801 SDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFR 14860

Query: 1005  VFSENMCGLSEDAT 1018
             V ++N  G+    T
Sbjct: 14861 VKAQNRYGVGPGIT 14874



 Score =  224 bits (570), Expect = 5e-58
 Identities = 165/572 (28%), Positives = 264/572 (46%), Gaps = 51/572 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--FAPDAYNVTLPAKVHVIDP 521
             W K+ +P++++ R+          L I +A  ED G YV      A        V V+D 
Sbjct: 15809 WHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDK 15868

Query: 522   P-----KIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      + +D + AD+             I +S  PP     S  +  I+E      T 
Sbjct: 15869 PGPPTGPVKMDEVTADS-------------ITLSWGPPKYDGGSSINNYIVEKRDTSTTT 15915

Query: 577   SYPDSSTLVIDI--AERDDSGV---YHINLKNEAGEA-HASIKVKVVDF----PDPPVAP 626
                 S+T+      A R  +G    + I  +N  G++ + + +  V  +    P PP  P
Sbjct: 15916 WQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTP 15975

Query: 627   TVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              VT    D   + W  P  DGGS ++GY +ERK++ S  W++LN     +T F+   + E
Sbjct: 15976 VVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTKFKTTGLEE 16035

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGA 746
             GV YE R+ A N +GI KPS  S  +V      PP       VT  +VT++W+ P + G 
Sbjct: 16036 GVEYEFRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTRNSVTLQWKKPTYDGG 16095

Query: 747   AGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKI 806
             + + GY++E                    +LP   W+ A+   I  T F +TGL  D + 
Sbjct: 16096 SKITGYIVE------------------KKELPEGRWMKASFTNIIDTHFEVTGLVEDHRY 16137

Query: 807   FVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQG 865
               RV A NAAG  SEP   +  I  ++ ++PP+I +    K T +   GE+  +     G
Sbjct: 16138 EFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYG 16197

Query: 866   KPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 924
             KP P + W K   E+    ++ I++++  T + ++ A R  SG Y L+ K      + ++
Sbjct: 16198 KPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTV 16257

Query: 925   DIQIIDRPGPPQ-IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 983
             +++++DRPGPP+  V I  V  E   L W PP  DG + I  Y +++ +   + W  V  
Sbjct: 16258 NVKVLDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDA 16317

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             +    S  +T+L+ GNEY FR+ + N  G+ E
Sbjct: 16318 NVQTLSCKVTKLLEGNEYTFRIMAVNKYGVGE 16349



 Score =  220 bits (560), Expect = 7e-57
 Identities = 161/544 (29%), Positives = 248/544 (45%), Gaps = 66/544 (12%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            + P+I LD +     +TV AG K+ L   ++G+P PK  W++ D  I++   RI  E+ P
Sbjct: 7314 EAPEIFLD-VKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADM-ILKQDKRITIENVP 7371

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              ST+ I  ++R D+G Y I   N  G A A ++V V+D P PP A  +T+V ++ C++ 
Sbjct: 7372 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDITDVTNESCLLT 7431

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W PP  DGGS I  Y +ER+   S  W +L+    K+T F+  K+I    Y  R+ A N 
Sbjct: 7432 WNPPRDDGGSKITNYVVERRATDSEVWHKLS-STVKDTNFKATKLIPNKEYIFRVAAENM 7490

Query: 700  IGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+ +P  + P           PPT L    +T   VT+ W  PD  G + + GY +E  
Sbjct: 7491 YGVGEPVQASPITAKYQFDPPGPPTRLEPSDITKDAVTLTWCEPDDDGGSPITGYWVE-- 7548

Query: 758  FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                              D   + W+  NK  +  T + + GL    K   RV A N AG
Sbjct: 7549 ----------------RLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFRVLAENLAG 7592

Query: 818  ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-- 875
              +P   ++PIL+K+ I+PP       +K                  GK    L W K  
Sbjct: 7593 PGKPSKSTEPILIKDPIDPPWPPGKPTVKDV----------------GKTSVRLNWTKPE 7636

Query: 876  --DGAEIDKNQINIRNSETDTIIFIRKAE-----------RSHSGKYDLQVK-VDKFVET 921
               GA+I+   I +  + TD   ++R AE                +Y  +V+ V+K  E+
Sbjct: 7637 HDGGAKIESYVIEMLKTGTDE--WVRVAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGES 7694

Query: 922  ASID-------IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKK 974
               +        + +  P PP+ +++ ++      L WT P+ DG + IT Y ++K D +
Sbjct: 7695 EPSEPSDPVLCREKLYPPSPPRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVR 7754

Query: 975  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
               W TV      T  T+T L  G+ Y FRV +EN  G S+   +  E +V+A+D     
Sbjct: 7755 RKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTEI--EDSVLAKDTFTTP 7812

Query: 1035 NPVY 1038
             P Y
Sbjct: 7813 GPPY 7816



 Score =  219 bits (559), Expect = 9e-57
 Identities = 174/636 (27%), Positives = 290/636 (45%), Gaps = 67/636 (10%)

Query: 428   VDLKPLKILTPLTDQTV-NLGKEICLKCEISENIPG--KWTKNGLPVQESDRLKVVHKGR 484
             V+   +K+     D  +   G+   L+ ++S   P   +W+K+G  ++ + +L++     
Sbjct: 15084 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 15143

Query: 485   IHKLVIANALTEDEGDYV--------FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                LV  ++   D G Y         FA   +NV       V+D P       +    VT
Sbjct: 15144 STNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVK------VLDRP----GPPEGPLAVT 15193

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAER 591
              +   K  L    S  PP     ++ D  I++     R       S    + L +    +
Sbjct: 15194 EVTSEKCVL----SWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLK 15249

Query: 592   DDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYD 646
              +  ++ +   N+ G     E+   + V     PDPP  P VT +  D  ++ W  P  D
Sbjct: 15250 GNEYIFRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSD 15309

Query: 647   GGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             GGS I+ Y +ER+ K   RW++ N     +  ++   + EG  YE RI A NA GIS PS
Sbjct: 15310 GGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRIMAENAAGISAPS 15369

Query: 707   MPSRPFVPLAVT----SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGST 762
              P+ PF     T     PP    V   + +++++ W  P + G + + GY++E       
Sbjct: 15370 -PTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIA----- 15423

Query: 763   SAKQSDENGEAAYDLPAED-W-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                           LP ED W IV     +  T +TITGL  + +  +R+ A+N+ G  E
Sbjct: 15424 --------------LPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGE 15469

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD-GAE 879
             P         ++ + PP+I +   L++    R    + L +P +G+P PE+ W +D G  
Sbjct: 15470 PALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGES 15529

Query: 880   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
             +DK   +I ++ + T++ +    R  SGKY L V+     ++A ++++++D PGPPQ +K
Sbjct: 15530 LDK--ASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK 15587

Query: 940   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN 999
             +++V   +V LTW PP  DG + I  Y ++K +     + TV  + H+TS  + +L  G 
Sbjct: 15588 VKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGC 15647

Query: 1000  EYYFRVFSENMCGL---SEDATMTKESAVIARDGKI 1032
              YYFRV +EN  G+   +E A   K S      GKI
Sbjct: 15648 SYYFRVLAENEYGIGLPAETAESVKASERPLPPGKI 15683



 Score =  219 bits (557), Expect = 2e-56
 Identities = 163/601 (27%), Positives = 258/601 (42%), Gaps = 40/601 (6%)

Query: 430   LKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLKVVHKGRIHK 487
             L P KIL P    T+  GK++ ++  +    +   KW K    V  S  L V        
Sbjct: 12525 LLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI 12583

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVI-----DPPKIILDGLDADNTVTVIAGNK 542
             L+I +   +D G Y    +  + T   K+ V+      PP+   D  D D          
Sbjct: 12584 LIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADAC-----S 12638

Query: 543   LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
             L   IP+         +      +  G       S   +S  V  +    +  ++ +  +
Sbjct: 12639 LSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEY-IFRVRAE 12697

Query: 603   NEAGEAHASIKVKVV-----DFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIE 657
             N  G +      K+V       P  P    VT+V  D   + W+ P  DGGSPI+GY IE
Sbjct: 12698 NRFGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIE 12757

Query: 658   RKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAV 717
             RK++ S  W++ N  L + T +    ++EG+ Y  RI+A+N  G S PS P+        
Sbjct: 12758 RKERNSLLWVKANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVTARMP 12817

Query: 718   TSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDL 777
               PP    V  VT +TV++ W  P H G + + GY +E C                   L
Sbjct: 12818 VDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEAC------------------KL 12859

Query: 778   PAEDWIVAN--KDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 835
             P + W+  N     I + ++T TGL   A+   R  A  A   S P   S P+ +     
Sbjct: 12860 PGDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV 12919

Query: 836   PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ-INIRNSETDT 894
             PP+I +   +K     + G  V L     GKP P ++WKKDG  +   + I +       
Sbjct: 12920 PPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLC 12979

Query: 895   IIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTP 954
              + +    R  SG Y +  +     ++A+I ++++D+PGPP  VKI  ++ +   L+W P
Sbjct: 12980 TLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEP 13039

Query: 955   PKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLS 1014
             P +DG + IT Y + K +     W  V      TS ++ +L+ G+EY FR+ +EN  G+ 
Sbjct: 13040 PLEDGGSEITNYIVDKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVG 13099

Query: 1015  E 1015
             +
Sbjct: 13100 D 13100



 Score =  219 bits (557), Expect = 2e-56
 Identities = 151/565 (26%), Positives = 257/565 (45%), Gaps = 42/565 (7%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDP 521
             W K+GLP++ES+ ++         L I NA  E  G Y    D     + +P  V  + P
Sbjct: 21225 WLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIAVPITVITLGP 21284

Query: 522   PK-----IILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTE 576
             P      I  D + AD+ +       L  ++P          +S   +   + + ++   
Sbjct: 21285 PSKPKGPIRFDEIKADSVI-------LSWDVPEDNGGGEITCYSIEKRETSQTNWKMVCS 21337

Query: 577   SYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD-----FPDPPVAPTVTEV 631
             S   ++  V ++  +D    + +  +N  G +   +   +V       P PP  P +  V
Sbjct: 21338 SVARTTFKVPNLV-KDAEYQFRVRAENRYGVSQPLVSSIIVAKHQFRIPGPPGKPVIYNV 21396

Query: 632   GDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYE 691
               D   + W+ P YDGGS + G+ +E+K++ S  W ++N        +    ++EG+ Y+
Sbjct: 21397 TSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLVEGLDYQ 21456

Query: 692   VRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDG 751
              R++A N+ G+S PS PS+  + ++   PP       VT  T+T++W PP   G + + G
Sbjct: 21457 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 21516

Query: 752   YVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVK 811
             Y +E         +Q +E            W+  N   + + ++T+TGL    +   R+ 
Sbjct: 21517 YSIE--------KRQGNER-----------WVRCNFTDVSECQYTVTGLSPGDRYEFRII 21557

Query: 812   AVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPE 870
             A NA G  S P   S  I+ ++   PP +          I + GE++ +    QG+P P 
Sbjct: 21558 ARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPR 21617

Query: 871   LTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
             +TW KDG EI+K   + I +    T +F+R A R H G Y ++ K       A I +++ 
Sbjct: 21618 VTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21677

Query: 930   DRPGP-PQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT 988
             D PG     ++  ++ GE + L W  P +DG A IT Y I+K +   + W  + +     
Sbjct: 21678 DTPGKVVGPIRFTNITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQ 21737

Query: 989   SATITELVIGNEYYFRVFSENMCGL 1013
             S T  +L+ GNEY FRV + N  G+
Sbjct: 21738 SYTAIKLINGNEYQFRVSAVNKFGV 21762



 Score =  216 bits (551), Expect = 8e-56
 Identities = 161/592 (27%), Positives = 267/592 (45%), Gaps = 52/592 (8%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHV 518
             +W K    +  + RL++        L + +A+  D G+Y+    A NV    ++   V V
Sbjct: 16204 QWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK--AKNVAGERSVTVNVKV 16261

Query: 519   IDPP-----KIILDGLDADNTVTVIA-----GNKLRLEIPISGEPPPKAMWSRGDKAIME 568
             +D P      +++ G+ A+            G    +   +      + +W+  D  +  
Sbjct: 16262 LDRPGPPEGPVVISGVTAEKCTLAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQT 16321

Query: 569   GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              S ++      +  T  I    +   G        E  E+   +       PD P AP V
Sbjct: 16322 LSCKVTKLLEGNEYTFRIMAVNKYGVG--------EPLESEPVVAKNPFVVPDAPKAPEV 16373

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGV 688
             T V  D  I+ WE PA DGGS ILGY +E++ K+  RW R +  L  E       +IE  
Sbjct: 16374 TTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELRLRVTGLIENH 16433

Query: 689   AYEVRIFAVNAIGISKPSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIG 745
              YE R+ A NA G+S+PS PS   +   P+    PP    V  +T ++V + W  P + G
Sbjct: 16434 DYEFRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSKPIYDG 16493

Query: 746   AAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDL-IDKTKFTITGLPTDA 804
                + GY++E C                  D+   +W +      I+KT   +  L    
Sbjct: 16494 GCEIQGYIVEKC------------------DVSVGEWTMCTPPTGINKTNIEVEKLLEKH 16535

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   R+ A+N AG  E      PI+V+E +E P I +   L++    R G ++ L +P +
Sbjct: 16536 EYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIK 16595

Query: 865   GKPRPELTW-KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS 923
             G+P PE+ W K DG   D   I++ +S T  +  +    R  SGKY L ++     ++A 
Sbjct: 16596 GRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLV--LDNVNRYDSGKYTLTLENSSGTKSAF 16653

Query: 924   IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE 983
             + ++++D P PP  +K+ ++  ++V++TW PP  DG + I  Y ++K +     +  V+ 
Sbjct: 16654 VTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVT 16713

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGL---SEDATMTKESAVIARDGKI 1032
             + H+ S  I +L  G  YYFRV +EN  G+   ++ A   K + V    GKI
Sbjct: 16714 NCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPPGKI 16765



 Score =  216 bits (550), Expect = 1e-55
 Identities = 154/518 (29%), Positives = 249/518 (48%), Gaps = 36/518 (6%)

Query: 505   PDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             P   N  + AK  +++ P+I LD +    +V   AG  +++ IP  G PPP   W R D+
Sbjct: 20881 PIEMNEPVQAK-DILEAPEIDLD-VALRTSVIAKAGEDVQVLIPFKGRPPPTVTW-RKDE 20937

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS-IKVKVVDFPDPP 623
               +    R   E+   SS L I    R+D+G Y + ++N  GE  +S + VKV+D P   
Sbjct: 20938 KNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAAC 20997

Query: 624   VAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
                 V  V      + W+PP  DGGSPI+ Y IE++      W  ++   C  T+F+   
Sbjct: 20998 QKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTWSVVSHK-CSSTSFKLID 21056

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             + E   +  R+ A N IGI +P   + P     V +P   L++   T T+V + W  PD 
Sbjct: 21057 LSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDF 21116

Query: 744   IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKT-KFTITGLPT 802
              G + +  YV+E   +G                   + W  A    I KT +  ++ L  
Sbjct: 21117 DGGSVITEYVVERKGKGE------------------QTWSHAG---ISKTCEIEVSQLKE 21155

Query: 803   DAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP 862
              + +  RV A N  G S+P     PI VKE+I  P++ +          R+G  V+L +P
Sbjct: 21156 QSVLEFRVFAKNEKGLSDPVTIG-PITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELP 21214

Query: 863   FQGKPRPELTWKKDGAEIDKNQ-INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
             ++GKP+P ++W KDG  + +++ +    +E    + I+ A++ H GKY   V +D  V  
Sbjct: 21215 YKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYT--VILDNAVCR 21272

Query: 922   ASIDIQIIDRPGPPQI----VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSME 977
              ++ I +I   GPP      ++ +++  ++V L+W  P+D+G   IT Y+I+K +     
Sbjct: 21273 IAVPITVITL-GPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIEKRETSQTN 21331

Query: 978   WFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
             W  V     RT+  +  LV   EY FRV +EN  G+S+
Sbjct: 21332 WKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQ 21369



 Score =  214 bits (546), Expect = 3e-55
 Identities = 142/494 (28%), Positives = 224/494 (45%), Gaps = 36/494 (7%)

Query: 573   IRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPT 627
             +   S P   T  I         V+ I  +N+ G     ++       +   P  P  PT
Sbjct: 9893  VHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFSVPGAPDKPT 9952

Query: 628   VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT----FEPKK 683
             V+ V  +   +NWE P YDGGSP+ GY++E K   S RW R+N D  K  T    ++   
Sbjct: 9953  VSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTG 10012

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRP 740
             +IEG  Y+ R++A+NA G+   S+PS P     P+A   PP    V   T ++  + W P
Sbjct: 10013 LIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPPGPP-FPKVTDWTKSSADLEWSP 10071

Query: 741   PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
             P   G + + GY++EY  EG                   E+W       +  TK  +TGL
Sbjct: 10072 PLKDGGSKVTGYIVEYKEEGK------------------EEWEKGKDKEVRGTKLVVTGL 10113

Query: 801   PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
                A    RV+AVN AG  EP   +  I +K+ +  P +++   ++   +   G  + ++
Sbjct: 10114 KEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRII 10173

Query: 861   IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
                 GKP P +TW  +   + + +  I  +   + + I+  +RSH G Y L  K +    
Sbjct: 10174 AYVSGKPPPTVTWNMNERTLPQ-EATIETTAISSSMVIKNCQRSHQGVYSLLAKNEAGER 10232

Query: 921   TASIDIQIIDRPGPPQIVKI-EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
               +I + ++D PGP     +  ++  E+  LTW  P+DDG + IT Y I+K +     W 
Sbjct: 10233 KKTIIVDVLDVPGPVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNYVIEKRESDRRAWT 10292

Query: 980   TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1039
              V     R +AT+  L+ G  Y+FR+ +EN  G+      T E+ VI     + + P  E
Sbjct: 10293 PVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMG-PFVETSEALVIREPITVPERP--E 10349

Query: 1040  DFDFSEAPMFTQPL 1053
             D +  E    T  L
Sbjct: 10350 DLEVKEVTKNTVTL 10363



 Score =  211 bits (537), Expect = 3e-54
 Identities = 160/553 (28%), Positives = 257/553 (46%), Gaps = 70/553 (12%)

Query: 502  VFAPDAYNVTLPAKV--HVI--DP---PKIILDGLDADNTVTVIAGNKLRLEIPISGEPP 554
            V A +A  V+ P+++  +V+  DP   P I L+  D    + VI G KL + +P    P 
Sbjct: 7988 VRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD----IIVIEGEKLSIPVPFRAVPV 8043

Query: 555  PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
            P   W +  K + + S R+  ++   S+ L +  + R D+G+Y I L+N+ G A ASI V
Sbjct: 8044 PTVSWHKDGKEV-KASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINV 8102

Query: 615  KVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC 674
            KV+  P P      +++    C + WEPP +DGG+PIL Y +ER++     ++ +     
Sbjct: 8103 KVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGEN 8162

Query: 675  KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTD 731
            K  ++  K +I    Y  R+ AVN +G  +      P +   P     PP  + V + T 
Sbjct: 8163 K-LSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTA 8221

Query: 732  TTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLID 791
              +T+ W+PP + G + + GY++E   +G                   E W   N+ L+ 
Sbjct: 8222 EAMTITWKPPLYDGGSKIMGYIIEKIAKGE------------------ERWKRCNEHLVP 8263

Query: 792  KTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR 851
               +T  GL    +   RV+A NAAG SEP   + P    + I+ PK+ +   L+   ++
Sbjct: 8264 ILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLE---VK 8320

Query: 852  RVGEAVNLVIPFQGKPRPELTWKKD-----GAEIDK------------------------ 882
            R G+ + L     G P P +TW KD       EI K                        
Sbjct: 8321 R-GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLT 8379

Query: 883  NQINIRNSET-DTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
             +++I NS+  ++ + +R + R   G Y ++V+ D  +  A   + ++D PGPP     E
Sbjct: 8380 QRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSVLDTPGPPINFVFE 8439

Query: 942  DVWGENVALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHRTSATITELVIGN 999
            D+   +V   W PP DDG + I  YT++K D  K   EW  V         ++T+L+ G 
Sbjct: 8440 DIRKTSVLCKWEPPLDDGGSEIINYTLEKKDKTKPDSEWIVVTSTLRHCKYSVTKLIEGK 8499

Query: 1000 EYYFRVFSENMCG 1012
            EY FRV +EN  G
Sbjct: 8500 EYLFRVRAENRFG 8512



 Score =  210 bits (535), Expect = 5e-54
 Identities = 177/671 (26%), Positives = 293/671 (43%), Gaps = 79/671 (11%)

Query: 380   EIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPL 439
             +++ G K  +RIR +         GA  A +     +    +  A       P  +L P 
Sbjct: 13965 DLVEGGKYEFRIRAKNTA------GAISAPSESTETIICKDEYEA-------PTIVLDPT 14011

Query: 440   TDQ--TVNLGKEICLKCE--ISENIP-GKWTKNGLPVQESDRLKVVHKGRIHKLVIANAL 494
                  T+  G  I L     + + +P   W+K G  ++ SD  ++        L I  A 
Sbjct: 14012 IKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYAT 14071

Query: 495   TEDEGDY-VFAPDAYNVTLP-AKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
              +D G+Y + A + +   +   KV V+D P     G      ++ ++  K  L    +  
Sbjct: 14072 RKDAGEYTITATNPFGTKVEHVKVTVLDVP-----GPPGPVEISNVSAEKATL----TWT 14122

Query: 553   PPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK----NE---- 604
             PP +   S     I+E           ++S L+  +   D     H+  K    NE    
Sbjct: 14123 PPLEDGGSPIKSYILEKR---------ETSRLLWTVVSEDIQSCRHVATKLIQGNEYIFR 14173

Query: 605   --------AGEAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILG 653
                      GE   S  VK+VD    P PP  P V+ V  +   ++W+ P  DGGS I G
Sbjct: 14174 VSAVNHYGKGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITG 14233

Query: 654   YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV 713
             Y +ER++K+S RW+R       +   +   + EG  YE R+ A N  GI  PS  S   +
Sbjct: 14234 YHVERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVL 14293

Query: 714   PLAVTSPPTLLTVDSVTDTT---VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDEN 770
                   PP   +   VTDTT    ++ W  P + G   + GYV+E+   G   A   D  
Sbjct: 14294 MKDAAYPPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGD-EAWIKDTT 14352

Query: 771   GEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILV 830
             G A                +  T+F +  L T  K   R+ A+N AG  EP       +V
Sbjct: 14353 GTA----------------LRITQFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIV 14396

Query: 831   KEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNS 890
             +  + P    +   L++T + R G ++ + +P +G+P PE+TW KD   + KN+ NI N+
Sbjct: 14397 EREMAPD-FELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIENT 14454

Query: 891   ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVAL 950
             E+ T++ I +  R  +GK+ + ++     ++  ++++++D PGP   ++  D+  ++V L
Sbjct: 14455 ESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVLNLRPTDITKDSVTL 14514

Query: 951   TWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENM 1010
              W  P  DG + IT Y ++K +     + T     H+ +  +T L  G EY+FRV +EN 
Sbjct: 14515 HWDLPLIDGGSRITNYIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENE 14574

Query: 1011  CGLSEDATMTK 1021
              G+ E    T+
Sbjct: 14575 YGIGEPTETTE 14585



 Score =  207 bits (527), Expect = 5e-53
 Identities = 119/408 (29%), Positives = 212/408 (51%), Gaps = 24/408 (5%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P PP  P VT++  +   + W  P  DGGS I GYF+E++ K+S  W ++  +  ++T  
Sbjct: 20694 PGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQ 20753

Query: 680   EPKKMIEGVAYEVRIFAVNAIG---ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             +   + E   Y+ R+ AVNA G    S+PS   +   P+    PP  + +   T +++T+
Sbjct: 20754 KVTGLTENSDYQYRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTKSSITL 20813

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWI-VANKDLIDKTKF 795
              W  P + G + + GYV+E         +Q +E          E+W  V+ K  +  T++
Sbjct: 20814 GWSKPVYDGGSAVTGYVVEI--------RQGEE----------EEWTTVSTKGEVRTTEY 20855

Query: 796   TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 855
              ++ L      + RV AVN AG  EP   ++P+  K+I+E P+I +   L+ + I + GE
Sbjct: 20856 VVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVALRTSVIAKAGE 20915

Query: 856   AVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYDLQVK 914
              V ++IPF+G+P P +TW+KD   +  + + +I N+++ +++ I +  R+ +GKY L ++
Sbjct: 20916 DVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIE 20975

Query: 915   VD-KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                   +++++ ++++D P   Q ++++ V    V L W PP  DG + I  Y I+K D 
Sbjct: 20976 NGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDA 21035

Query: 974   KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
                 W  V      TS  + +L     ++FRV +EN  G+ E    T+
Sbjct: 21036 TKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTE 21083



 Score =  206 bits (525), Expect = 8e-53
 Identities = 160/599 (26%), Positives = 279/599 (46%), Gaps = 50/599 (8%)

Query: 444   VNLGKEICLKCEI-SENIPGK-WTKNGLPVQESD-RLKVVHKGRIHKLVIANALTEDEGD 500
             V+ G+   L+ +I  + IP   W+K+G  ++E+  R+++    +   LV+ + +  D G 
Sbjct: 18347 VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQ 18406

Query: 501   YVFAPDAYNVT--LPAKVHVIDPP-----KIILDGLDAD------NTVTVIAGNKLRLEI 547
             Y+        T  +P  V V+D P      + + G+ A+      N      G  +   I
Sbjct: 18407 YILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYI 18466

Query: 548   PISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE 607
              I      +  W++    +   + ++ T+  P +  +   +A       Y I    E+G 
Sbjct: 18467 -IEKRETSRLSWTQVSTEVQALNYKV-TKLLPGNEYIFRVMAVNK----YGIGEPLESGP 18520

Query: 608   AHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
               A    K    P PP  P V+ +  D  ++ W  P  DGG+ I GY +E++ K+  RW 
Sbjct: 18521 VTACNPYKP---PGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWT 18577

Query: 668   RLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVD 727
             + N     +       + EG +YE R+ A NA G+ +PS PS  +       PP   +  
Sbjct: 18578 KCNKKTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPSVFYRACDALYPPGPPSNP 18637

Query: 728   SVTDT---TVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIV 784
              VTDT   +V++ W  P + G A + GYV+E                EAA    A++W  
Sbjct: 18638 KVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEV--------------KEAA----ADEWTT 18679

Query: 785   ANKDL-IDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPR 843
                   +   +FT+T L  + +   R+ A+N+ G  EP      ++ +E IEPP+I +  
Sbjct: 18680 CTPPTGLQGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDA 18739

Query: 844   HLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK-DGAEIDKNQINIRNSETDTIIFIRKAE 902
              L++  + R    + L +  +G+P PE+ W+K +G   D+ QI + +S   T++ I    
Sbjct: 18740 DLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSS--FTMLVIDNVT 18797

Query: 903   RSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAA 962
             R  SG+Y+L ++ +   +TA ++++++D P  P  + I +V  ++V L+W PP  DG A 
Sbjct: 18798 RFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAK 18857

Query: 963   ITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
             IT Y ++K +     + T+  +  +T+  I  L  G  YYFRV + N  G+   A  T+
Sbjct: 18858 ITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTE 18916



 Score =  206 bits (524), Expect = 1e-52
 Identities = 159/616 (25%), Positives = 268/616 (43%), Gaps = 73/616 (11%)

Query: 434   KILTPLTDQTVNLGKEICLKCEISENIPG----------KWTKNGLPVQESDRLKVVHKG 483
             K++ P  +  V L + + +K   +   P           KWT +G  ++  +   V    
Sbjct: 11132 KLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDN 11191

Query: 484   RIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVID---PPKIILDGLDADNTVTVI 538
                 L I N L  D G+Y       A + T+   + V+D   PP   ++ LD        
Sbjct: 11192 FSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPE---- 11247

Query: 539   AGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIAERDD 593
                     + IS +PP     S     I+E     +       S    + L I   ++  
Sbjct: 11248 -------HMTISWQPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGC 11300

Query: 594   SGVYHINLKNEAG-----EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
               V+ +  +N+ G     ++  ++       P PP  P VT++ ++   ++W  P  DGG
Sbjct: 11301 EYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGG 11360

Query: 649   SPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             SPI GY++ER++  + +W+R+N     +  F    + EG  YE R+FA N  G+SKPS  
Sbjct: 11361 SPITGYYMERREV-TGKWVRVNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPS 11419

Query: 709   SRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
             S P     P+    PP    +   +  T  + W  P   G + + GYV+E C +  T+  
Sbjct: 11420 SDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVE-CQKPGTA-- 11476

Query: 766   QSDENGEAAYDLPAEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYY 824
                             W   NKD LI +  F + GL    +   R+KA N  G  EP+  
Sbjct: 11477 ---------------QWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPREL 11521

Query: 825   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQ 884
             ++ ++ K+I+ PP++ +    +     RVG+ + ++   +G+P P++TW K+G      +
Sbjct: 11522 AESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEG------K 11575

Query: 885   INIRNSETDTI-------IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQI 937
             + +R    D I       + I++A R+  GKY +  K        S  + ++DRPGP Q 
Sbjct: 11576 VLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQN 11635

Query: 938   VKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVI 997
             +K+ +V  EN  ++W  P D+G + IT + ++        W  V     +       L+ 
Sbjct: 11636 LKVTNVTKENCTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLIK-ANLLA 11694

Query: 998   GNEYYFRVFSENMCGL 1013
              NEYYFRV +EN  G+
Sbjct: 11695 NNEYYFRVCAENKVGV 11710



 Score =  204 bits (520), Expect = 3e-52
 Identities = 127/423 (30%), Positives = 206/423 (48%), Gaps = 36/423 (8%)

Query: 611  SIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWM 667
            S KV + D    P PP  P V        +++W PP  +GGSPI GY++E++++ S  W 
Sbjct: 9215 SDKVVIQDPYRLPGPPGKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWS 9274

Query: 668  RLNFDLC-----KETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
            R++         K   F   +++EGV Y+ R  A+NA GI  PS PS P V   P+    
Sbjct: 9275 RVSRAPITKVGLKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPG 9334

Query: 720  PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
            PP+   V   T +++++ W+PP   G + + GY++E   EG+T  K+ +E  +       
Sbjct: 9335 PPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDK------- 9387

Query: 780  EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKI 839
                     LI   +  +  L    K   RVKAVN AG SEP   +  I   +I E P++
Sbjct: 9388 ---------LITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEV 9438

Query: 840  RIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWK---------KDGAEIDKNQINIRNS 890
             I    +   + + G  + +    +G+P P+ +W+         KDG         +  +
Sbjct: 9439 FIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETA 9498

Query: 891  ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVAL 950
            E  ++I I + +RSH+GKY +  K     +TA+  ++++D PGPP+ +K+ D+   +  L
Sbjct: 9499 ENSSVIIIPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCRL 9558

Query: 951  TWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENM 1010
            +W  P DDG   I GY I+K       W  V      T+  + +L+   +Y+FRV +EN 
Sbjct: 9559 SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENR 9618

Query: 1011 CGL 1013
             G+
Sbjct: 9619 FGI 9621



 Score =  204 bits (518), Expect = 5e-52
 Identities = 146/522 (27%), Positives = 236/522 (45%), Gaps = 39/522 (7%)

Query: 520  DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
            +PP + LD +     + ++AG  LR+   ++G P P  +W++ +  +     R+  ++  
Sbjct: 8728 EPPAVELD-VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL--DKDRVVIDNVG 8784

Query: 580  DSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMN 639
              S L+I  A R D G Y I   N  G   A+ +V+V D P P +           C++N
Sbjct: 8785 TKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLN 8844

Query: 640  WEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNA 699
            W  P  DGGS I G+ IERK  +   W R   +  + +  +   ++EG  Y+ R+ A N 
Sbjct: 8845 WSDPEDDGGSEITGFIIERKDAKMHTW-RQPIE-TERSKCDITGLLEGQEYKFRVIAKNK 8902

Query: 700  IGISKPSM--PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P    P     PL   + P  LT    T +T+T+ W+ P   G + + GY++E  
Sbjct: 8903 FGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIE-- 8960

Query: 758  FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                          +  +D P  D+   NK L   T F +  L        RVKAVN  G
Sbjct: 8961 --------------KRRHDKP--DFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIG 9004

Query: 818  ASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAVNLVIPFQGKPRPELTWKKD 876
             SEP      +++++   PP I++   ++   I+ + GE V++     G P P++ W K+
Sbjct: 9005 ESEPS-LPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKN 9063

Query: 877  GAEIDK-------NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
               I+K        +  +  SE  T + I KA R   G Y +           ++ +++ 
Sbjct: 9064 ETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVY 9123

Query: 930  DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD--KKSMEWFTVIEHYHR 987
            DRP PP+ + + D+  E+  LTW  P D+G + IT Y I K D  +K  EW  V      
Sbjct: 9124 DRPSPPRNLAVTDIKAESCYLTWDAPLDNGGSEITHYVIDKRDASRKKAEWEEVTNTAVE 9183

Query: 988  TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
                I +L+   +Y FRV + N  G+S++    K   V+ +D
Sbjct: 9184 KRYGIWKLIPNGQYEFRVRAVNKYGISDEC---KSDKVVIQD 9222



 Score =  203 bits (516), Expect = 9e-52
 Identities = 164/613 (26%), Positives = 270/613 (44%), Gaps = 62/613 (10%)

Query: 443   TVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T+  G ++ L   +      K  WTK    +   +++ + + G+    VI      D G 
Sbjct: 22686 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGK 22745

Query: 501   YVFAPDAYNVT--LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP---- 554
             Y       + T  +   V V+D P     G     TV+ +   K  L   +  E      
Sbjct: 22746 YTLTVKNASGTKAVSVMVKVLDSP-----GPCGKLTVSRVTQEKCTLAWSLPQEDGGAEI 22800

Query: 555   -----PKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                   +   SR +  I+EG     T SY      V+    +++  ++ +   N+ G   
Sbjct: 22801 THYIVERRETSRLNWVIVEGE--CPTLSY------VVTRLIKNNEYIFRVRAVNKYGPGV 22852

Query: 607   --EAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSS 664
               E+   +       P PP  P     G +  I+ W  P  DGG+ I  Y +++++K+S 
Sbjct: 22853 PVESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSL 22912

Query: 665   RWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV----PLAVTS 719
             RW R+N D +  +T  +   ++EG  Y+ R+ AVNA G S+PS  S  F+    P     
Sbjct: 22913 RWTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASN-FISCREPSYTPG 22971

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
             PP+   V   T  ++++ W  P + G   + GYVLE         K +D+          
Sbjct: 22972 PPSAPRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEM------QEKDTDQ---------- 23015

Query: 780   EDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
               W  V     I  T+FT+  L    K   RV AVN  G SE       I   E IE P 
Sbjct: 23016 --WYRVHTNATIRNTEFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPD 23073

Query: 839   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFI 898
             + +   LK+T   R G ++ L++   G+P P +TW K G ++    I I  +E+ +++ +
Sbjct: 23074 LELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI-IDTTESYSLLIV 23132

Query: 899   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDD 958
              K  R  +GKY ++ +     ++A++ +++ D PGP   VK+++V  ++V +TW  P  D
Sbjct: 23133 DKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTID 23192

Query: 959   GNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE--- 1015
             G A +  Y ++K +     + TV     +T   I+ LV G  YYFRV  EN+ G+ E   
Sbjct: 23193 GGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCE 23252

Query: 1016  --DATMTKESAVI 1026
               DA +  E  ++
Sbjct: 23253 TSDAVLVSEVPLV 23265



 Score =  201 bits (512), Expect = 3e-51
 Identities = 157/613 (25%), Positives = 280/613 (45%), Gaps = 46/613 (7%)

Query: 420   GQSSAKLSVDLKPLKILTPLTDQ-TVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDR 476
             G  +AK  V+L  + +     D   VN G+   L+ ++  + +P  +W +    ++ES R
Sbjct: 17240 GPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESAR 17299

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPD--AYNVTLPAKVHVIDPPKIILDGLDADNT 534
              ++ +      L++ +A+  D G Y+      A + + P  V V+D P       +    
Sbjct: 17300 CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP----GPPEGPVQ 17355

Query: 535   VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR-----TESYPDSSTLVIDIA 589
             VT +   K  L    +  PP +   S     ++E     R       S   +++L +   
Sbjct: 17356 VTGVTSEKCSL----TWSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKL 17411

Query: 590   ERDDSGVYHINLKNE--AGEAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPA 644
                +  V+ I   N+   GE   S  V + +    P PP +  VT +  D   + W  P 
Sbjct: 17412 LEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAKDSMTVCWNRPD 17471

Query: 645   YDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
              DGGS I+GY +E++ +   RW++ N     +       + E   YE R+ A NA G+ +
Sbjct: 17472 SDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGE 17531

Query: 705   PSMPS---RPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             PS  +   +   P+    PPT   +   T  ++T+ W  P + G + + GYV+E C    
Sbjct: 17532 PSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAWGKPIYDGGSEILGYVVEIC---- 17587

Query: 762   TSAKQSDENGEAAYDLPAEDW-IVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                 ++DE          E+W IV  +  +  T+F I+ L    +  +RV A+N  G  E
Sbjct: 17588 ----KADE----------EEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNKVGLGE 17633

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEI 880
                    +  ++ +E P++ +   L++  + R G +  + IPF+G+P PE+TW ++  E 
Sbjct: 17634 ATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEF 17693

Query: 881   DKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKI 940
               +++ I      T + I   +R+ +GKY L+++     ++A + ++++D PGPPQ + +
Sbjct: 17694 T-DKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAV 17752

Query: 941   EDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNE 1000
             ++V  ++  L W PP  DG A +  Y I K +     +  V     +TS  +  L  G  
Sbjct: 17753 KEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAI 17812

Query: 1001  YYFRVFSENMCGL 1013
             YYFRV +EN  G+
Sbjct: 17813 YYFRVMAENEFGV 17825



 Score =  201 bits (510), Expect = 4e-51
 Identities = 139/497 (27%), Positives = 230/497 (46%), Gaps = 32/497 (6%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
             P  P  P V  V  +   + WE P +DGGS I+GY++E+K++ +  W++ N   C E  +
Sbjct: 22469 PSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNY 22528

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
             +   ++EG+ Y+ R +A+NA G+SK S  SRP +       P    V  VT +TV++ W 
Sbjct: 22529 KVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWS 22588

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P + G + + GY++E         K   E G+         W+  N  ++    FT+T 
Sbjct: 22589 APAYDGGSKVVGYIIE--------RKPVSEVGDGR-------WLKCNYTIVSDNFFTVTA 22633

Query: 800   LPTDAKIFVRVKAVNAAGA-SEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIR-RVGEAV 857
             L        RV A NAAG  S+    + P+  ++   PPK  +   L    +  R G  +
Sbjct: 22634 LSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDL 22693

Query: 858   NLVIPFQGKPRPELTWKKDGAEIDK-NQINIRNSETDTIIFIRKAERSHSGKYDLQVKVD 916
              L     GKP P++ W K   E+D   +++++ +       I+  +RS SGKY L VK  
Sbjct: 22694 VLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNA 22753

Query: 917   KFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                +  S+ ++++D PGP   + +  V  E   L W+ P++DG A IT Y +++ +   +
Sbjct: 22754 SGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRL 22813

Query: 977   EWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
              W  V       S  +T L+  NEY FRV + N  G        +   ++AR+     +P
Sbjct: 22814 NWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYG---PGVPVESEPIVARNSFTIPSP 22870

Query: 1037  --VYEDFDFSEAPM---FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDD 1090
               + E+    +  +   +T+P  +     G N   N  V    K  + W + NK  +V D
Sbjct: 22871 PGIPEEVGTGKEHIIIQWTKPESD-----GGNEISNYLVDKREKKSLRWTRVNKDYVVYD 22925

Query: 1091  PRYRMFSNQGVCTLEIR 1107
              R ++ S    C  + R
Sbjct: 22926 TRLKVTSLMEGCDYQFR 22942



 Score =  196 bits (497), Expect = 1e-49
 Identities = 219/924 (23%), Positives = 366/924 (39%), Gaps = 131/924 (14%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +   V F  E+     + KW++N + I  S+KYI   K     L I +  + D + Y
Sbjct: 6278 RVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANY 6337

Query: 323  YVTAGDE-----KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKN 377
             V+  +      K +  L V E  + + + L+D      + V   C+V+  +  +KW KN
Sbjct: 6338 NVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKN 6397

Query: 378  GEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILT 437
            GEE+    +  YR  V+  KH+L I+     D  EY V     +S A+L +   P + + 
Sbjct: 6398 GEEVPFDNRVSYR--VDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVE 6455

Query: 438  PLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTE 496
             L DQTV    +    C++S E    KW +NG  ++E  + K    G IH+L+I +   +
Sbjct: 6456 HLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLD 6515

Query: 497  DEGDYVFAPD-----AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISG 551
            DE +Y    +     A        V +I PP+ IL+   AD  V +   NK ++E+    
Sbjct: 6516 DECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGAD-VVFLAELNKDKVEV---- 6570

Query: 552  EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHAS 611
                   W R +  +++G               + DI  RD  G Y    K++  EA A 
Sbjct: 6571 ------QWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQ-GEYRFIAKDK--EARAK 6621

Query: 612  IKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYF-IERKKKQSSRWMRLN 670
            +++          AP +     D  +        D G P+      +   K  + W + N
Sbjct: 6622 LELAA--------APKIKTADQDLVV--------DVGKPLTMVVPYDAYPKAEAEWFKEN 6665

Query: 671  FDL--------CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPT 722
              L         ++T+F   +  +G     +I   N  G ++  +  +    + V  P  
Sbjct: 6666 EPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFINLKV---IDVPGPVR 6722

Query: 723  LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDW 782
             L V    D  V++ W  P   G + + GYV+E                    D+  + W
Sbjct: 6723 NLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVE------------------RRDIKRKTW 6764

Query: 783  IVANKDLIDKTKFTITGLPTDAKIFV-RVKAVNAAGASEPKYYSQPILVKEIIEPPKIRI 841
            ++A  D  +  +FT+TGL      ++ RV A N  G  EP     P+  +   + P    
Sbjct: 6765 VLAT-DRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKYDVP---- 6819

Query: 842  PRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKD----GAEIDKNQINIRNSET---DT 894
                        G  +N+ I    +    LTW+      GAEI    I +R+  +   DT
Sbjct: 6820 ------------GPPLNVTITDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDT 6867

Query: 895  IIFIRKAERS-------HSGKYDLQVKVDKFV-----ETASIDIQI---IDRPGPPQIVK 939
             + +R  + S          +Y  +V+    +       A+  +++   I+RP PP  + 
Sbjct: 6868 AMTVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLT 6927

Query: 940  IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIG 998
              D    +V L W PP  DG + I GY I++ ++    W    ++     +  +T L  G
Sbjct: 6928 SSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKG 6987

Query: 999  NEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYA 1058
            N+Y +RV +EN  G+S+ + +                P+  D  F E  M      +   
Sbjct: 6988 NKYLYRVSAENKAGVSDPSEIL--------------GPLTADDAFVEPTMDLSAFKDGLE 7033

Query: 1059 IAGYNA-TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
            +   N  T+     G P+P  TW      +    R +M +      L I      D G Y
Sbjct: 7034 VIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIY 7093

Query: 1118 CCKAVNDLGTVEIECKLEVKVIAQ 1141
              K  N + T+  E  ++V VIA+
Sbjct: 7094 TLKLENRVKTISGE--IDVNVIAR 7115



 Score =  195 bits (496), Expect = 2e-49
 Identities = 141/519 (27%), Positives = 228/519 (43%), Gaps = 38/519 (7%)

Query: 518   VIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTES 577
             ++ PP++ LD +   + +TV  G  +R+   + G P P   W++  K ++      R + 
Sbjct: 11530 ILHPPEVELD-VTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK---RVDL 11585

Query: 578   YPDSSTLVIDIAE--RDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDW 635
               D   + + I E  R D G Y I+ KN +G A  S  V V+D P P     VT V  + 
Sbjct: 11586 IQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKEN 11645

Query: 636   CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIF 695
             C ++WE P  +GGS I  + +E +K     W  +  D+ K        ++    Y  R+ 
Sbjct: 11646 CTISWENPLDNGGSEITNFIVEYRKPNQKGWSIVASDVTKRLI--KANLLANNEYYFRVC 11703

Query: 696   AVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             A N +G+        P +   P+     P  L +     T V ++WR PD+ G +    Y
Sbjct: 11704 AENKVGVGPTIETKTPILAINPIDRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSY 11763

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
              +E   +GS                  +DW   +K  I +T + +     +     RV+ 
Sbjct: 11764 HVERRLKGS------------------DDWERVHKGSIKETHYMVDRCVENQIYEFRVQT 11805

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
              N  G S+    ++ ++VKE ++ P + +   L      + G+ + L    +GKP PE+ 
Sbjct: 11806 KNEGGESD-WVKTEEVVVKEDLQKPVLDLK--LSGVLTVKAGDTIRLEAGVRGKPFPEVA 11862

Query: 873   WKKDGAEIDKNQ---INIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
             W KD    D  +   + I      +   + KA+RS  GKY +          A   + ++
Sbjct: 11863 WTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVL 11922

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             D+PGP + +KI DV  +   + W PP+DDG   I  Y ++K + K M W T         
Sbjct: 11923 DKPGPVRNLKIVDVSSDRCTVCWDPPEDDGGCEIQNYILEKCETKRMVWSTYSATVLTPG 11982

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIAR 1028
              T+T L+ GNEY FRV +EN  G       T+   VIA+
Sbjct: 11983 TTVTRLIEGNEYIFRVRAENKIGTGPP---TESKPVIAK 12018



 Score =  195 bits (495), Expect = 2e-49
 Identities = 123/422 (29%), Positives = 206/422 (48%), Gaps = 28/422 (6%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP A  V +V      + WEPP  DGG PI  Y IE+K++  +RW++       +  F
Sbjct: 7812 PGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNF 7871

Query: 680  EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTM 736
                +IEG   + ++ A N  G+  PS P+       P +  SPP  L V       + +
Sbjct: 7872 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 7931

Query: 737  RWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFT 796
             W+PP+  G + + GY +E C  G+                  E W+  N   I   KF 
Sbjct: 7932 AWKPPEKNGGSPIIGYHVEMCPVGT------------------EKWMRVNSRPIKDLKFK 7973

Query: 797  IT-GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGE 855
            +  G+  D +  +RV+AVNA G SEP   S+ ++ K+    P I +  H     I   GE
Sbjct: 7974 VEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGE 8030

Query: 856  AVNLVIPFQGKPRPELTWKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDLQVK 914
             +++ +PF+  P P ++W KDG E+   +++ ++N      + + K+ R+ +G Y + ++
Sbjct: 8031 KLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLE 8090

Query: 915  VDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKK 974
                  TASI++++I  PGP + +K  D+   +  LTW PP+ DG   I  Y +++ +  
Sbjct: 8091 NKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEFDGGTPILHYVLERREAG 8150

Query: 975  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
               +  V+   ++ S T+ +L+   EY+FRV + N  G  E   +  ++ VIA+D K   
Sbjct: 8151 RRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIEL--KNPVIAQDPKQPP 8208

Query: 1035 NP 1036
            +P
Sbjct: 8209 DP 8210



 Score =  194 bits (493), Expect = 4e-49
 Identities = 148/575 (25%), Positives = 258/575 (44%), Gaps = 49/575 (8%)

Query: 464   WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAK----VHVI 519
             W K+G+ +++   +++        L + +A  +  G  V+  +A N +  AK    V V 
Sbjct: 21620 WFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG--VYTVEAKNASGSAKAEIKVKVQ 21677

Query: 520   DPPKIILDGLDADNTVTVIAGNKLRL--EIPISGEPPP-------KAMWSRGDKAIMEGS 570
             D P  ++  +   N    I G K+ L  + P++    P       K   SR   A++E  
Sbjct: 21678 DTPGKVVGPIRFTN----ITGEKMTLWWDAPLNDGCAPITHYIIEKRETSRLAWALIED- 21732

Query: 571   GRIRTESYPDSSTLVIDIAERDDSGV--YHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
              +   +SY     +  +  +   S V  + +    ++    A I+  V   PD P  P  
Sbjct: 21733 -KCEAQSYTAIKLINGNEYQFRVSAVNKFGVGRPLDSDPVVAQIQYTV---PDAPGIPEP 21788

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMR-LNFDLCKETTFEPKKMIEG 687
             + +  +   + W  P  DGGS I  Y +ER++K+S+RW++ ++     ET F+   + EG
Sbjct: 21789 SNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEG 21848

Query: 688   VAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHI 744
               YE  + A NA G+   S  SR      P+    PPT++ V   + TTV++ W  P   
Sbjct: 21849 NEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFD 21908

Query: 745   GAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDA 804
             G   + GY++E C                       DW   N +   KT++T+T L    
Sbjct: 21909 GGMEIIGYIIEMC------------------KADLGDWHKVNAEACVKTRYTVTDLQAGE 21950

Query: 805   KIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
             +   RV A+N AG  +    +  I   + +  P++ I  + KQT++ R G ++ L I +Q
Sbjct: 21951 EYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQ 22010

Query: 865   GKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASI 924
             G+P P   W K  + +   + +I  +++ + + +    R+ +GKY L V+ +   ++ + 
Sbjct: 22011 GRPTPTAVWSKPDSNLSL-RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITF 22069

Query: 925   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH 984
              ++++D PGPP  +  +DV   +  L W  P  DG A I  Y ++K +     W  + E 
Sbjct: 22070 TVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARIHHYVVEKREASRRSWQVISEK 22129

Query: 985   YHRTSATITELVIGNEYYFRVFSENMCGLSEDATM 1019
               R    + +L  G  YYFRV + N  G+ E   M
Sbjct: 22130 CTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEM 22164



 Score =  185 bits (470), Expect = 2e-46
 Identities = 172/692 (24%), Positives = 288/692 (41%), Gaps = 92/692 (13%)

Query: 373  KWFKNGEEIIP-----------GPKSRYRIRVEGKKHILIIEGATKA-------DAAEYS 414
            +W +  E ++P           G + ++R+R E    I     AT         DA +  
Sbjct: 8253 RWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVI 8312

Query: 415  VMTT-----GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC---------EISENI 460
            + T+     G + +   S+   P   +T + D+ V + +EI  +          E+ E  
Sbjct: 8313 LRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEE 8372

Query: 461  PGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN--VTLPAKVHV 518
            P       LP+ +   +    KG   +L + ++L  D G Y+   +  +     P  V V
Sbjct: 8373 PFV-----LPLTQRLSIDNSKKGE-SQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8426

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
            +D P   ++ +  D   T +             EPP       G   I+  +   + ++ 
Sbjct: 8427 LDTPGPPINFVFEDIRKTSVL---------CKWEPP----LDDGGSEIINYTLEKKDKTK 8473

Query: 579  PDSSTLVIDIAERD-----------DSGVYHINLKNEAGEAHASIKVKVVDF-----PDP 622
            PDS  +V+    R               ++ +  +N  G     +   +V       PD 
Sbjct: 8474 PDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPLVAKDPFGPPDA 8533

Query: 623  PVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPK 682
            P  P V +V  +  ++ W  P  D GSPILGY++E+++  S+ W R+N  L         
Sbjct: 8534 PDKPIVEDVTSNSMLVKWNEPK-DNGSPILGYWLEKREVNSTHWSRVNKSLLNALKANVD 8592

Query: 683  KMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP--PTLLTVDSVTDTTVTMRWRP 740
             ++EG+ Y  R+ A NA G  K S PS P       SP  P +  V   + TT+ + W P
Sbjct: 8593 GLLEGLTYVFRVCAENAAGPGKFSPPSDPKTAHDPISPPGPPIPRVTDTSSTTIELEWEP 8652

Query: 741  PDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL 800
            P   G   + GY ++    G+                   +W    + +I   ++T+  +
Sbjct: 8653 PAFNGGGEIVGYFVDKQLVGT------------------NEWSRCTEKMIKVRQYTVKEI 8694

Query: 801  PTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLV 860
               A   +RV AVNAAG   P   +QP+ V E  EPP + +   +K       G+ + + 
Sbjct: 8695 REGADYKLRVSAVNAAGEGPPG-ETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIP 8753

Query: 861  IPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVE 920
                G+P P   W K+  E+DK+++ I N  T + + I+ A R   G+Y +        +
Sbjct: 8754 AVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSK 8813

Query: 921  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFT 980
             A+  +++ D PGP   +K      +   L W+ P+DDG + ITG+ I++ D K   W  
Sbjct: 8814 FAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQ 8873

Query: 981  VIEHYHRTSATITELVIGNEYYFRVFSENMCG 1012
             IE   R+   IT L+ G EY FRV ++N  G
Sbjct: 8874 PIE-TERSKCDITGLLEGQEYKFRVIAKNKFG 8904



 Score =  184 bits (467), Expect = 4e-46
 Identities = 177/720 (24%), Positives = 313/720 (43%), Gaps = 79/720 (10%)

Query: 344   VTKQLEDTTAYCGERVELECE-VSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
             + K+++D T   GE  +L C+ V     ++KW++ G+E+I   K  Y++  +G+ H L +
Sbjct: 24163 IRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRK--YKMSSDGRTHTLTV 24220

Query: 403   EGATKADAAEYSVMTTGG----QSSAKLSVDLKP-LKILTPLTDQTVN-LGKEICLKCE- 455
                 + D   Y+ + T      ++S+KL +   P      PL ++    +G  + L    
Sbjct: 24221 MTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMY 24280

Query: 456   ISENIPGK-WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
             I   +P   W      +Q S+ + + +      LV+ N   +           Y V L  
Sbjct: 24281 IGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAG------KYKVQLSN 24334

Query: 515   KVHVIDPPKIILDGLDADN----TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIME-- 568
                 +D    ILD    D     T  ++    L+    IS +PP     S     ++E  
Sbjct: 24335 VFGTVDA---ILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKC 24391

Query: 569   -----GSGRIRTESYPDSSTLVIDIAERDDSGVY-HINLKNEAG-----EAHASIKVKV- 616
                     ++ + +   ++  ++++ E  ++G Y  ++ +N  G     E  + + +K  
Sbjct: 24392 EAKEGAEWQLVSSAISVTTCRIVNLTE--NAGYYFRVSAQNTFGISDPLEVSSVVIIKSP 24449

Query: 617   VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
              + P  P  PT+T V  D C++ W+PPA DGG+ I  Y++E+++K+ ++W+ +  +  +E
Sbjct: 24450 FEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 24509

Query: 677   TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTM 736
             T F  K +IEG+ YE R+   N  G S+ S  S P  P +          + + +  V  
Sbjct: 24510 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRY 24569

Query: 737   RWRPPDHIGAAGLDGYVLEYCFEG----STSAKQSDENGEAAYDLPAEDWIVANKDLIDK 792
             +          G    ++++  +G    +   K   +  +  Y                 
Sbjct: 24570 QSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYH---------------- 24613

Query: 793   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRR 852
              +  I  +  D     +V+A N  G+             E+  P KI +P+ L+      
Sbjct: 24614 -QLIIASVTDDDATVYQVRATNQGGSVSGT------ASLEVEVPAKIHLPKTLEGMGAVH 24666

Query: 853   V--GEAVNLVIPFQGKPRPELTWKKDGAEIDKN---QINIRNSETDTIIFIRKAERSHSG 907
                GE V++ IPF GKP P +TW+K    ID N   Q+ +  S T +++F    ER  +G
Sbjct: 24667 ALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFT-SLVFPNGVERKDAG 24725

Query: 908   KYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYT 967
              Y +  K    ++  ++++ + D P PP+ VK+ DV  ++V LTWT P  DG + IT Y 
Sbjct: 24726 FYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYI 24785

Query: 968   IQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE-----DATMTKE 1022
             ++K    +  W  V      T  T+  L     Y FRV +EN  GLS+     + T+TKE
Sbjct: 24786 VEKCATTAERWLRV-GQARETRYTVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKE 24844



 Score =  169 bits (427), Expect = 2e-41
 Identities = 165/704 (23%), Positives = 284/704 (40%), Gaps = 93/704 (13%)

Query: 350  DTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
            D    CGE V E + EV+  +   KW+             YR++   +      +GA+K 
Sbjct: 7260 DKWVACGEPVAETKMEVTGLEEG-KWYA------------YRVKALNR------QGASKP 7300

Query: 409  DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTK 466
                  +     Q + ++ +D+K L  LT      V  G +I L   ++     K  WTK
Sbjct: 7301 SRPTEEIQAVDTQEAPEIFLDVKLLAGLT------VKAGTKIELPATVTGKPEPKITWTK 7354

Query: 467  NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV----TLPAKVHVIDP- 521
              + +++  R+ + +  +   + I ++   D G Y+   +A NV    T   +V+V+D  
Sbjct: 7355 ADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYII--EAVNVCGRATAVVEVNVLDKP 7412

Query: 522  -PKIILDGLDADNTVTVIAGNKLR-------LEIPISGEPPPKAMWSRGDKAIMEGSGRI 573
             P    D  D  N   ++  N  R           +        +W +    + + + + 
Sbjct: 7413 GPPAAFDITDVTNESCLLTWNPPRDDGGSKITNYVVERRATDSEVWHKLSSTVKDTNFK- 7471

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGD 633
             T+  P+   +    AE     +Y +    +A    A  +    D P PP     +++  
Sbjct: 7472 ATKLIPNKEYIFRVAAE----NMYGVGEPVQASPITAKYQ---FDPPGPPTRLEPSDITK 7524

Query: 634  DWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVR 693
            D   + W  P  DGGSPI GY++ER    + +W+R N    K+TT+  K +     Y  R
Sbjct: 7525 DAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRFR 7584

Query: 694  IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
            + A N  G  KPS  + P +   P+    PP   TV  V  T+V + W  P+H G A ++
Sbjct: 7585 VLAENLAGPGKPSKSTEPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIE 7644

Query: 751  GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 810
             YV+E    G+                  ++W+   +  +  T+  + GL    +   RV
Sbjct: 7645 SYVIEMLKTGT------------------DEWVRVAEG-VPTTQHLLPGLMEGQEYSFRV 7685

Query: 811  KAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP- 869
            +AVN AG SEP   S P+L +E + PP    PR L+   I +    +   +P +    P 
Sbjct: 7686 RAVNKAGESEPSEPSDPVLCREKLYPPS--PPRWLEVINITKNTADLKWTVPEKDGGSPI 7743

Query: 870  -----------ELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF 918
                          W+     +   +  +      ++   R A  +  G+ D        
Sbjct: 7744 TNYIVEKRDVRRKGWQTVDTTVKDTKCTVTPLTEGSLYVFRVAAENAIGQSDYTE----- 7798

Query: 919  VETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEW 978
            +E + +       PGPP  + + DV   +V L W PPK+DG   I  Y I+K ++    W
Sbjct: 7799 IEDSVLAKDTFTTPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGTRW 7858

Query: 979  FTVIEHY-HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTK 1021
                +      +  +T+++ G E  F+V +EN  G+   +  T+
Sbjct: 7859 VKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTE 7902



 Score =  162 bits (411), Expect = 1e-39
 Identities = 110/364 (30%), Positives = 175/364 (48%), Gaps = 16/364 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V  G    F  EL+   + V+WY  G+++ PS K +   +G    L + + ++ D  E  
Sbjct: 5835 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 5894

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
            +TA D K    LFV+EPP+  TK LED T   G    LECEVS ++A VKWFKNG EI+ 
Sbjct: 5895 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 5954

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
              K  Y I  +G+   L+I   T  D   Y+      ++S  L+V    ++ L PLTD  
Sbjct: 5955 SKK--YEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQ 6012

Query: 444  VNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V   +    +CE+S EN   KW K+G  +++  +  ++ KG +  LVI   L +DE +Y 
Sbjct: 6013 VREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY- 6071

Query: 503  FAPDAYNVTLPAKVHVIDPPKII---LDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
             + +         + V++   +    L  ++   T T+    KL  E+    +P  + +W
Sbjct: 6072 -SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTI----KLVCEV---SKPGAEVIW 6123

Query: 560  SRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF 619
             +GD+ I+E +GR    +      LVI  A  +D+G Y+  L +   +    +     +F
Sbjct: 6124 YKGDEEIIE-TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEF 6182

Query: 620  PDPP 623
               P
Sbjct: 6183 ISKP 6186



 Score =  152 bits (383), Expect = 2e-36
 Identities = 107/326 (32%), Positives = 162/326 (49%), Gaps = 37/326 (11%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             +DPP+I +D    D T+ V AG   +++  I G+P P   W +GD+ +   + R+  +S 
Sbjct: 16166 VDPPRISMDPKYKD-TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKST 16223

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV-TEVGDDWCI 637
               +++L +  A R DSG Y +  KN AGE   ++ VKV+D P PP  P V + V  + C 
Sbjct: 16224 DFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCT 16283

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL----CKETTFEPKKMIEGVAYEVR 693
             + W+PP  DGGS I+ Y +ER++     W  ++ ++    CK T     K++EG  Y  R
Sbjct: 16284 LAWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVT-----KLLEGNEYTFR 16338

Query: 694   IFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             I AVN  G+ +P + S P V   P  V   P    V +VT  ++ + W  P   G + + 
Sbjct: 16339 IMAVNKYGVGEP-LESEPVVAKNPFVVPDAPKAPEVTTVTKDSMIVVWERPASDGGSEIL 16397

Query: 751   GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRV 810
             GYVLE          + D+ G          W   +K LI + +  +TGL  +     RV
Sbjct: 16398 GYVLE----------KRDKEGIR--------WTRCHKRLIGELRLRVTGLIENHDYEFRV 16439

Query: 811   KAVNAAGASEPKYYSQPILVKEIIEP 836
              A NAAG SEP   S P   ++  +P
Sbjct: 16440 SAENAAGLSEP---SPPSAYQKACDP 16462



 Score =  150 bits (379), Expect = 7e-36
 Identities = 100/328 (30%), Positives = 160/328 (48%), Gaps = 26/328 (7%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P++ L G+     V   AG+ +++EIP+ G P P   W +GD+ I++ + R+  E+   S
Sbjct: 14691 PELDLRGI-YQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQ-ILKQTQRVNFETTATS 14748

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             + L I+   R DSG Y +  +N  GE    I ++V D P PP  P    EV  D+   +W
Sbjct: 14749 TILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSW 14808

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             +PP  DGG PI  Y +E ++  S+ W+ L   + + TT++  ++  G+ Y+ R+ A N  
Sbjct: 14809 DPPENDGGVPISNYVVEMRQTDSTTWVELATTVIR-TTYKATRLTTGLEYQFRVKAQNRY 14867

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+  P + S   V   P  V  PP    V +VT  ++T+ W  P   G + + GY +E  
Sbjct: 14868 GVG-PGITSACIVANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVE-- 14924

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                     + + NG          W   +K L+    F  +GL        RV A N AG
Sbjct: 14925 --------RKERNGIL--------WQTVSKALVPGNIFKSSGLTDGIAYEFRVIAENMAG 14968

Query: 818   ASEPKYYSQPILVKEIIEPPKIRIPRHL 845
              S+P   S+P+L  + I+PP   +P ++
Sbjct: 14969 KSKPSKPSEPMLALDPIDPPGKPVPLNI 14996



 Score =  150 bits (379), Expect = 7e-36
 Identities = 103/337 (30%), Positives = 165/337 (48%), Gaps = 25/337 (7%)

Query: 506   DAYNVTLPAKV-HVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDK 564
             D   + LP  +   ++PP+I +    + +TV V AG+ L+++IPISG+P PK   SR D 
Sbjct: 20085 DPRELLLPVLIKEQLEPPEIDMKNFPS-HTVYVRAGSNLKVDIPISGKPLPKVTLSR-DG 20142

Query: 565   AIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPV 624
               ++ + R  TE   ++ T+ +  +   D+G Y I   N +G   A I + V+D P PP 
Sbjct: 20143 VPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPT 20202

Query: 625   APTV-TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKK 683
              P V +++ ++   + WEPP YDGGS +  Y + +++  ++ W  ++  + + T  +  K
Sbjct: 20203 GPVVISDITEESVTLKWEPPKYDGGSQVTNYILLKRETSTAVWTEVSATVAR-TMMKVMK 20261

Query: 684   MIEGVAYEVRIFAVNAIGISK--PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPP 741
             +  G  Y+ RI A N  GIS    S      +P     PP+   V +VT  ++T+ W  P
Sbjct: 20262 LTTGEEYQFRIKAENRFGISDHIDSACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEP 20321

Query: 742   DHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
                G + + GY LE            D N           W  ANK +I  T F +T + 
Sbjct: 20322 VSNGGSAVVGYHLE----------MKDRNSIL--------WQKANKLVIRTTHFKVTTIS 20363

Query: 802   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
                    RV A NAAG  +P + S+P+L  +  EPP+
Sbjct: 20364 AGLIYEFRVYAENAAGVGKPSHPSEPVLAIDACEPPR 20400



 Score =  149 bits (377), Expect = 1e-35
 Identities = 148/568 (26%), Positives = 234/568 (41%), Gaps = 60/568 (10%)

Query: 360   ELEC-EVSEDDANVKWFK----NGEEII-----------PGPKSRYRIRVEGKKHILIIE 403
             ELE   +S+D   ++W K     G+EI+              K   + R++ K+    I 
Sbjct: 24064 ELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQ--FTIG 24121

Query: 404   GATKADAAEYSVMT---TGGQSSAKLSVDLKPLK-------ILTPLTDQTVNLGKEICLK 453
             G  +A   E+ V     TG     + ++ +K          I   + D T  LG+   L 
Sbjct: 24122 GLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLS 24181

Query: 454   CEI-SENIPG-KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYN 509
             C+I    +P  KW + G  + +S + K+   GR H L +     EDEG Y  +   +   
Sbjct: 24182 CQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGE 24241

Query: 510   VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             V   +K+ +   P+    G           G+ LRL +   G P P   W  G K +++ 
Sbjct: 24242 VETSSKLLLQATPQFH-PGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQK-LLQN 24299

Query: 570   SGRIRTESYPDSSTLVI-DIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
             S  I  E+    + LV+ ++  +  +G Y + L N  G   A + V++ D PD P  P V
Sbjct: 24300 SENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIV 24359

Query: 629   TE-VGDDWCIMNWEPPAYDGGSPILGYFIER-KKKQSSRWMRLNFDLCKETTFEPKKMIE 686
              E +  +  +++W+PPA DGGS I  Y +E+ + K+ + W +L       TT     + E
Sbjct: 24360 IEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEW-QLVSSAISVTTCRIVNLTE 24418

Query: 687   GVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
                Y  R+ A N  GIS P   S   +   P      P   T+ +VT  +  + W+PP  
Sbjct: 24419 NAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPAS 24478

Query: 744   IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTD 803
              G A +  Y LE         ++  +N           WI    + I +T F++  L   
Sbjct: 24479 DGGAKIRNYYLE--------KREKKQN----------KWISVTTEEIRETVFSVKNLIEG 24520

Query: 804   AKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPF 863
              +   RVK  N  G SE    S+PI  K  +          L+   +R    A  LV   
Sbjct: 24521 LEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNA-TLVCKV 24579

Query: 864   QGKPRPELTWKKDGAEIDKNQINIRNSE 891
              G P+P + W + G EI  + +  R  E
Sbjct: 24580 TGHPKPIVKWYRQGKEIIADGLKYRIQE 24607



 Score =  148 bits (373), Expect = 3e-35
 Identities = 104/358 (29%), Positives = 163/358 (45%), Gaps = 33/358 (9%)

Query: 491   ANALTEDEGDYVFAPDAYNVT---LPAKVHVIDPPKIILDGLDA----DNTVTVIAGNKL 543
             A  LTE + +Y F   A N      P+++ V+    ++   LD     D        +  
Sbjct: 13570 AKDLTEGK-EYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNF 13628

Query: 544   RLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKN 603
             RL+IPI G+P P   W +G+  +   + R+  ES   ++TL++   ++ D+G Y I LKN
Sbjct: 13629 RLKIPIKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKN 13687

Query: 604   EAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
              AG    +I +KVV  P  P  P    EV  +   + W PP  DGGS I  Y +E++   
Sbjct: 13688 VAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSV 13747

Query: 663   SSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTS 719
             +++W+       ++TTF   ++ EG+ Y  R+ A N  G+ +  + S P V   P  V  
Sbjct: 13748 NNKWVTCA-SAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE-GLKSEPIVARHPFDVPD 13805

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
              P    +  V   +V++ W  P   G + + GY LE+    S                  
Sbjct: 13806 APPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL---------------- 13849

Query: 780   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 837
               W  ANK  I    F +TGL    +   RV A+N AG  +P   S+P++  + I+PP
Sbjct: 13850 --WKRANKTPIRMRDFKVTGLTEGLEYEFRVMAINLAGVGKPSLPSEPVVALDPIDPP 13905



 Score =  145 bits (365), Expect = 3e-34
 Identities = 110/374 (29%), Positives = 173/374 (46%), Gaps = 19/374 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            QV +    RF  EL+    +VKW+K+G EI+   KY    KG  RIL IN C + D++EY
Sbjct: 6012 QVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEY 6071

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEII 382
                   + S  L V E   + TK L +      + ++L CEVS+  A V W+K  EEII
Sbjct: 6072 SCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEII 6131

Query: 383  PGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQ 442
                 RY I  EG+K IL+I+ A   DA  Y+      ++  K+ V     + ++   + 
Sbjct: 6132 --ETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNL 6189

Query: 443  TVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             +  G++    C IS E+ P +W ++   ++  D+  V+  G+   LV+ +A  +D G Y
Sbjct: 6190 EILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTY 6249

Query: 502  VF----APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKA 557
            V     A  A ++T+  K+ ++ P K        D  V          E+   G    KA
Sbjct: 6250 VVMVGAARAAAHLTVIEKLRIVVPLK--------DTRVKEQQEVVFNCEVNTEG---AKA 6298

Query: 558  MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVV 617
             W R ++AI + S  I  +      TL I  A  DD   Y+++L N  GE   S    +V
Sbjct: 6299 KWFRNEEAIFDSSKYIILQK-DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV 6357

Query: 618  DFPDPPVAPTVTEV 631
            +  D  +   + ++
Sbjct: 6358 EEEDLRIVEPLKDI 6371



 Score =  143 bits (360), Expect = 1e-33
 Identities = 99/322 (30%), Positives = 145/322 (45%), Gaps = 23/322 (7%)

Query: 519   IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESY 578
             ID P   LD    D  + V AG    LE  I G+P P  +WS+  K + E + R+  +S 
Sbjct: 18330 IDAPNASLDPKYKD-VIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKST 18388

Query: 579   PDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCI 637
                +TLV+    R D G Y + L N  G     I VKV+D P PP  P  VT V  + C 
Sbjct: 18389 IQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCY 18448

Query: 638   MNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAV 697
             + W PP  DGG+ I  Y IE+++     W +++ ++ +   ++  K++ G  Y  R+ AV
Sbjct: 18449 LAWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEV-QALNYKVTKLLPGNEYIFRVMAV 18507

Query: 698   NAIGISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             N  GI +P  S P     P     PP+   V ++T  ++ + W  P   G   ++GY+LE
Sbjct: 18508 NKYGIGEPLESGPVTACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILE 18567

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
                       + D+ G          W   NK  +   +  +TGL        RV A NA
Sbjct: 18568 ----------KRDKEGVR--------WTKCNKKTLTDLRLRVTGLTEGHSYEFRVAAENA 18609

Query: 816   AGASEPKYYSQPILVKEIIEPP 837
             AG  EP   S      + + PP
Sbjct: 18610 AGVGEPSEPSVFYRACDALYPP 18631



 Score =  140 bits (352), Expect = 9e-33
 Identities = 97/357 (27%), Positives = 171/357 (47%), Gaps = 39/357 (10%)

Query: 496   EDEGDYVF---APDAYNVTLPAK----VHVID---PPKIILDGLDADNTVTVIAGNKLRL 545
             E++  Y F   A  A N++ P++    V ++    PP+I L  +   + +TV AG  + L
Sbjct: 12885 EEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLS-VAMKSLLTVKAGTNVCL 12943

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
             +  + G+P P   W + D  +++ +  I+     +  TL +    R DSG Y I  +N +
Sbjct: 12944 DATVFGKPMPTVSWKK-DGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSS 13002

Query: 606   GEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSR 665
             G   A+IK+KV+D P PP +  + ++  D  +++WEPP  DGGS I  Y +++++     
Sbjct: 13003 GSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVDKRETSRPN 13062

Query: 666   WMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGI-----SKPSMPSRPFVPLAVTSP 720
             W +++  +   T+   +K+IEG  Y+ RI A N  G+     ++P++   P+ P     P
Sbjct: 13063 WAQVSATV-PITSCSVEKLIEGHEYQFRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDP 13121

Query: 721   PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE 780
             P    + ++T   +T+ W+PP   G + + GY+LE                    +  A 
Sbjct: 13122 P---VISNITKDHMTVSWKPPADDGGSPITGYLLE------------------KRETQAV 13160

Query: 781   DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP 837
             +W   N+  I +     TGL    +   RV A+N AG  +P   S+    ++   PP
Sbjct: 13161 NWTKVNRKPIIERTLKATGLQEGTEYEFRVTAINKAGPGKPSDASKAAYARDPQYPP 13217



 Score =  139 bits (350), Expect = 2e-32
 Identities = 112/414 (27%), Positives = 188/414 (45%), Gaps = 21/414 (5%)

Query: 270  VRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDE 329
            + F V +    +  KW KNG EI+ + K     K     L I N    D ++Y   AG  
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 330  KCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRY 389
              +  L+V    I   K ++D      +R   ECEVSE D  V+W K+ +E+      R 
Sbjct: 3000 TSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRI 3057

Query: 390  RIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKE 449
            +I+ E   H L+I     +DA +Y+V+  G  S+AKL V+ + ++I +   +  V   + 
Sbjct: 3058 KIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3117

Query: 450  ICLKCEISE-NIPGKWTKNGLPV--QESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD 506
              ++ E++E ++   W K+G+ +  Q  +R K V + RIH++ I+     D G+Y F   
Sbjct: 3118 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3177

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                ++   V+  +PP++    L     VTV +G   R    ISG P PK  W + ++ +
Sbjct: 3178 RNRSSVTLYVNAPEPPQV----LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL 3233

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG----EAHASIKVKVVDFPD- 621
              G  + +        TL++  A  +D+ VY    KN+ G     A  S++V  V  PD 
Sbjct: 3234 STGF-KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3292

Query: 622  --PPVAPTVTEVGDDWCIMNWEPPAY----DGGSPILGYFIERKKKQSSRWMRL 669
              P   P +     D      +P  +     G    + ++ + KK + SR+ R+
Sbjct: 3293 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3346



 Score =  137 bits (344), Expect = 8e-32
 Identities = 104/360 (28%), Positives = 172/360 (47%), Gaps = 10/360 (2%)

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F VEL+   + VKW+KN Q +  +     + +G    +   +  + D S+  V A     
Sbjct: 5576 FTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSS 5635

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +L V E     T +L+D T    + V L+CE+S+ DA VKWFK+G+EI P   +   I
Sbjct: 5636 EAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNA--VI 5693

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
            + +GKK +LI++ A K+D  +Y+      ++S KL ++ + +K++ PL    V   +   
Sbjct: 5694 KADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETAR 5753

Query: 452  LKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNV 510
             + EISE +I   W   G  + ++   ++  +G+IH LV+ N   +  G   F   A NV
Sbjct: 5754 FETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDF--QAANV 5811

Query: 511  TLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS 570
               A + V   P++I   L     VTV AG     +  +S E  P   + +G K  +E S
Sbjct: 5812 KSSAHLRV--KPRVI-GLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKK--LEPS 5866

Query: 571  GRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
             ++   S     TL +   + +D+G   +  K+    A+  +K   V+F  P    TV E
Sbjct: 5867 DKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEE 5926



 Score =  137 bits (344), Expect = 8e-32
 Identities = 134/554 (24%), Positives = 209/554 (37%), Gaps = 88/554 (15%)

Query: 617  VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKE 676
            +D P PP  PTV +VG     +NW  P +DGG+ I  Y IE  K  +  W+R+   +   
Sbjct: 7609 IDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVRVAEGVPTT 7668

Query: 677  TTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTT 733
                P  M EG  Y  R+ AVN  G S+PS PS P +    L   SPP  L V ++T  T
Sbjct: 7669 QHLLPGLM-EGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEVINITKNT 7727

Query: 734  VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKT 793
              ++W  P+  G + +  Y++E                    D+  + W   +  + D T
Sbjct: 7728 ADLKWTVPEKDGGSPITNYIVE------------------KRDVRRKGWQTVDTTVKD-T 7768

Query: 794  KFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRV 853
            K T+T L   +    RV A NA G S+       +L K+    P                
Sbjct: 7769 KCTVTPLTEGSLYVFRVAAENAIGQSDYTEIEDSVLAKDTFTTP---------------- 7812

Query: 854  GEAVNLVIPFQGKPRPELTW---KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYD 910
            G    L +    K   +L W   K DG    +  +  +     T    R  +   +   D
Sbjct: 7813 GPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKERLGT----RWVKAGKTAGPD 7868

Query: 911  LQVKVDKFVETASIDIQI-----------------------IDRPGPPQIVKIEDVWGEN 947
               +V   +E   +  Q+                          P PP  + + D   ++
Sbjct: 7869 CNFRVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKH 7928

Query: 948  VALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITE--LVIGNEYYFRV 1005
            +A+ W PP+ +G + I GY ++     + +W  V     +      E  +V   EY  RV
Sbjct: 7929 IAIAWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRV 7988

Query: 1006 FSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT 1065
             + N  G+SE + +++   V+A+D         E  D                I G   +
Sbjct: 7989 RAVNAIGVSEPSEISEN--VVAKDPDCKPTIDLETHDI-------------IVIEGEKLS 8033

Query: 1066 LNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDL 1125
            +    R  P P ++W K+   +    R  M ++     LE+ K    D G Y     N L
Sbjct: 8034 IPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKL 8093

Query: 1126 GTVEIECKLEVKVI 1139
            G+      + VKVI
Sbjct: 8094 GSA--TASINVKVI 8105



 Score =  136 bits (343), Expect = 1e-31
 Identities = 105/376 (27%), Positives = 169/376 (44%), Gaps = 13/376 (3%)

Query: 247  EEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQ 306
            + K+   F + L      +K     F  E ++P ++VKWYK+G E+    KY        
Sbjct: 2123 QAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKV 2182

Query: 307  RILFINNCQMTDDSEY-YVTAGDE--KCSTELFVREPPIMVTKQLEDTTAYCGERVELEC 363
              L I     +D  +Y  V   DE  K + +L V    +   K+L+D         ELEC
Sbjct: 2183 HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC 2242

Query: 364  EVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSS 423
             VS ++   KW+ N  E+      +Y I     +  L ++  TK D  EYS +  G +++
Sbjct: 2243 IVSPENIEGKWYHNDVEL--KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT 2300

Query: 424  AKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHK 482
             KL +  +P+ IL  L+DQ V  G  + L+ ++S E++ G W K+G  VQ SDR+ +V  
Sbjct: 2301 CKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVID 2360

Query: 483  GRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNK 542
             + H L+I +   ED G+Y F   A  ++   +V V       +D +     V VI G K
Sbjct: 2361 KQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYS-----VDVITPLKDVNVIEGTK 2415

Query: 543  LRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLK 602
              LE  +S        W   D+ I +   R++         LVI+     D G Y + + 
Sbjct: 2416 AVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2474

Query: 603  NEAGEAHASI-KVKVV 617
                  + S+ K+K++
Sbjct: 2475 RVETNCNLSVEKIKII 2490



 Score =  133 bits (335), Expect = 8e-31
 Identities = 197/836 (23%), Positives = 326/836 (38%), Gaps = 110/836 (13%)

Query: 337   VREPPIMVTKQLEDTTAY-CGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVE 394
             V  P I V  + +DT     GE   LE +VS      ++W K+G+E+     ++  I++ 
Sbjct: 15084 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL--EGTAKLEIKIA 15141

Query: 395   GKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKC 454
                  L+ + +T+ D+  Y++  T     AK   ++K L    P  +  + + +    KC
Sbjct: 15142 DFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGP-PEGPLAVTEVTSEKC 15200

Query: 455   EISENIP-----GKWTKNGLPVQESDRL---KVVHKGRIHKLVIANALTEDEGDY-VFAP 505
              +S   P      K     +  +E+ RL    V  + ++ KL +   L  +E  + V A 
Sbjct: 15201 VLSWFPPLDDGGAKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAV 15260

Query: 506   DAYNVTLPAKVHVI---------DPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPK 556
             + Y V  P +   +         DPPK        +  VT I  + +   +   G P   
Sbjct: 15261 NKYGVGEPLESEPVLAVNPYGPPDPPK--------NPEVTTITKDSM---VVCWGHPDSD 15309

Query: 557   A-------MWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG--- 606
                     +  R DKA      +   ++  D    V  + E  +   + I  +N AG   
Sbjct: 15310 GGSEIINYIVERRDKAGQRWI-KCNKKTLTDLRYKVSGLTEGHEYE-FRIMAENAAGISA 15367

Query: 607   EAHASIKVKVVDF---PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQS 663
              +  S   K  D    P PP  P V +       + W  P YDGGS I GY +E    + 
Sbjct: 15368 PSPTSPFYKACDTVFKPGPPGNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEE 15427

Query: 664   SRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM-PSRPFVPLAVTSPP 721
               W  +      K T++    + E   Y++RI+A+N+ G+ +P++ P  P     +  P 
Sbjct: 15428 DEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPE 15487

Query: 722   TLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAED 781
               L  D     T+         +   G     +++  +   S  ++     ++Y L    
Sbjct: 15488 IELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHGESLDKASIESTSSYTL---- 15543

Query: 782   WIVANKDLIDKTKF--TITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII----- 834
              IV N +  D  K+  T+         FV V+ ++  G        Q + VKE+      
Sbjct: 15544 LIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPP------QDLKVKEVTKTSVT 15597

Query: 835   ---EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSE 891
                +PP +     +K  YI    E+             + +WK D  +           E
Sbjct: 15598 LTWDPPLLDGGSKIKN-YIVEKRESTRKAYSTVATNCHKTSWKVDQLQ-----------E 15645

Query: 892   TDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALT 951
               +  F   AE  +         +    ETA   ++  +RP PP  + + DV   +V+L+
Sbjct: 15646 GCSYYFRVLAENEYG--------IGLPAETAE-SVKASERPLPPGKITLMDVTRNSVSLS 15696

Query: 952   WTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMC 1011
             W  P+ DG + I GY ++   K S +W T       T ATIT L+ G EY FRV ++N  
Sbjct: 15697 WEKPEHDGGSRILGYIVEMQTKGSDKWATCAT-VKVTEATITGLIQGEEYSFRVSAQNEK 15755

Query: 1012  GLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSV 1070
             G+S+   ++    VIA+D  I              P   + L NT+ + AG +  ++   
Sbjct: 15756 GISDPRQLSVP--VIAKDLVI--------------PPAFKLLFNTFTVLAGEDLKVDVPF 15799

Query: 1071  RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
              G P P +TW K+ V +    R    S +    L I+     D G Y  K  N  G
Sbjct: 15800 IGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAG 15855



 Score =  133 bits (335), Expect = 8e-31
 Identities = 89/320 (27%), Positives = 152/320 (47%), Gaps = 26/320 (8%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P   L G+  +  +T  AG+   +++PISG P PK  W   +  + E + R+   +  D 
Sbjct: 22273 PTADLTGI-TNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKE-TDRVSITTTKDR 22330

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             +TL +  + R DSG Y + L+N AG    S+ V V+  P P   P  V+ V  + C+++W
Sbjct: 22331 TTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSW 22390

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P   GG+ I  Y +E+++  ++ W  +N  + K T  +   + + + Y  R+ + N  
Sbjct: 22391 GEPKDGGGTEITNYIVEKRESGTTAWQLVNSSV-KRTQIKVTHLTKYMEYSFRVSSENRF 22449

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G+SKP + S P +   P    S PT   V  V+   +++RW  P H G + + GY +E  
Sbjct: 22450 GVSKP-LESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIRWEEPYHDGGSKIIGYWVE-- 22506

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
                     + + N           W+  NK    +  + +TGL    +   R  A+NAAG
Sbjct: 22507 --------KKERNTIL--------WVKENKVPCLECNYKVTGLVEGLEYQFRTYALNAAG 22550

Query: 818   ASEPKYYSQPILVKEIIEPP 837
              S+    S+PI+ +  ++ P
Sbjct: 22551 VSKASEASRPIMAQNPVDAP 22570



 Score =  131 bits (329), Expect = 4e-30
 Identities = 159/630 (25%), Positives = 262/630 (41%), Gaps = 95/630 (15%)

Query: 267   GGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT 325
             GG +R  V +   P  EVKW K   EIR +   I +       L ++N    D  +Y +T
Sbjct: 16585 GGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFTSLVLDNVNRYDSGKYTLT 16642

Query: 326   AGDEKCSTELFVR-------EPPI--MVTKQLEDTTAYCGERVELECE-------VSEDD 369
               +   +   FV         PP+   VT+  +D+ +   E   L+         V + +
Sbjct: 16643 LENSSGTKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEKRE 16702

Query: 370   ANVKWF--------KNG---EEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
             A  K +        KN    +++  G    +R+  E +  I        A  A+   +  
Sbjct: 16703 ATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGI-----GLPAQTADPIKVAE 16757

Query: 419   GGQSSAKLSVDLKPLKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESD 475
               Q   K++VD         +T  +V+L     E     +I + I     K+     E  
Sbjct: 16758 VPQPPGKITVD--------DVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECA 16809

Query: 476   RLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN-----------VTLPAKVHVIDPPKI 524
             R+K +      + VI N LT+ E +Y+F   A N           V + AK  VI+P   
Sbjct: 16810 RVKSL------QAVITN-LTQGE-EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEP--- 16858

Query: 525   ILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTL 584
               D   A ++ +V  G  L++E+PISG P P   W++ D   ++ + RI      D +TL
Sbjct: 16859 --DVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTK-DGLPLKQTTRINVTDSLDLTTL 16915

Query: 585   VIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNWEPP 643
              I    +DD G Y I + N  G+  ASI++  +D PDPP  P    +V  +   ++W PP
Sbjct: 16916 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPP 16975

Query: 644   AYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGIS 703
              Y GG  I  Y ++++   ++ W  ++  + + TT +  K+  G  Y+ RIFA N  G S
Sbjct: 16976 LYTGGCQITNYIVQKRDTTTTVWDVVSATVAR-TTLKVTKLKTGTEYQFRIFAENRYGQS 17034

Query: 704   KPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEG 760
               ++ S P V   P     PP      +++  ++ ++W  P + G + + GY LE     
Sbjct: 17035 F-ALESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLE----- 17088

Query: 761   STSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE 820
                  + + N           W   NK +I  T+F    L    +   RV A N  G  +
Sbjct: 17089 -----RKERNSIL--------WTKVNKTIIHDTQFKAQNLEEGIEYEFRVYAENIVGVGK 17135

Query: 821   PKYYSQPILVKEIIEPPKIRIPRHLKQTYI 850
                 S+  + ++  +PP    P  +K+  I
Sbjct: 17136 ASKNSECYVARDPCDPPGTPEPIMVKRNEI 17165



 Score =  131 bits (329), Expect = 4e-30
 Identities = 92/316 (29%), Positives = 146/316 (46%), Gaps = 25/316 (7%)

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPD 580
             PPK  LD     + VT+ AG+ L L+  + G+P PK +W++GDK  ++   ++  +    
Sbjct: 22671 PPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKE-LDLCEKVSLQYTGK 22729

Query: 581   SSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNW 640
              +T VI   +R DSG Y + +KN +G    S+ VKV+D P P    TV+ V  + C + W
Sbjct: 22730 RATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQEKCTLAW 22789

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
               P  DGG+ I  Y +ER++     W+ +  + C   ++   ++I+   Y  R+ AVN  
Sbjct: 22790 SLPQEDGGAEITHYIVERRETSRLNWVIVEGE-CPTLSYVVTRLIKNNEYIFRVRAVNKY 22848

Query: 701   GISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYC 757
             G   P + S P V      + SPP +          + ++W  P+  G   +  Y+++  
Sbjct: 22849 GPGVP-VESEPIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKR 22907

Query: 758   FEGSTSAKQSDENGEAAYDLPAEDWIVANKD-LIDKTKFTITGLPTDAKIFVRVKAVNAA 816
              + S                    W   NKD ++  T+  +T L        RV AVNAA
Sbjct: 22908 EKKSLR------------------WTRVNKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAA 22949

Query: 817   GASEPKYYSQPILVKE 832
             G SEP   S  I  +E
Sbjct: 22950 GNSEPSEASNFISCRE 22965



 Score =  130 bits (328), Expect = 5e-30
 Identities = 80/234 (34%), Positives = 120/234 (51%), Gaps = 8/234 (3%)

Query: 272  FVVELADPKLE-VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            F VEL  P ++ V+W KNG  +  + KY    KG    L I NC + D+S Y    G   
Sbjct: 2680 FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLG 2739

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S  L V    + + K+ +D TA     V  E  VS D   VKWF    EI P  K  +R
Sbjct: 2740 ASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDK--HR 2795

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            +  E K H L+++  + +DA EY+ +   GQ   K  + ++ L I   + +  V   K  
Sbjct: 2796 LVSERKVHKLMLQNISPSDAGEYTAVV--GQLECKAKLFVETLHITKTMKNIEVPETKTA 2853

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF 503
              +CE+S  N+P  W KNG+ ++ S++ K+V +G++H+L+I N  TED  +Y F
Sbjct: 2854 SFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF 2907



 Score =  130 bits (328), Expect = 5e-30
 Identities = 91/320 (28%), Positives = 147/320 (45%), Gaps = 24/320 (7%)

Query: 522   PKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDS 581
             P I+  G +  + + + +G  LR++  + G P P+  W + D   +E    +       S
Sbjct: 21583 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFK-DGVEIEKRMNMEITDVLGS 21641

Query: 582   STLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT-VTEVGDDWCIMNW 640
             ++L +  A RD  GVY +  KN +G A A IKVKV D P   V P   T +  +   + W
Sbjct: 21642 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWW 21701

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAI 700
             + P  DG +PI  Y IE+++     W  +  D C+  ++   K+I G  Y+ R+ AVN  
Sbjct: 21702 DAPLNDGCAPITHYIIEKRETSRLAWALIE-DKCEAQSYTAIKLINGNEYQFRVSAVNKF 21760

Query: 701   GISKP--SMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCF 758
             G+ +P  S P    +   V   P +    ++T  ++T+ W  P+  G + +  Y+LE   
Sbjct: 21761 GVGRPLDSDPVVAQIQYTVPDAPGIPEPSNITGNSITLTWARPESDGGSEIQQYILERRE 21820

Query: 759   EGSTSAKQSDENGEAAYDLPAEDWI-VANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG 817
             + ST                   W+ V +K  I +T+F +TGL    +    V A NAAG
Sbjct: 21821 KKSTR------------------WVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 21862

Query: 818   ASEPKYYSQPILVKEIIEPP 837
                    S+ I  +E + PP
Sbjct: 21863 VGPASGISRLIKCREPVNPP 21882



 Score =  128 bits (322), Expect = 3e-29
 Identities = 101/352 (28%), Positives = 164/352 (46%), Gaps = 15/352 (4%)

Query: 264  VDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYY 323
            V +G    FV EL+  K+ V W+KN  ++  S   +   +G    L +    + D S+  
Sbjct: 5213 VKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIK 5272

Query: 324  VTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIP 383
                +   + +L V E     T +L D TA   + + L+CEVS+ D  VKWFK+GEEI+P
Sbjct: 5273 AQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSK-DVPVKWFKDGEEIVP 5331

Query: 384  GPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQT 443
             PK  Y I+ +G + IL I+ A   D  EY       ++ A ++V+ + +K+  PL    
Sbjct: 5332 SPK--YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVE 5389

Query: 444  VNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV 502
            V +G+    + E+SE ++ G+W   G P+  S   +++  G+ H L++ N      G+  
Sbjct: 5390 VFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVS 5449

Query: 503  FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
            F   A N    A + V + P I +  L   + V V   ++ + E  +S E P    W +G
Sbjct: 5450 F--QAANAKSAANLKVKELPLIFITPL---SDVKVFEKDEAKFECEVSRE-PKTFRWLKG 5503

Query: 563  DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKV 614
             + I  G  R          ++VI  A  +D   Y      EA + H S K+
Sbjct: 5504 TQEI-TGDDRFELIKDGTKHSMVIKSAAFEDEAKYMF----EAEDKHTSGKL 5550



 Score =  127 bits (319), Expect = 6e-29
 Identities = 199/857 (23%), Positives = 322/857 (37%), Gaps = 121/857 (14%)

Query: 319   DSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAY-CGERVELECEV-SEDDANVKWFK 376
             DS   +TA DE       V  P I +  +  DT     GE   LE +V  +    ++W +
Sbjct: 17237 DSTGPITAKDE-------VELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLR 17289

Query: 377   NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL 436
               +EI     +R  I+    K +LI++ A + D  +Y +  +    S    V++K L   
Sbjct: 17290 GDKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRP 17347

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVVHKGRIHKL-------- 488
              P  +  V +      KC ++ + P +    G  +       VV K    +L        
Sbjct: 17348 GP-PEGPVQVTGVTSEKCSLTWSPPLQ--DGGSDISHY----VVEKRETSRLAWTVVASE 17400

Query: 489   VIANALTEDE----GDYVF---APDAYNVTLPAK-VHVIDPPKIILDGLDADNTVTVIAG 540
             V+ N+L   +     +YVF   A + Y V  P +   V+     +L G      VT IA 
Sbjct: 17401 VVTNSLKVTKLLEGNEYVFRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLEVTNIAK 17460

Query: 541   NKLRLEIPISGEPPPKAMWSRGDKA--------IMEGSGRIRTESYPDSSTLVIDIAER- 591
             + + +             W+R D          I+E   R        +   + D+  R 
Sbjct: 17461 DSMTV------------CWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRV 17508

Query: 592   -----DDSGVYHINLKNEAGEAH---ASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNW 640
                  D    + ++ +N AG      A++  K  D    P PP    + +   +   + W
Sbjct: 17509 TGLTEDHEYEFRVSAENAAGVGEPSPATVYYKACDPVFKPGPPTNAHIVDTTKNSITLAW 17568

Query: 641   EPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNA 699
               P YDGGS ILGY +E  K     W  +      + T FE  K+ E   Y++R+ A+N 
Sbjct: 17569 GKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGLRVTRFEISKLTEHQEYKIRVCALNK 17628

Query: 700   IGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             +G+ + +       P      P L  +DS     + +R        A G     + +   
Sbjct: 17629 VGLGEATSVPGTVKPEDKLEAPEL-DLDSELRKGIVVR--------AGGSARIHIPFKGR 17679

Query: 760   GSTSAKQSDENGEAAYDLPAEDWI------VANKDLIDKTKFTIT--GLPTDAKIFVRVK 811
              +     S E GE    +  E  +      + N D  D  K+ +           FV VK
Sbjct: 17680 PTPEITWSREEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVK 17739

Query: 812   AVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 871
              ++  G        Q + VKE+ +     +    +   I    +  N VI  +   R   
Sbjct: 17740 VLDTPGPP------QNLAVKEVRKDSAFLV---WEPPIIDGGAKVKNYVIDKRESTRK-- 17788

Query: 872   TWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDR 931
              +    ++  K    + N     I + R    +  G       V   VET    ++  + 
Sbjct: 17789 AYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFG-------VGVPVETVDA-VKAAEP 17840

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
             P PP  V + DV   + +L W  P+ DG + + GY ++   K + +W  V E     +A 
Sbjct: 17841 PSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAES-KVCNAV 17899

Query: 992   ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQ 1051
             +T L  G EY FRV + N  G S+   +     VIA+D  I              P    
Sbjct: 17900 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVP--VIAKDLTIQ-------------PSLKL 17944

Query: 1052  PLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPS 1110
             P  NTY+I AG +  +   V G P+P I+W+K+   +    R  +        L I++ +
Sbjct: 17945 PF-NTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGN 18003

Query: 1111  PYDGGTYCCKAVNDLGT 1127
               D G Y   A N  GT
Sbjct: 18004 KDDFGKYTVTATNSAGT 18020



 Score =  126 bits (316), Expect = 1e-28
 Identities = 125/552 (22%), Positives = 221/552 (40%), Gaps = 66/552 (11%)

Query: 597   YHINLKNEAG---EAHASIKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             Y +  +N AG    +  S  ++  D    P PP  P + + G     + W  P +DGG+P
Sbjct: 19683 YRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAP 19742

Query: 651   ILGYFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSR 710
             I GY +E KK   + W + +    + T +    +  G  Y  R+ +VN +G S PS  S 
Sbjct: 19743 ITGYTVEYKKSDDTDW-KTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSSD 19801

Query: 711   PFVPLAVTSPP----------TLLTVDSVTDT-TVTMRWRPPDHIGAAGLDGYVLEYCFE 759
             P +       P          TL+     + T TV  R RP  ++  +  D  +    + 
Sbjct: 19802 PQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYV 19861

Query: 760   GSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGAS 819
              +T ++ S         L  E+   AN++   K   TI  + + A + + VK ++  G  
Sbjct: 19862 DTTDSRTS---------LTIEN---ANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPP 19909

Query: 820   EPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAE 879
                     I V+++ +   +     L        G A       + +   +  W      
Sbjct: 19910 TN------ITVQDVTKESAV-----LSWDVPENDGGAPVKNYHIEKREASKKAWVSVTNN 19958

Query: 880   IDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVK 939
              ++    + N +   I + R      SG+ +  V +    ET    ++I ++P PP+ + 
Sbjct: 19959 CNRLSYKVTNLQEGAIYYFRV-----SGENEFGVGIP--AETKE-GVKITEKPSPPEKLG 20010

Query: 940   IEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF--TVIEHYHRTSATITELVI 997
             +  +  ++V+LTW  P+ DG + I  Y ++  +K    W    V +  H   + + E   
Sbjct: 20011 VTSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRE--- 20067

Query: 998   GNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTY 1057
              +EY+FRVF+EN  GLS+   +            +    + E  +  E  M   P    Y
Sbjct: 20068 NSEYFFRVFAENQAGLSDPREL------------LLPVLIKEQLEPPEIDMKNFPSHTVY 20115

Query: 1058  AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
               AG N  ++  + G P PK+T  ++ V +    R+         T+ +++    D G Y
Sbjct: 20116 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRY 20175

Query: 1118  CCKAVNDLGTVE 1129
                A N  GT +
Sbjct: 20176 EITAANSSGTTK 20187



 Score =  125 bits (315), Expect = 2e-28
 Identities = 87/266 (32%), Positives = 123/266 (46%), Gaps = 11/266 (4%)

Query: 247  EEKKSAAFAKIL--DPAYQV---DKGGRVRFVVEL---ADPKLEVKWYKNGQEIRPSTKY 298
            +E  S A  K+L  DP + V   DK    +  + L       + VKW+K+G+EI PS KY
Sbjct: 5276 KELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKY 5335

Query: 299  IFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGER 358
              +  G +RIL I    + D  EY    G +K    + V    I V K L     + GE 
Sbjct: 5336 SIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGET 5395

Query: 359  VELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTT 418
               E E+SE D + +W   G+ +   P     I  +GKKHILI+         E S    
Sbjct: 5396 AHFEIELSEPDVHGQWKLKGQPLTASPDC--EIIEDGKKHILILHNCQLGMTGEVSFQAA 5453

Query: 419  GGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRL 477
              +S+A L V   PL  +TPL+D  V    E   +CE+S E    +W K    +   DR 
Sbjct: 5454 NAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRF 5513

Query: 478  KVVHKGRIHKLVIANALTEDEGDYVF 503
            +++  G  H +VI +A  EDE  Y+F
Sbjct: 5514 ELIKDGTKHSMVIKSAAFEDEAKYMF 5539



 Score =  124 bits (312), Expect = 4e-28
 Identities = 135/548 (24%), Positives = 203/548 (37%), Gaps = 95/548 (17%)

Query: 620   PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETT 678
             P PP  P V +       ++W  PAYDGGSPI+GY +E K+  S  W+R N     ++T 
Sbjct: 13217 PGPPAFPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKTR 13276

Query: 679   FEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPP----------TLLTVDS 728
             FE   ++E   Y+ R++AVN IG S PS       P  +  PP          TL+    
Sbjct: 13277 FEVTGLMEDTQYQFRVYAVNKIGYSDPSDVPDKHYPKDILIPPEGELDADLRKTLILRAG 13336

Query: 729   VTDTT-VTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANK 787
             VT    V ++ RPP                                    P   W   N 
Sbjct: 13337 VTMRLYVPVKGRPP------------------------------------PKITWSKPNV 13360

Query: 788   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASE----------PKYYSQPILVKEIIEPP 837
             +L D+    I    TD   F+R + VN   A +           K Y+  + V +   PP
Sbjct: 13361 NLRDRIGLDIKS--TDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPP 13418

Query: 838   -KIRIPRHLKQT--------YIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIR 888
               + +    K +         I      +N V+  Q +     +W     E  K    + 
Sbjct: 13419 VNVTVKEISKDSAYVTWEPPIIDGGSPIINYVV--QKRDAERKSWSTVTTECSKTSFRVA 13476

Query: 889   NSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENV 948
             N E     F R    +  G  D     D         ++    PGP   +K+  V   + 
Sbjct: 13477 NLEEGKSYFFRVFAENEYGIGDPGETRDA--------VKASQTPGPVVDLKVRSVSKSSC 13528

Query: 949   ALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSE 1008
             ++ W  P  DG + I GY +    +++ +W  V++       +  +L  G EY FRV +E
Sbjct: 13529 SIGWKKPHSDGGSRIIGYVVDFLTEEN-KWQRVMKSLS-LQYSAKDLTEGKEYTFRVSAE 13586

Query: 1009  NMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNC 1068
             N  G    + +T    V+ARD     + V  D D    P          A    N  L  
Sbjct: 13587 NENGEGTPSEIT----VVARD-----DVVAPDLDLKGLPDLCY-----LAKENSNFRLKI 13632

Query: 1069  SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTV 1128
              ++G P P ++W K +  +  D R  + S+    TL +      D G Y     N  GT 
Sbjct: 13633 PIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 13692

Query: 1129  EIECKLEV 1136
             E    ++V
Sbjct: 13693 EGTISIKV 13700



 Score =  120 bits (301), Expect = 7e-27
 Identities = 130/513 (25%), Positives = 208/513 (40%), Gaps = 41/513 (7%)

Query: 96   KGKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSF 155
            KG+W+    + GKHL L       S  +   + I   K +  G Y    TYK      S 
Sbjct: 2603 KGEWL----RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSA 2654

Query: 156  DLEVH--ESTGTTPNIDIRSAFKRSGEGQEDAGELDFSGLLKRREVKQQEEEPQVDVWEL 213
             L+V   +   T  N+ +          +     +     +K   V +  E+  + V   
Sbjct: 2655 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV--- 2711

Query: 214  LKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVD--KGGRVR 271
                K + Y        I D      RL R+    +      KI+     V   +   V 
Sbjct: 2712 ----KGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVA 2767

Query: 272  FVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKC 331
            F V ++   + VKW+    EI+PS K+    +     L + N   +D  EY    G  +C
Sbjct: 2768 FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLEC 2827

Query: 332  STELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRI 391
              +LFV    + +TK +++      +    ECEVS  +    W KNG EI    K  ++I
Sbjct: 2828 KAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK--FKI 2883

Query: 392  RVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC 451
             V+GK H LII   +  D+AEY+ +    Q SA L+V   P+ I + L D  +N  ++  
Sbjct: 2884 VVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMITSMLKD--INAEEKDT 2939

Query: 452  LKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPD-- 506
            +  E++ N  G   KW KNG+ ++ +D+ ++  K   H L I N    D  DY F     
Sbjct: 2940 ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKA 2999

Query: 507  AYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAI 566
                TL  +   I+  K I D       + V+   +   E  +S EP     W + D+  
Sbjct: 3000 TSTATLYVEARHIEFRKHIKD-------IKVLEKKRAMFECEVS-EPDITVQWMKDDQE- 3050

Query: 567  MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHI 599
            ++ + RI+ +       L+I      D+G Y +
Sbjct: 3051 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV 3083



 Score =  120 bits (301), Expect = 7e-27
 Identities = 89/317 (28%), Positives = 143/317 (45%), Gaps = 11/317 (3%)

Query: 256  KILDPAYQVD--KGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINN 313
            K++ P + V+  +    RF  E+++  +   W   G+ +  +     + +G    L ++N
Sbjct: 5736 KLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHN 5795

Query: 314  CQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVK 373
            C++         A + K S  L V+   I + + L+D T   GE    +CE+S +D  V+
Sbjct: 5796 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 5855

Query: 374  WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPL 433
            W+  G+++ P  K     R EGK H L +      DA E  +     ++ A L V   P+
Sbjct: 5856 WYLKGKKLEPSDK--VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPV 5913

Query: 434  KILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
            +   PL DQTV  G    L+CE+S EN   KW KNG  + +S + ++V  GR+ KLVI +
Sbjct: 5914 EFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHD 5973

Query: 493  ALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGE 552
               ED   Y    DA +      ++V+ P    L  L     + V      R E  +S E
Sbjct: 5974 CTPEDIKTYTC--DAKDFKTSCNLNVVPPHVEFLRPL---TDLQVREKEMARFECELSRE 6028

Query: 553  PPPKAMWSRGDKAIMEG 569
               K  W +    I +G
Sbjct: 6029 -NAKVKWFKDGAEIKKG 6044



 Score =  120 bits (301), Expect = 7e-27
 Identities = 124/479 (25%), Positives = 201/479 (41%), Gaps = 76/479 (15%)

Query: 463   KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY--VFAPDAYNVTLPAKVHVID 520
             KWTK G  +  S R  +       +LVI  A   D G Y  V         +  KV VI 
Sbjct: 23797 KWTKEGQDI--SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIG 23854

Query: 521   PPKIILDGLDADNTVTVIAGNKLRLEIPISGEPP------------------PKAMWSRG 562
              P      L+ D+             + +S  PP                  PKA W   
Sbjct: 23855 SPNSPEGPLEYDDIQV--------RSVRVSWRPPADDGGADILGYILERREVPKAAWYTI 23906

Query: 563   DKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG-----EAHASIKVKV- 616
             D        R+R       ++LV+   + +    + ++ +N+ G     ++   +  K  
Sbjct: 23907 DS-------RVR------GTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTP 23953

Query: 617   VDFPDPPV-APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCK 675
             ++ P+PP   P V +V      ++W  P  DGGS + GY+IERK+  + +W+R N     
Sbjct: 23954 LNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQIT 24013

Query: 676   ETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFV---PLAVTSPPTLLTVDSVTDT 732
              T +    ++    Y+ RI A N +G+S+ S  S P V   P    S P  L + S++  
Sbjct: 24014 TTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISKD 24073

Query: 733   TVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDK 792
             +VT++W  P+  G   + GY +EY            ++G++A       W  +NK+ I  
Sbjct: 24074 SVTLQWEKPECDGGKEILGYWVEY-----------RQSGDSA-------WKKSNKERIKD 24115

Query: 793   TKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEII-EPPKIRIPRHLKQTYIR 851
              +FTI GL    +   RV A N  G S P+  +  I  K    E P IR  + +K     
Sbjct: 24116 KQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIR--KEMKDV-TT 24172

Query: 852   RVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDT-IIFIRKAERSHSGKY 909
             ++GEA  L     G+P P++ W + G E+ +++    +S+  T  + +   E+   G Y
Sbjct: 24173 KLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVY 24231



 Score =  118 bits (295), Expect = 4e-26
 Identities = 143/575 (24%), Positives = 215/575 (37%), Gaps = 93/575 (16%)

Query: 597   YHINLKNEAGEAHASIKVKVVDF------PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSP 650
             + ++ +NE G    S   K V        P PPV P   +   +   + W+PP +DGGS 
Sbjct: 10712 FRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSK 10771

Query: 651   ILGYFIERKKKQSSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMP 708
             ILGY +E +K     W R N   + C ET ++   + +G  Y+ R+ AVNA G S P+  
Sbjct: 10772 ILGYIVEYQKVGDEEWRRANHTPESCPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHV 10831

Query: 709   SRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSD 768
               P +      PP L     + D  +        HI     D   L    +G        
Sbjct: 10832 PEPVLVKDRLEPPEL-----ILDANMARE----QHIKVG--DTLRLSAIIKG-------- 10872

Query: 769   ENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAG----ASEPKYY 824
                      P   W   ++D   K +  +T  P  +K+ +R  A    G      E    
Sbjct: 10873 ------VPFPKVTWKKEDRDAPTKARIDVT--PVGSKLEIRNAAHEDGGIYSLTVENPAG 10924

Query: 825   SQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKK---DGAEID 881
             S+ + VK ++   K   PR L+ + IR              K    LTWK+   DG  + 
Sbjct: 10925 SKTVSVKVLVLD-KPGPPRDLEVSEIR--------------KDSCYLTWKEPLDDGGSVI 10969

Query: 882   KNQINIRNSETD---TIIFIRKAERSHSGKY-------------DLQVKVDKFVETASID 925
              N +  R        + +     ++SH  K+             + Q     FVET    
Sbjct: 10970 TNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPK-P 11028

Query: 926   IQIIDR---PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVI 982
             I+ +D    PGPP+ +   DV    V+L W  P  DG + ITGY ++  ++ + +W    
Sbjct: 11029 IKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIK-F 11087

Query: 983   EHYHRTSATITELVIGNEYYFRVFSENMCGLS-EDATMTKESAVIARDGKIYKNPVYEDF 1041
             +        +T L  G  Y FRV +EN+ GL   D T+  E        K+    V  D 
Sbjct: 11088 KTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIEC-----QEKLVPPSVELDV 11142

Query: 1042  DFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGV 1101
                E  +           AG        +RG P P   W  +   I  D  Y + ++   
Sbjct: 11143 KLIEGLVVK---------AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 11193

Query: 1102  CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               L I+     D G Y     N  G+  +   L V
Sbjct: 11194 SVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11228



 Score =  116 bits (290), Expect = 1e-25
 Identities = 185/884 (20%), Positives = 323/884 (36%), Gaps = 156/884 (17%)

Query: 313   NCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDA 370
             N     DS   +TA DE       +  P   +  + +D    + GE   LE ++  +   
Sbjct: 18313 NFSEPSDSSGAITARDE-------IDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIP 18365

Query: 371   NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEY--SVMTTGGQSSAKLSV 428
             +V W K+G+E+     +R  I+   +K  L+++   + D  +Y   +   GG  S  ++V
Sbjct: 18366 DVVWSKDGKEL-EETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITV 18424

Query: 429   DLK--------PLKIL------------TPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
              +         PLK+              PL D   N+   I  K E S      WT+  
Sbjct: 18425 KVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL---SWTQVS 18481

Query: 469   LPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVHVID----- 520
               VQ  +        ++ KL+  N       +Y+F   A + Y +  P +   +      
Sbjct: 18482 TEVQALNY-------KVTKLLPGN-------EYIFRVMAVNKYGIGEPLESGPVTACNPY 18527

Query: 521   -----PPKIILDGLDADNTVTVIA------GNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
                  P    +  +  D+ V   A      G ++   I +         W++ +K  +  
Sbjct: 18528 KPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYI-LEKRDKEGVRWTKCNKKTLTD 18586

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGE-AHASIKVKVVDF---PDPPVA 625
               R+R     +  +    +A  + +GV         GE +  S+  +  D    P PP  
Sbjct: 18587 L-RLRVTGLTEGHSYEFRVAAENAAGV---------GEPSEPSVFYRACDALYPPGPPSN 18636

Query: 626   PTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETT------F 679
             P VT+       + W  P YDGG+P+ GY +E K+  +  W       C   T      F
Sbjct: 18637 PKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTT-----CTPPTGLQGKQF 18691

Query: 680   EPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTL-----------LTVDS 728
                K+ E   Y  RI A+N+ G+ +P+      V      PP +           L   +
Sbjct: 18692 TVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASA 18751

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
                  VT++ RP   +     +G + +      TS+                  ++ N  
Sbjct: 18752 TLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVTSSFTM--------------LVIDNVT 18797

Query: 789   LIDKTKFTIT--GLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLK 846
               D  ++ +T          FV V+ +++  A        P+ +  I E  K  +    +
Sbjct: 18798 RFDSGRYNLTLENNSGSKTAFVNVRVLDSPSA--------PVNLT-IREVKKDSVTLSWE 18848

Query: 847   QTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHS 906
                I    +  N ++  +   R       +     K    I N +     + R      S
Sbjct: 18849 PPLIDGGAKITNYIVEKRETTRKAYATITNNCT--KTTFRIENLQEGCSYYFRVLA---S 18903

Query: 907   GKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY 966
              +Y + +  +      +  +++ + P PP  V + DV      + W  P+ DG + ITGY
Sbjct: 18904 NEYGIGLPAE-----TTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGY 18958

Query: 967   TIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVI 1026
              ++   K S +W T  +      ATI+ L  G EY FRV + N  G S+   +     VI
Sbjct: 18959 VVEMQTKGSEKWSTCTQ-VKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVP--VI 19015

Query: 1027  ARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVA 1086
             ARD +I              P    P       A     ++   +G P+  + W K+   
Sbjct: 19016 ARDIEI-------------KPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQT 19062

Query: 1087  IVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEI 1130
             + +  R  + S++ V +L I++ S  D GTY     N  G++ +
Sbjct: 19063 LKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSITV 19106



 Score =  115 bits (288), Expect = 2e-25
 Identities = 180/802 (22%), Positives = 307/802 (38%), Gaps = 107/802 (13%)

Query: 373   KWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKP 432
             KW  +G EI       Y +  +    +L I+   + D  EY +  +    S  ++V L  
Sbjct: 11171 KWTTDGSEI--KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11228

Query: 433   LKILTPLTDQTVNLG---KEICLKCEISENIPGKWTKNGLPVQESDRLK----VVHKGRI 485
             L +  P T     L    + + +  +  ++  G    N + V++ D  K    VV  G  
Sbjct: 11229 LDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSPVINYI-VEKQDTRKDTWGVVSSGSS 11287

Query: 486   H-KLVIANALTEDEGDYVFAPDAYNV---------TLPAKVHVIDPPKIILDGLDADNTV 535
               KL I +   +   +YVF   A N          T     H   PP            V
Sbjct: 11288 KTKLKIPHL--QKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSP-----PGKPVV 11340

Query: 536   TVIAGNKLRLE--IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERD- 592
             T I  N   +   +P S    P   +    + +     R+      D    V  + E + 
Sbjct: 11341 TDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKTPIADLKFRVTGLYEGNT 11400

Query: 593   -DSGVYHINLKNEAGEAHASIKVKV---VDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGG 648
              +  V+  NL   +  + +S  +K    +  P PP+ P + +   +   + W  P  DGG
Sbjct: 11401 YEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPKLKDKSRETADLVWTKPLSDGG 11460

Query: 649   SPILGYFIERKKKQSSRWMRLNFD-LCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSM 707
             SPILGY +E +K  +++W R+N D L ++  F    +IEG  Y  RI A N +G  +P  
Sbjct: 11461 SPILGYVVECQKPGTAQWNRINKDELIRQCAFRVPGLIEGNEYRFRIKAANIVGEGEPRE 11520

Query: 708   PSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAA--GLDGYVLEYCFEGSTSAK 765
              +   +   +  PP +  +D      +T+R      I A   G     + +  EG    +
Sbjct: 11521 LAESVIAKDILHPPEV-ELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVR 11579

Query: 766   QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
             +  +  +   DLP  +  +      D  K+ I+             A N++G      ++
Sbjct: 11580 E--KRVDLIQDLPRVELQIKEAVRADHGKYIIS-------------AKNSSG------HA 11618

Query: 826   QPILVKEIIEPPKIRIPRHLKQTYIRRVG--------------EAVNLVIPFQGKPRPEL 871
             Q   +  +++ P     ++LK T + +                E  N ++ ++ KP  + 
Sbjct: 11619 QGSAIVNVLDRPGPC--QNLKVTNVTKENCTISWENPLDNGGSEITNFIVEYR-KPNQK- 11674

Query: 872   TWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--IDIQII 929
              W    +++ K  I       +   F   AE         +V V   +ET +  + I  I
Sbjct: 11675 GWSIVASDVTKRLIKANLLANNEYYFRVCAEN--------KVGVGPTIETKTPILAINPI 11726

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             DRPG P+ + I D     V L W  P  DG +    Y +++  K S +W  V +   + +
Sbjct: 11727 DRPGEPENLHIADKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKET 11786

Query: 990   ATITELVIGNEYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPM 1048
               + +  + N+ Y FRV ++N  G S+   +  E  V+  D               + P+
Sbjct: 11787 HYMVDRCVENQIYEFRVQTKNEGGESD--WVKTEEVVVKED--------------LQKPV 11830

Query: 1049  FTQPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVA--IVDDPRYRMFSNQGVCTLE 1105
                 L     + AG    L   VRG P P++ W K+K A  +   PR ++ +        
Sbjct: 11831 LDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFS 11890

Query: 1106  IRKPSPYDGGTYCCKAVNDLGT 1127
             + K    DGG Y   A N  G+
Sbjct: 11891 LTKAKRSDGGKYVVTATNTAGS 11912



 Score =  115 bits (288), Expect = 2e-25
 Identities = 190/873 (21%), Positives = 328/873 (37%), Gaps = 153/873 (17%)

Query: 324   VTAGDEKCSTELFVREPPIMVTKQLEDT-TAYCGERVELECEV-SEDDANVKWFKNGEEI 381
             +TA DE       V  P I +  + +DT   + GE  +++ ++  +    ++W K  +E+
Sbjct: 16160 ITARDE-------VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL 16212

Query: 382   IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
                  +R  I+       L ++ A + D+  Y +          ++V++K L    P   
Sbjct: 16213 --SNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 16270

Query: 442   QTVNLGKEICLKCEISENIPGKWTKNGLPVQE--SDRLKVVHKGR-----IHKLVIANAL 494
               V  G     KC ++      W     P+Q+  SD +  + + R     +  +V AN  
Sbjct: 16271 PVVISGVT-AEKCTLA------WKP---PLQDGGSDIINYIVERRETSRLVWTVVDANVQ 16320

Query: 495   TED-------EG-DYVF---APDAYNVTLPAKVH--VIDPPKIILDGLDADNTVTVIAGN 541
             T         EG +Y F   A + Y V  P +    V   P ++ D   A    TV   +
Sbjct: 16321 TLSCKVTKLLEGNEYTFRIMAVNKYGVGEPLESEPVVAKNPFVVPDAPKAPEVTTVTKDS 16380

Query: 542   KLRL-EIPISG------------EPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDI 588
              + + E P S                    W+R  K ++ G  R+R          V  +
Sbjct: 16381 MIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLI-GELRLR----------VTGL 16429

Query: 589   AERDDSGVYHINLKNEAGEAHAS---IKVKVVD---FPDPPVAPTVTEVGDDWCIMNWEP 642
              E  D   + ++ +N AG +  S      K  D    P PP  P V ++      ++W  
Sbjct: 16430 IENHDYE-FRVSAENAAGLSEPSPPSAYQKACDPIYKPGPPNNPKVIDITRSSVFLSWSK 16488

Query: 643   PAYDGGSPILGYFIERKKKQSSRWMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIG 701
             P YDGG  I GY +E+       W          +T  E +K++E   Y  RI A+N  G
Sbjct: 16489 PIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINKTNIEVEKLLEKHEYNFRICAINKAG 16548

Query: 702   ISKPSMPSRPFVPLAVTSPPTL-----------LTVDSVTDTTVTMRWRPPDHIGAAGLD 750
             + + +    P +       P +           +         V ++ RP   +    +D
Sbjct: 16549 VGEHADVPGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVD 16608

Query: 751   GYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTIT--GLPTDAKIFV 808
             G + +      TS+  S               ++ N +  D  K+T+T          FV
Sbjct: 16609 GEIRDAAIIDVTSSFTS--------------LVLDNVNRYDSGKYTLTLENSSGTKSAFV 16654

Query: 809   RVKAVNAAGASEPKYYSQPILVKEII----EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ 864
              V+ ++    S P       + K+ +    EPP +     +K   + +            
Sbjct: 16655 TVRVLDTP--SPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYIVEK------------ 16700

Query: 865   GKPRPELTWKKDGAEID---KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
                  E T K   A +    KN   I   +     + R    +  G       +    +T
Sbjct: 16701 ----REATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYG-------IGLPAQT 16749

Query: 922   ASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 981
             A   I++ + P PP  + ++DV   +V+L+WT P+ DG + I  Y ++   K S +W + 
Sbjct: 16750 AD-PIKVAEVPQPPGKITVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKW-SE 16807

Query: 982   IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDF 1041
                     A IT L  G EY FRV + N  G S+  ++     ++A+D  I  +      
Sbjct: 16808 CARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVP--IVAKDLVIEPD------ 16859

Query: 1042  DFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1100
                      +P  ++Y++  G +  +   + G PKP ITW K+ + +    R  +  +  
Sbjct: 16860 --------VKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLD 16911

Query: 1101  VCTLEIRKPSPYDGGTYCCKAVNDLG--TVEIE 1131
             + TL I++    DGG Y     N +G  T  IE
Sbjct: 16912 LTTLSIKETHKDDGGQYGITVANVVGQKTASIE 16944



 Score =  115 bits (287), Expect = 3e-25
 Identities = 101/370 (27%), Positives = 158/370 (42%), Gaps = 34/370 (9%)

Query: 266  KGGRVRFVVELAD-----------------PKLEVKWYKNGQEIRPSTKYIFEHKGCQRI 308
            +G  V FV EL D                   +E KWY N  E++ + KY    +  ++ 
Sbjct: 2217 EGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQN 2276

Query: 309  LFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSED 368
            L + +    D  EY      +K + +L ++  PI + + L D     G+ V+LE +VS +
Sbjct: 2277 LTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLE 2336

Query: 369  DANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSV 428
                 W K+G+E+   P  R  I ++ + H+L+IE  TK DA  YS        S    V
Sbjct: 2337 SVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRV 2394

Query: 429  DLKPLKILTPLTDQTVNLGKEICLKCEIS--ENIPGKWTKNGLPVQESDRLKVVHKGRIH 486
             +  + ++TPL D  V  G +  L+C++S  +    KW  N   ++  DR++ + KG   
Sbjct: 2395 SVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQ 2454

Query: 487  KLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLE 546
            +LVI      DEG Y              V  I     I+ GL  D T T        +E
Sbjct: 2455 RLVINRTHASDEGPYKLIVGRVETNCNLSVEKIK----IIRGL-RDLTCTETQNVVFEVE 2509

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAG 606
            +  SG      +W+  DK I + S + + E++     L +    +DD G Y       AG
Sbjct: 2510 LSHSG---IDVLWNFKDKEI-KPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAG 2561

Query: 607  EAHASIKVKV 616
            E   S K+ V
Sbjct: 2562 ENMTSGKLTV 2571



 Score =  110 bits (276), Expect = 6e-24
 Identities = 178/830 (21%), Positives = 319/830 (38%), Gaps = 108/830 (13%)

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADA 410
             T   G  + L+  V  + +  + W K  +E+    K    ++  GK+   +I+   ++D+
Sbjct: 22686 TIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK--VSLQYTGKRATAVIKFCDRSDS 22743

Query: 411   AEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIP-----GKWT 465
              +Y++       +  +SV +K L    P    TV+   +   KC ++ ++P      + T
Sbjct: 22744 GKYTLTVKNASGTKAVSVMVKVLDSPGPCGKLTVSRVTQE--KCTLAWSLPQEDGGAEIT 22801

Query: 466   KNGLPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH---- 517
                +  +E+ RL  V+ +G    L           +Y+F   A + Y   +P +      
Sbjct: 22802 HYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVA 22861

Query: 518   ----VIDPPKIILDGLDADNTVTVI--------AGNKLRLEIPISGEPPPKAMWSRGDKA 565
                  I  P  I + +       +I         GN++   + +         W+R +K 
Sbjct: 22862 RNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYL-VDKREKKSLRWTRVNKD 22920

Query: 566   IMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDF-PDPPV 624
              +    R++  S  +       +   + +G       +E  EA   I  +   + P PP 
Sbjct: 22921 YVVYDTRLKVTSLMEGCDYQFRVTAVNAAG------NSEPSEASNFISCREPSYTPGPPS 22974

Query: 625   APTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLC-KETTFEPKK 683
             AP V +       + W  P YDGG+ I+GY +E ++K + +W R++ +   + T F    
Sbjct: 22975 APRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPD 23034

Query: 684   MIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDH 743
             +  G  Y  R+ AVN  G+S+ S       P+     P L   D +  T VT+R      
Sbjct: 23035 LKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKT-VTIRAGASLR 23093

Query: 744   --IGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLP 801
               +  +G    V+ +  +G   A ++  +   +Y L     IV   +  D  K+TI    
Sbjct: 23094 LMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL----LIVDKVNRYDAGKYTI---- 23145

Query: 802   TDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTY-----IRRV 853
                      +A N +G       S  +LVK    P   P +++    + +      I  +
Sbjct: 23146 ---------EAENQSGKK-----SATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTI 23191

Query: 854   --GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDL 911
               G  VN  I  + +      +K    +  K    I      T+ + R    +  G    
Sbjct: 23192 DGGAPVNNYI-VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYG---- 23246

Query: 912   QVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKA 971
                + +  ET+   + + + P  P  +++ DV    V L W  P  DG + +TGY ++  
Sbjct: 23247 ---IGEPCETSDA-VLVSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEAC 23302

Query: 972   DKKSMEWF-------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESA 1024
                +  W        TV+EH      T+T L  G +Y FR+ ++N  G+SE       +A
Sbjct: 23303 KAGTERWMKVVTLKPTVLEH------TVTSLNEGEQYLFRIRAQNEKGVSEPRETV--TA 23354

Query: 1025  VIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNK 1084
             V  +D ++         D S     T P    +  AG    L   + G P P  +W    
Sbjct: 23355 VTVQDLRVLPT-----IDLS-----TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAG 23404

Query: 1085  VAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
               + +  R  + ++  V  L IR+ +  D G Y  +  N  GT     K+
Sbjct: 23405 SKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKV 23454



 Score =  110 bits (275), Expect = 8e-24
 Identities = 93/366 (25%), Positives = 162/366 (44%), Gaps = 18/366 (4%)

Query: 269  RVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGD 328
            R  F  E+++P + V+W K+ QE++ + +   + +     L I + +M+D  +Y V AG 
Sbjct: 3028 RAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG 3087

Query: 329  EKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSR 388
               + +LFV    + +    ++      +R  +E EV+EDD +  W+K+G EI    + R
Sbjct: 3088 NVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER 3147

Query: 389  YRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDL-KPLKILTPLTDQTVNLG 447
            ++  VE + H + I    ++DA EY+ +    +SS  L V+  +P ++L  L   TV  G
Sbjct: 3148 HKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSG 3207

Query: 448  KEICLKCEISENIPGK--WTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVF-A 504
            K       IS     K  W K    +    + K +H G+ + L++  A  ED   Y   A
Sbjct: 3208 KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEA 3267

Query: 505  PDAYNVTLPAKVHVIDPPKIILDGLD-----------ADNTVTVIAGNKLRLEIPISGEP 553
             + Y V   +    ++ P+++    +             +TVT   G   R +  +SG  
Sbjct: 3268 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVT-SEGQPARFQCRVSG-T 3325

Query: 554  PPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIK 613
              K  W   DK I + S   R   + D+  L I  A  +D G Y     N  G+  ++  
Sbjct: 3326 DLKVSWYSKDKKI-KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3384

Query: 614  VKVVDF 619
            + +  F
Sbjct: 3385 LSLEGF 3390



 Score =  108 bits (270), Expect = 3e-23
 Identities = 103/437 (23%), Positives = 169/437 (38%), Gaps = 53/437 (12%)

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLP 778
             SP   L  D +   +V + WRPP   G A + GY+LE                    ++P
Sbjct: 23858 SPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILE------------------RREVP 23899

Query: 779   AEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPK 838
                W   +   +  T   + GL  + +   RV A N  G S+P    +P+  K  + PP+
Sbjct: 23900 KAAWYTIDSR-VRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPE 23958

Query: 839   IRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQIN----IRNSETD- 893
                P       +     +V+L      +P+ +   +  G  I++ + +    +R+++T  
Sbjct: 23959 ---PPSNPPEVLDVTKSSVSLS---WSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQI 24012

Query: 894   TIIFIRKAERSHSGKYDLQVKVDKFV---ETASIDIQII-----DRPGPPQIVKIEDVWG 945
             T             +Y  ++     V   ET+     ++     D+P  P  ++I  +  
Sbjct: 24013 TTTMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGELEILSISK 24072

Query: 946   ENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-TVIEHYHRTSATITELVIGNEYYFR 1004
             ++V L W  P+ DG   I GY ++        W  +  E       TI  L+   EY FR
Sbjct: 24073 DSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFR 24132

Query: 1005  VFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNA 1064
             VF+EN  GLS               G              EAP   + + +     G  A
Sbjct: 24133 VFAENETGLSRPRRTAMSIKTKLTSG--------------EAPGIRKEMKDVTTKLGEAA 24178

Query: 1065  TLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVND 1124
              L+C + G P P I W +    ++   +Y+M S+    TL +      D G Y C A N+
Sbjct: 24179 QLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNE 24238

Query: 1125  LGTVEIECKLEVKVIAQ 1141
             +G VE   KL ++   Q
Sbjct: 24239 VGEVETSSKLLLQATPQ 24255



 Score =  107 bits (268), Expect = 5e-23
 Identities = 123/468 (26%), Positives = 198/468 (42%), Gaps = 56/468 (11%)

Query: 196  RREVKQQEEE---PQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKRMRREEKKSA 252
            R + K++ EE     +   EL    K   YE++  +        +L   K +  EEKK+ 
Sbjct: 1952 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRK----TKDELLHWTKELTEEEKKAL 2007

Query: 253  AF-AKILDPAYQVDK-----------------------GGRVRFVVELAD-PKLEVKWYK 287
            A   KI  P ++ DK                       G    F V +   P  E +WYK
Sbjct: 2008 AEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYK 2067

Query: 288  NGQEIRPSTK---YIFEHKGCQRILFINNCQMTDDSEYYV----TAGDEKCSTELFVREP 340
            NG +I  S +   Y  E   C+  L I +    D +   V     AG+      L V+  
Sbjct: 2068 NGVKIERSDRIYWYWPEDNVCE--LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2125

Query: 341  PIMV-TKQLEDTTAYCGERV-ELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             ++  T++L+D  A   + +   ECE SE    VKW+K+G E+  G K  YR+  + K H
Sbjct: 2126 QLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK--YRMHSDRKVH 2183

Query: 399  ILIIEGATKADAAEYS---VMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCE 455
             L I     +DA +YS   V     +++AKL V+   ++ +  L D  V       L+C 
Sbjct: 2184 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 456  IS-ENIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPA 514
            +S ENI GKW  N + ++ + +  +  +     L + +   ED+G+Y F  D    T   
Sbjct: 2244 VSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT--C 2301

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIR 574
            K+ +   P  IL GL       V  G+ ++LE+ +S E   + +W + D   ++ S R+ 
Sbjct: 2302 KLKMKPRPIAILQGLSDQK---VCEGDIVQLEVKVSLE-SVEGVWMK-DGQEVQPSDRVH 2356

Query: 575  TESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDP 622
                  S  L+I+   ++D+G Y   +          + V  VD   P
Sbjct: 2357 IVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITP 2404



 Score =  107 bits (266), Expect = 8e-23
 Identities = 171/808 (21%), Positives = 305/808 (37%), Gaps = 106/808 (13%)

Query: 356   GERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHI--LIIEGATKADAAE 412
             G  V+L   +S   A  ++W+K+ +E+    ++   + VE    +  ++I+ A + ++  
Sbjct: 20515 GTSVKLRAGISGKPAPTIEWYKDDKEL----QTNALVCVENTTDLASILIKDADRLNSGC 20570

Query: 413   YSVMTTGGQSSAKLSVDL----KPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNG 468
             Y +       SA  ++ +    KP     P+  +TV   K   L    +++   K T   
Sbjct: 20571 YELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGGAKITHYI 20630

Query: 469   LPVQESDRLK-VVHKGRIHKLVIANALTEDEGDYVF---APDAYNVTLPAKVH-VIDPPK 523
             +  +E+ R+   +    + + +I         +Y+F   A + Y +  P +   V+    
Sbjct: 20631 VEKRETSRVVWSMVSEHLEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNA 20690

Query: 524   IILDGLDADNTVTVIAGNKLRL----EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYP 579
              +  G      VT I  N + +     I   G         + DK  + G  ++  E+  
Sbjct: 20691 FVTPGPPGIPEVTKITKNSMTVVWSRPIADGGSDISGYFLEKRDKKSL-GWFKVLKETIR 20749

Query: 580   DSSTLVIDIAERDDSGVYHINLKNEAGE---AHASIKVKVVDFPDPPVAPTVTEVGDDW- 635
             D+   V  + E  D   Y +   N AG+   +  S   K  D  DPP  P    + D   
Sbjct: 20750 DTRQKVTGLTENSDYQ-YRVCAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIADSTK 20808

Query: 636   --CIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNF-DLCKETTFEPKKMIEGVAYEV 692
                 + W  P YDGGS + GY +E ++ +   W  ++     + T +    +  GV Y  
Sbjct: 20809 SSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYF 20868

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R+ AVN  G  +P   + P     +   P +       D  V +R      I  AG D  
Sbjct: 20869 RVSAVNCAGQGEPIEMNEPVQAKDILEAPEI-------DLDVALR---TSVIAKAGEDVQ 20918

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             VL   F+G                 P   W    K+L    +++I    TD+   + +  
Sbjct: 20919 VL-IPFKGRPP--------------PTVTWRKDEKNLGSDARYSIEN--TDSSSLLTIPQ 20961

Query: 813   VN-----------AAGASEPKYYSQPILVKEIIEP---PKIRIPRHLKQTYIRRVGE--- 855
             V              G  EPK  S  + VK +  P    K+++ +H+ +  +  + +   
Sbjct: 20962 VTRNDTGKYILTIENGVGEPK--SSTVSVKVLDTPAACQKLQV-KHVSRGTVTLLWDPPL 21018

Query: 856   ------AVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKY 909
                    +N VI  + +   + TW     +       + +    T  F R    +  G  
Sbjct: 21019 IDGGSPIINYVI--EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIG-- 21074

Query: 910   DLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
                  + +  ET    ++  + P P + + ++D    +V L+WT P  DG + IT Y ++
Sbjct: 21075 -----IGEPCETTE-PVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVE 21128

Query: 970   KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
             +  K    W +           +++L   +   FRVF++N  GLS+  T+          
Sbjct: 21129 RKGKGEQTW-SHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTI---------- 21177

Query: 1030  GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
             G I    V E     E  +   P        G+N  L    +G PKP I+W+K+ + + +
Sbjct: 21178 GPI---TVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 21234

Query: 1090  DPRYRMFSNQGVCTLEIRKPSPYDGGTY 1117
                 R    +   TL I+      GG Y
Sbjct: 21235 SEFVRFSKTENKITLSIKNAKKEHGGKY 21262



 Score =  106 bits (265), Expect = 1e-22
 Identities = 117/456 (25%), Positives = 185/456 (40%), Gaps = 83/456 (18%)

Query: 597   YHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFI 656
             Y +N    +  + AS  +   +  D P  P VT+V      + W  PAYDGGS ++GY I
Sbjct: 22544 YALNAAGVSKASEASRPIMAQNPVDAPGRPEVTDVTRSTVSLIWSAPAYDGGSKVVGYII 22603

Query: 657   ERK---KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPF 712
             ERK   +    RW++ N+ +  +  F    + EG  YE R+ A NA G ISK S  + P 
Sbjct: 22604 ERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGDTYEFRVLAKNAAGVISKGSESTGPV 22663

Query: 713   VPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGE 772
                   +PP       +    VT+R         AG D  VL+    G    K     G+
Sbjct: 22664 TCRDEYAPPKAELDARLHGDLVTIR---------AGSD-LVLDAAVGGKPEPKIIWTKGD 22713

Query: 773   AAYDL----------PAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPK 822
                DL               ++   D  D  K+T+T               NA+G     
Sbjct: 22714 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLT-------------VKNASGTK--- 22757

Query: 823   YYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW----KKDGA 878
               +  ++VK +  P                 G    L +    + +  L W    +  GA
Sbjct: 22758 --AVSVMVKVLDSP-----------------GPCGKLTVSRVTQEKCTLAWSLPQEDGGA 22798

Query: 879   EI--------DKNQIN--IRNSETDTIIFIRKAERSHSGKYDLQVK-VDKFVETASIDIQ 927
             EI        + +++N  I   E  T+ ++       + +Y  +V+ V+K+     ++ +
Sbjct: 22799 EITHYIVERRETSRLNWVIVEGECPTLSYV-VTRLIKNNEYIFRVRAVNKYGPGVPVESE 22857

Query: 928   -IIDR-----PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV 981
              I+ R     P PP I +      E++ + WT P+ DG   I+ Y + K +KKS+ W  V
Sbjct: 22858 PIVARNSFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRV 22917

Query: 982   IEHY--HRTSATITELVIGNEYYFRVFSENMCGLSE 1015
              + Y  + T   +T L+ G +Y FRV + N  G SE
Sbjct: 22918 NKDYVVYDTRLKVTSLMEGCDYQFRVTAVNAAGNSE 22953



 Score =  106 bits (264), Expect = 1e-22
 Identities = 128/545 (23%), Positives = 211/545 (38%), Gaps = 64/545 (11%)

Query: 620  PDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKETTF 679
            P PP  P V +       + W+PPA DGGSPI GY +E +++ ++ W R+N      TT 
Sbjct: 9333 PGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITTC 9392

Query: 680  E--PKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMR 737
            E     + E   Y  R+ AVN  G S+PS  +       +   P +  +D      +  +
Sbjct: 9393 ECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVF-IDIGAQDCLVCK 9451

Query: 738  WRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTI 797
                  I A        +  +E    AK++ ++G   +D+P +    A  +  + +   I
Sbjct: 9452 AGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDG--VHDIPED----AQLETAENSSVII 9505

Query: 798  TGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAV 857
              +P   +      ++ A   +  K  +  + V ++  PPK      LK + I R    +
Sbjct: 9506 --IPECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPK-----DLKVSDITRGSCRL 9558

Query: 858  NLVIP------------FQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIR-KAERS 904
            +  +P             + +      W K   +       + +  ++   F R +AE  
Sbjct: 9559 SWKMPDDDGGDRIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAEN- 9617

Query: 905  HSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAIT 964
               ++ +   V+    T + D   I  P PP  +KI  +    V L+W PPK+DG + +T
Sbjct: 9618 ---RFGIGPPVETIQRTTARDP--IYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVT 9672

Query: 965  GYTIQ-----KADKKSMEWFTVIEH-YHRTSATITELVIGNEYYFRVFSENMCGLSEDAT 1018
             Y ++         K   W    +        T+ +LV G EY FRV + N  G+S+ + 
Sbjct: 9673 HYIVECLAWDPTGTKKEAWRQCNKRDVEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSA 9732

Query: 1019 MTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKI 1078
                      D      P  +  +F E               G N  +   ++G P P +
Sbjct: 9733 TVGPCDCQRPD----MPPSIDLKEFMEVE------------EGTNVNIVAKIKGVPFPTL 9776

Query: 1079 TWMK-------NKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIE 1131
            TW K       NK  ++ D           CTL I +    D G Y   AVN+LGT   E
Sbjct: 9777 TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKE 9836

Query: 1132 CKLEV 1136
             +L V
Sbjct: 9837 MRLNV 9841



 Score =  105 bits (263), Expect = 2e-22
 Identities = 101/375 (26%), Positives = 158/375 (42%), Gaps = 21/375 (5%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
            +V +G  V+  V+++   +E  W K+GQE++PS +          +L I +    D   Y
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379

Query: 323  YVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDD-ANVKWFKNGEEI 381
              T      ST   V    + V   L+D     G +  LEC+VS  D  +VKW+ N E+I
Sbjct: 2380 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2439

Query: 382  IPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTD 441
               P  R +  V+G K  L+I     +D   Y ++    +++  LSV+   +KI+  L D
Sbjct: 2440 --KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRD 2495

Query: 442  QTVNLGKEICLKCEISEN-IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGD 500
             T    + +  + E+S + I   W      ++ S + K+   G+I+KL + N + +DEG 
Sbjct: 2496 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2555

Query: 501  YVF--APDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAM 558
            Y F    +  +  L      I  P         D TV          E+     P  K  
Sbjct: 2556 YTFYAGENMTSGKLTVAGGAISKPL-------TDQTVAESQEAVFECEV---ANPDSKGE 2605

Query: 559  WSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVD 618
            W R  K  +  +  IR+ES      L+I   + DD G Y    K    +  A +KV+ V 
Sbjct: 2606 WLRDGKH-LPLTNNIRSESDGHKRRLIIAATKLDDIGEY--TYKVATSKTSAKLKVEAVK 2662

Query: 619  FPDPPVAPTVTEVGD 633
                    TVTE  D
Sbjct: 2663 IKKTLKNLTVTETQD 2677



 Score =  103 bits (258), Expect = 7e-22
 Identities = 110/456 (24%), Positives = 174/456 (38%), Gaps = 80/456 (17%)

Query: 702   ISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             + KP +P+ P            +  D VT   +T++W PP   G + +  Y+LE      
Sbjct: 13701 VGKPGIPTGP------------IKFDEVTAEAMTLKWAPPKDDGGSEITNYILE------ 13742

Query: 762   TSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGA--- 818
                K+   N +         W+      + KT F +T L    +   RV A N  G    
Sbjct: 13743 ---KRDSVNNK---------WVTC-ASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGEG 13789

Query: 819   --SEPKYYSQPILVKEIIEPPKIRIPRH----LKQTYIRRVGEAVNLVIPFQGKPRPELT 872
               SEP     P  V +   PP I   RH    L  T  ++ G +       + K R  L 
Sbjct: 13790 LKSEPIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLL 13849

Query: 873   WKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETAS--------I 924
             WK+     +K  I +R+ +   +        +   +Y+ +V                  +
Sbjct: 13850 WKR----ANKTPIRMRDFKVTGL--------TEGLEYEFRVMAINLAGVGKPSLPSEPVV 13897

Query: 925   DIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIE- 983
              +  ID PG P+++ I      +V L WT PK DG   +TGY ++K D  S  W      
Sbjct: 13898 ALDPIDPPGKPEVINITR---NSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHV 13954

Query: 984   HYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDF 1043
             +    + T+T+LV G +Y FR+ ++N  G     + + E+ +I +D            ++
Sbjct: 13955 NVPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTET-IICKD------------EY 14001

Query: 1044  SEAPMFTQPLVNTYAI--AGYNATLNC-SVRGNPKPKITWMKNKVAIVDDPRYRMFSNQG 1100
                 +   P +       AG    LN  S+ G P PK +W K    I      ++ S   
Sbjct: 14002 EAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPT 14061

Query: 1101  VCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                L I+  +  D G Y   A N  GT     K+ V
Sbjct: 14062 SSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTV 14097



 Score =  102 bits (255), Expect = 2e-21
 Identities = 103/389 (26%), Positives = 171/389 (43%), Gaps = 15/389 (3%)

Query: 248  EKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK-GCQ 306
            E+    F K L+    V KG  +    EL + + +V W K+G+ +      I     G  
Sbjct: 4836 EELPVRFVKTLEEEVTVVKGQPLYLSCEL-NKERDVVWRKDGKIVVEKPGRIVPGVIGLM 4894

Query: 307  RILFINNCQMTDDSEYYVT---AGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELE 362
            R L IN+   TD   Y VT   A + +CS+ + V E     + K + D            
Sbjct: 4895 RALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFA 4954

Query: 363  CEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQS 422
            C++++D  N+KWFK  +EI   P  +  I  +G    L I+ A   D AEY+V   G + 
Sbjct: 4955 CDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRY 5014

Query: 423  SAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISE-NIPGKWTKNGLPVQESDRLKVVH 481
             AKL++  + +++L P+ D T+   +      EISE +IPG+W   G  ++ S   ++  
Sbjct: 5015 PAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELLRPSPTCEIKA 5074

Query: 482  KGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGN 541
            +G    L +     +  G+ ++   A N    A   ++   +I LD       VTV    
Sbjct: 5075 EGGKRFLTLHKVKLDQAGEVLY--QALNAITTA---ILTVKEIELDFAVPLKDVTVPERR 5129

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINL 601
            + R E  ++ E     +WS+G   I++ S +    +      LVI+ ++ DD GVY   +
Sbjct: 5130 QARFECVLTRE--ANVIWSKGPD-IIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEV 5186

Query: 602  KNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
            + +   A   +    + F  P    TV E
Sbjct: 5187 EGKKTSARLFVTGIRLKFMSPLEDQTVKE 5215



 Score =  102 bits (254), Expect = 2e-21
 Identities = 85/281 (30%), Positives = 121/281 (43%), Gaps = 16/281 (5%)

Query: 283  VKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPI 342
            V W K    I+ S K+     G + IL IN+ Q  D+  Y      +K S  LFV    +
Sbjct: 5143 VIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRL 5202

Query: 343  MVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILII 402
                 LED T   GE     CE+S +  +V WFKN  ++         I  EGK H L +
Sbjct: 5203 KFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL--HTSRTVLISSEGKTHKLEM 5260

Query: 403  EGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPG 462
            +  T  D ++         S+A+L V          L D+T     EI LKCE+S+++P 
Sbjct: 5261 KEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPV 5320

Query: 463  KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV----FAPDAYNVTLPAKVHV 518
            KW K+G  +  S +  +   G    L I  A  +D+G+YV          NVT+ A++  
Sbjct: 5321 KWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIK 5380

Query: 519  IDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMW 559
            ++ P   L G      V V  G     EI +S EP     W
Sbjct: 5381 VEKP---LYG------VEVFVGETAHFEIELS-EPDVHGQW 5411



 Score =  102 bits (254), Expect = 2e-21
 Identities = 179/762 (23%), Positives = 289/762 (37%), Gaps = 135/762 (17%)

Query: 340   PPIMVTKQLEDTTAYCGERVELECEV-SEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKH 398
             P I++ +Q+   T   G+++ +E  V  +     KW K  +E++    S   +       
Sbjct: 12528 PKILMPEQI---TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTS--SHLAVHKADSSS 12582

Query: 399   ILIIEGATKADAAEYSVMT--TGGQSSAKLSV--------------------DLKPLKIL 436
             ILII+  T+ D+  YS+    + G  + K+ V                    D   L   
Sbjct: 12583 ILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWH 12642

Query: 437   TPLTDQTVNLGKEICLKCEISENIPGKW-TKNGLPVQESDRLKVVHKGRIH--------K 487
              PL D   N+   I  KC++S    G W T      + S R+  +  G+ +        +
Sbjct: 12643 IPLEDGGSNITNYIVEKCDVSR---GDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENR 12699

Query: 488   LVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL--DGLDADNTVTVIAGNKLRL 545
               I+  LT  +    F     +    A+V  ++   I +  D  D+D    +I       
Sbjct: 12700 FGISEPLTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIG------ 12753

Query: 546   EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEA 605
                I  +     +W + +  +      +R+  YP +   +++  E      + I   N+A
Sbjct: 12754 -YLIERKERNSLLWVKANDTL------VRSTEYPCAG--LVEGLEYS----FRIYALNKA 12800

Query: 606   GEAHASIKVKVVDFP---DPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQ 662
             G +  S   + V      DPP  P V +V      + W  P +DGGS I+GYF+E  K  
Sbjct: 12801 GSSPPSKPTEYVTARMPVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLP 12860

Query: 663   SSRWMRLNF--DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP 720
               +W+R N       +  +    + E   Y+ R  A  A+ IS PS PS P   LA   P
Sbjct: 12861 GDKWVRCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVP 12920

Query: 721   P---------TLLTVDSVT----DTTV------TMRWRPPDHIGAAGLDGYVLEYCFEGS 761
             P         +LLTV + T    D TV      T+ W+          DG +L+   EG 
Sbjct: 12921 PRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKK---------DGTLLKPA-EGI 12970

Query: 762   TSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEP 821
               A Q +           E + V  KD  D T  T           +++K ++  G    
Sbjct: 12971 KMAMQRNL-------CTLELFSVNRKDSGDYT-ITAENSSGSKSATIKLKVLDKPGPPAS 13022

Query: 822   ----KYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVG-EAVNLVIPFQGKPRPELTWKKD 876
                 K YS   ++    EPP            +   G E  N ++  +   RP   W + 
Sbjct: 13023 VKINKMYSDRAMLSW--EPP------------LEDGGSEITNYIVDKRETSRPN--WAQV 13066

Query: 877   GAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQ 936
              A +     ++           R    +  G  D       F E A I     D PG   
Sbjct: 13067 SATVPITSCSVEKLIEGHEYQFRICAENKYGVGD-----PVFTEPA-IAKNPYDPPGRCD 13120

Query: 937   IVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATI--TE 994
                I ++  +++ ++W PP DDG + ITGY ++K + +++ W T +        T+  T 
Sbjct: 13121 PPVISNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNW-TKVNRKPIIERTLKATG 13179

Query: 995   LVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
             L  G EY FRV + N  G  + +  +K  A  ARD +    P
Sbjct: 13180 LQEGTEYEFRVTAINKAGPGKPSDASK--AAYARDPQYPPGP 13219



 Score = 98.6 bits (244), Expect = 3e-20
 Identities = 93/361 (25%), Positives = 149/361 (41%), Gaps = 12/361 (3%)

Query: 271  RFVVELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVTAGDEK 330
            +F  E++      +W K  QEI    ++     G +  + I +    D+++Y   A D+ 
Sbjct: 5486 KFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKH 5545

Query: 331  CSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYR 390
             S +L +    +     L+D TA   E      E+S D+  VKWFKN + +         
Sbjct: 5546 TSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRL--HTTRSVS 5603

Query: 391  IRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEI 450
            ++ EGK H +  +  +  D ++  V   G  S AKL+V          L D T     E+
Sbjct: 5604 MQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEV 5663

Query: 451  CLKCEISE-NIPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYN 509
             L+CEIS+ + P KW K+G  ++ S    +   G+   L++  AL  D G Y    D   
Sbjct: 5664 ILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC--DCGT 5721

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWS-RGDKAIME 568
                 K+ + D    ++  L   ++V V+     R E  IS E    A W  +G+  +  
Sbjct: 5722 DKTSGKLDIEDREIKLVRPL---HSVEVMETETARFETEIS-EDDIHANWKLKGEALLQT 5777

Query: 569  GSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTV 628
                I+ E    S  LV+     D +G       N    AH  +K +V+    P    TV
Sbjct: 5778 PDCEIKEEGKIHS--LVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTV 5835

Query: 629  T 629
            T
Sbjct: 5836 T 5836



 Score = 97.1 bits (240), Expect = 9e-20
 Identities = 126/568 (22%), Positives = 206/568 (36%), Gaps = 75/568 (13%)

Query: 597   YHINLKNEAGEAHASIKVKVV---DFPDPPVAPTVTEVGDDW---CIMNWEPPAYDGGSP 650
             + +  +NE G    S+  + V   D  +PP  PT   V D       + W  P YDGG+P
Sbjct: 12096 FRVKAENEIGIGEPSLPSRPVVAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAP 12155

Query: 651   ILGYFIERKKKQSSR-----WMRLNFDL-CKETTFEPKKMIEGVAYEVRIFAVNAIGISK 704
             I+GY +E + K +       W R N         F    + E   YE R+ A N +GI +
Sbjct: 12156 IIGYVVEMRPKIADASPDEGWKRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGR 12215

Query: 705   PSMPSRPFVPLAVTSPPTLLTVDSVTDTTVT-----------MRWRPPDHIG--AAGLDG 751
             P+       P  +  PP +    S+    +            +R RP   +     G+D 
Sbjct: 12216 PAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDN 12275

Query: 752   YVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGL-PTDAK-IFVR 809
              V +          Q D     A+       ++ N    D  K+++T + P   K +FV 
Sbjct: 12276 VVRK---------GQVDLVDTMAF------LVIPNSTRDDSGKYSLTLVNPAGEKAVFVN 12320

Query: 810   VKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRP 869
             V+ ++  G         P+   ++ +  K     H+        G +       + +   
Sbjct: 12321 VRVLDTPG---------PVSDLKVSDVTKTSC--HVSWAPPENDGGSQVTHYIVEKREAD 12369

Query: 870   ELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII 929
               TW     E+ K   ++ N       + R    +  G       V   V    +    +
Sbjct: 12370 RKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGP-----GVPTDVPKPVLASDPL 12424

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGY-TIQKADKKSMEWFTVIEHYHRT 988
               P PP+ +++ ++   +  L W PP  DG A I GY T  + +++  + +T        
Sbjct: 12425 SEPDPPRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDL 12484

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPM 1048
             S  +T L  G +Y FRV + N  G+S           + R+ +     VYE  +    P 
Sbjct: 12485 SLVVTGLKEGKKYKFRVAARNAVGVS-----------LPREAE----GVYEAKEQLLPPK 12529

Query: 1049  FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRK 1108
                P   T   AG    +   V G P P   W K +  +V      +        L I+ 
Sbjct: 12530 ILMPEQITIK-AGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKD 12588

Query: 1109  PSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              +  D G Y   A N  GT   + K+ V
Sbjct: 12589 VTRKDSGYYSLTAENSSGTDTQKIKVVV 12616



 Score = 94.4 bits (233), Expect = 6e-19
 Identities = 147/655 (22%), Positives = 260/655 (39%), Gaps = 108/655 (16%)

Query: 20    EEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILFIEKPQGGTVKVGEDITFIA 79
             E+ SK  E   +  K      T   E +A +  +S+  I  +   Q  TV       F  
Sbjct: 26444 EKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVI--VTGLQDTTVSSDSVAKFAV 26501

Query: 80    KVKAEDLLRKPTIKWFK--------GKWMDLASKAGKHLQLKETFERHSRVYTFEMQIIK 131
             K   E    +PT  W K        GK+     K G  L++ +T    S +YT  ++   
Sbjct: 26502 KATGEP---RPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVK--- 26555

Query: 132   AKDNFAGNYR--CEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGEGQEDAGELD 189
                N AG+    C++T K   D+ +  +   +++  TP        K++   +E + +  
Sbjct: 26556 ---NSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQ-------KKAVVQEEISQKAL 26605

Query: 190   FSGLLKRREVKQQE------EEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKRLKR 243
              S  +K  E K QE      E  +V + E +K +  +  EK      IT           
Sbjct: 26606 RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTS-------- 26657

Query: 244   MRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIFEHK 303
                EE ++ A  K       +++G R+     +A    +VKW  NG E+  S +Y +   
Sbjct: 26658 QASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT-DVKWVLNGVELTNSEEYRYGVS 26716

Query: 304   GCQRILFINNCQMTDDSEYYVTA----GDEKCSTELFVREPPIMVTKQLEDTTAYC---- 355
             G  + L I      D+      +    G  KC  +L        ++K+L D  A+     
Sbjct: 26717 GSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDL-------TLSKELSDAPAFISQPR 26769

Query: 356   ------GERVELECEVS-EDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKA 408
                   G+ V   CE+S E    ++WFKN   I     S   I      + L I  A+ +
Sbjct: 26770 SQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI--SISSNVSISRSRNVYSLEIRNASVS 26827

Query: 409   DAAEYSVMTTG--GQSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTK 466
             D+ +Y++      GQ SA  S+      ++ PL ++     +E+ L+     ++ G ++ 
Sbjct: 26828 DSGKYTIKAKNFRGQCSATASL------MVLPLVEEP---SREVVLRTSGDTSLQGSFSS 26878

Query: 467   NGLPVQESDR-----------LKVVHKGRIHKLVIANALTEDEGDYVFAPDAY----NVT 511
               + +  S +              + + +   +   +  +  E     +  ++    N+T
Sbjct: 26879 QSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT 26938

Query: 512   ---------LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRG 562
                      L A +  I PPKI  + L +D  +++  G  L +    +GEP P+  WS G
Sbjct: 26939 QLESSTSKMLKAGIRGI-PPKI--EALPSD--ISIDEGKVLTVACAFTGEPTPEVTWSCG 26993

Query: 563   DKAI-MEGSGRIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
              + I  +  GR   E+  D +TL+I   ++ D G+Y ++L NE G   A++ + +
Sbjct: 26994 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27048



 Score = 94.0 bits (232), Expect = 7e-19
 Identities = 93/416 (22%), Positives = 158/416 (37%), Gaps = 58/416 (13%)

Query: 728   SVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANK 787
             +VT   +T+ WRPP   G A +  Y++E             E     + + +E       
Sbjct: 20605 TVTAEKITLLWRPPADDGGAKITHYIVE-----------KRETSRVVWSMVSEH------ 20647

Query: 788   DLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQ 847
               +++   T T +    +   RV+AVN  G  EP      +     + P    IP   K 
Sbjct: 20648 --LEECIITTTKIIKGNEYIFRVRAVNKYGIGEPLESDSVVAKNAFVTPGPPGIPEVTKI 20705

Query: 848   T-------YIRRVGEAVNLVIPF--QGKPRPELTW---KKDGAEIDKNQINIRNSETDTI 895
             T       + R + +  + +  +  + + +  L W    K+     + ++      +D  
Sbjct: 20706 TKNSMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQ 20765

Query: 896   IFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 955
               +     +  G +    +  +F + A      ID PGPP  ++I D    ++ L W+ P
Sbjct: 20766 YRVCAVNAAGQGPFS---EPSEFYKAADP----IDPPGPPAKIRIADSTKSSITLGWSKP 20818

Query: 956   KDDGNAAITGYTIQKADKKSMEWFTVIE--HYHRTSATITELVIGNEYYFRVFSENMCGL 1013
               DG +A+TGY ++    +  EW TV        T   ++ L  G  YYFRV + N  G 
Sbjct: 20819 VYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEVRTTEYVVSNLKPGVNYYFRVSAVNCAGQ 20878

Query: 1014  SEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV---NTYAIAGYNATLNCSV 1070
              E   M               N   +  D  EAP     +    +  A AG +  +    
Sbjct: 20879 GEPIEM---------------NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPF 20923

Query: 1071  RGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
             +G P P +TW K++  +  D RY + +      L I + +  D G Y     N +G
Sbjct: 20924 KGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVG 20979



 Score = 92.0 bits (227), Expect = 3e-18
 Identities = 69/216 (31%), Positives = 100/216 (46%), Gaps = 18/216 (8%)

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRT 988
             ++PG P    I  V  ++  + W PP  DG A I  Y ++K +KK  +W +V  E    T
Sbjct: 24451 EKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRET 24510

Query: 989   SATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFS-EAP 1047
               ++  L+ G EY FRV  EN+ G SE + +++              P+    D   +AP
Sbjct: 24511 VFSVKNLIEGLEYEFRVKCENLGGESEWSEISE--------------PITPKSDVPIQAP 24556

Query: 1048  MFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMK-NKVAIVDDPRYRMFS-NQGVCTLE 1105
              F + L N       NATL C V G+PKP + W +  K  I D  +YR+     G   L 
Sbjct: 24557 HFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 24616

Query: 1106  IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1141
             I   +  D   Y  +A N  G+V     LEV+V A+
Sbjct: 24617 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAK 24652



 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 99/438 (22%), Positives = 170/438 (38%), Gaps = 59/438 (13%)

Query: 600   NLKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERK 659
             N+  ++  +  S  +  +D  DPP  P    +      + W  P Y GG  I  Y +E++
Sbjct: 14965 NMAGKSKPSKPSEPMLALDPIDPPGKPVPLNITRHTVTLKWAKPEYTGGFKITSYIVEKR 15024

Query: 660   KKQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIG-ISKPSMPSRPFVPLAVT 718
                + RW++ NF    E  F    + E  AYE R+ A NA G IS PS PS         
Sbjct: 15025 DLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDV 15084

Query: 719   SPPTLLTVDSVTDTTVTMRWRPPDHIGA--AGLDGYVLEYCFEGSTSAKQSDENGEAAYD 776
               P  + VD     TV ++      + A  +G     +E+  +G       +  G A  +
Sbjct: 15085 EAPK-IKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDG------KELEGTAKLE 15137

Query: 777   LPAEDWI--VANKDLI--DKTKFTITGLPTD--AKIFVRVKAVNAAGASEPKYYSQPILV 830
             +   D+   + NKD    D   +T+T       AK    VK ++  G  E      P+ V
Sbjct: 15138 IKIADFSTNLVNKDSTRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPE-----GPLAV 15192

Query: 831   KEIIE--------PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDK 882
              E+          PP            +   G  ++  I  Q +    L W    +E+  
Sbjct: 15193 TEVTSEKCVLSWFPP------------LDDGGAKIDHYI-VQKRETSRLAWTNVASEVQV 15239

Query: 883   NQINI-RNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
              ++ + +  + +  IF   A   +     L+           + +     P PP+  ++ 
Sbjct: 15240 TKLKVTKLLKGNEYIFRVMAVNKYGVGEPLE-------SEPVLAVNPYGPPDPPKNPEVT 15292

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF-----TVIEHYHRTSATITELV 996
              +  +++ + W  P  DG + I  Y +++ DK    W      T+ +  ++ S     L 
Sbjct: 15293 TITKDSMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSG----LT 15348

Query: 997   IGNEYYFRVFSENMCGLS 1014
              G+EY FR+ +EN  G+S
Sbjct: 15349 EGHEYEFRIMAENAAGIS 15366



 Score = 89.0 bits (219), Expect = 2e-17
 Identities = 61/198 (30%), Positives = 88/198 (44%), Gaps = 18/198 (9%)

Query: 932  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
            P PP+ VK  D    ++ LTW PPK+DG + I GY +++  + S +W    E    T   
Sbjct: 7216 PDPPENVKWRDRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSDKWVACGEPVAETKME 7275

Query: 992  ITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAP---M 1048
            +T L  G  Y +RV + N  G S+ +  T+E   +               D  EAP   +
Sbjct: 7276 VTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAV---------------DTQEAPEIFL 7320

Query: 1049 FTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRK 1108
              + L      AG    L  +V G P+PKITW K  + +  D R  + +     T+ I  
Sbjct: 7321 DVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVD 7380

Query: 1109 PSPYDGGTYCCKAVNDLG 1126
                D GTY  +AVN  G
Sbjct: 7381 SKRSDTGTYIIEAVNVCG 7398



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 112/510 (21%), Positives = 197/510 (38%), Gaps = 70/510 (13%)

Query: 648   GSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEGVAYEVRIFAVNAIGISKPS 706
             G P+    + R        MR N ++  E  T   K+ +   A    I A N+ G +K  
Sbjct: 20130 GKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTKAF 20189

Query: 707   MPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAK 765
             +     V L    PPT  + +  +T+ +VT++W PP + G + +  Y+L    +  TS  
Sbjct: 20190 IN---IVVLDRPGPPTGPVVISDITEESVTLKWEPPKYDGGSQVTNYIL---LKRETSTA 20243

Query: 766   QSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYS 825
                E                    + +T   +  L T  +   R+KA N  G S+    S
Sbjct: 20244 VWTEVSAT----------------VARTMMKVMKLTTGEEYQFRIKAENRFGISD-HIDS 20286

Query: 826   QPILVK---EIIEPPKIRIPRHLKQTYI-----RRVGEAVNLVIPF--QGKPRPELTWKK 875
               + VK       PP      ++ +  I       V    + V+ +  + K R  + W+K
Sbjct: 20287 ACVTVKLPYTTPGPPSTPWVTNVTRESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQK 20346

Query: 876   DGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETA-----SIDIQIID 930
                    N++ IR +        +    S    Y+ +V  +           S  +  ID
Sbjct: 20347 ------ANKLVIRTTH------FKVTTISAGLIYEFRVYAENAAGVGKPSHPSEPVLAID 20394

Query: 931   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTS 989
                PP+ V+I D+   +V+L+W  P  DG + ITGY +++ D     W      +   T 
Sbjct: 20395 ACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVTETQ 20454

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1049
               I+ L   ++Y FRVF+ N  G     +++  S V+         P+    D    P+ 
Sbjct: 20455 FIISGLTQNSQYEFRVFARNAVG-----SISNPSEVVG--------PI-TCIDSYGGPVI 20500

Query: 1050  TQPLVNTYAI---AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
               PL  T  +   AG +  L   + G P P I W K+   +  +    + +   + ++ I
Sbjct: 20501 DLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILI 20560

Query: 1107  RKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             +     + G Y  K  N +G+     ++++
Sbjct: 20561 KDADRLNSGCYELKLRNAMGSASATIRVQI 20590



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 94/359 (26%), Positives = 158/359 (44%), Gaps = 23/359 (6%)

Query: 285  WYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT---AGDEKCST-ELFVREP 340
            W K+G  IR S K+ F   G  R L I + Q++D  EY         EK ST +L V E 
Sbjct: 4779 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 4838

Query: 341  PIMVTKQL-EDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHI 399
            P+   K L E+ T   G+ + L CE+++ + +V W K+G+ ++  P  R    V G    
Sbjct: 4839 PVRFVKTLEEEVTVVKGQPLYLSCELNK-ERDVVWRKDGKIVVEKP-GRIVPGVIGLMRA 4896

Query: 400  LIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKIL-----TPLTDQTVNLGKEICLKC 454
            L I  A   DA  Y+V T    ++ + S  +K ++++      P+ DQ V         C
Sbjct: 4897 LTINDADDTDAGTYTV-TVENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFAC 4955

Query: 455  EISENIPG-KWTK--NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVT 511
            +I+++ P  KW K  + +P + +D+ +++  G    L I NA+ ED  +Y  A +     
Sbjct: 4956 DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEY--AVEIEGKR 5013

Query: 512  LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             PAK+ + +    +L  ++    VT+        +  IS    P     +G+  ++  S 
Sbjct: 5014 YPAKLTLGEREVELLKPIE---DVTIYEKESASFDAEISEADIPGQWKLKGE--LLRPSP 5068

Query: 572  RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTE 630
                ++      L +   + D +G       N    A  ++K   +DF  P    TV E
Sbjct: 5069 TCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPE 5127



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 78/292 (26%), Positives = 125/292 (42%), Gaps = 60/292 (20%)

Query: 265   DKGGRVRFV--VELADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEY 322
             ++GG V++V  +E  D   +V WY   +++  S KY   ++    IL++ +    DD  Y
Sbjct: 25208 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 25267

Query: 323   YVTA----GDEKCSTELFVR---------------------------EPPIMVTKQLEDT 351
                     G++    ELFV+                           E P   T  L + 
Sbjct: 25268 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 25327

Query: 352   TAYCGERVELECEVS-EDDANVKWFKNGEEIIPGPK-SRYRIRVEGKKHILIIEGATKAD 409
             TAY GE V     ++   + +V W+K+G++I PG    +Y    +   + L I   T  D
Sbjct: 25328 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDD 25387

Query: 410   AAEYSVMTTG--GQSS--AKLSVDLKPLKILTPLTDQTV-------------NLGKEICL 452
              AEY+V+     G+ S  AKL+V L P     P TD T+               G+ +C 
Sbjct: 25388 DAEYTVVARNKYGEDSCKAKLTVTLHP-----PPTDSTLRPMFKRLLANAECQEGQSVCF 25442

Query: 453   KCEISENIPG--KWTKNGLPVQESDRLKVVHKG-RIHKLVIANALTEDEGDY 501
             +  +S   P   KW K+G P+     ++++H+G   + L I + L ED G Y
Sbjct: 25443 EIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYY 25494



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 115/472 (24%), Positives = 174/472 (36%), Gaps = 92/472 (19%)

Query: 693   RIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             R  AVN   + KP  P+ P            L ++ +T    ++ W  P   G A +D Y
Sbjct: 19499 RSVAVNCKVLDKPGPPAGP------------LEINGLTAEKCSLSWGRPQEDGGADIDYY 19546

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             ++E             E    A       W +   +L   T   +T L    +   RV  
Sbjct: 19547 IVE-----------KRETSHLA-------WTICEGEL-QMTSCKVTKLLKGNEYIFRVTG 19587

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELT 872
             VN  G  EP    + + +K +        P  L+ T + +  E++ L        RPE  
Sbjct: 19588 VNKYGVGEPL---ESVAIKALDPFTVPSPPTSLEITSVTK--ESMTLCWS-----RPE-- 19635

Query: 873   WKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQI---- 928
                 G+EI    I  R  E +++ ++R  ++     YDL+VK     E    + ++    
Sbjct: 19636 -SDGGSEISGYIIERR--EKNSLRWVRVNKKP---VYDLRVKSTGLREGCEYEYRVYAEN 19689

Query: 929   -------------------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQ 969
                                +  P PP   KI D     + + W  P  DG A ITGYT++
Sbjct: 19690 AAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLFDGGAPITGYTVE 19749

Query: 970   KADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
                    +W T I+    T  TI+ L  G EY FRV S N  G S+ +  +        D
Sbjct: 19750 YKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPSDSS--------D 19801

Query: 1030  GKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
              +I K    E     ++ M    +V     AG + T+    RG P P + W K       
Sbjct: 19802 PQIAKEREEEPLFDIDSEMRKTLIVK----AGASFTMTVPFRGRPVPNVLWSKPDT---- 19853

Query: 1090  DPRYRMF--SNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVI 1139
             D R R +  +     +L I   +  D G Y     N L    +   L VKV+
Sbjct: 19854 DLRTRAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASL--TLVVKVL 19903



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 128/602 (21%), Positives = 222/602 (36%), Gaps = 112/602 (18%)

Query: 581   SSTLVIDIAERDDSGV--YHINLKNEAGEAH----ASIKVKV------VDFPDPPVAPTV 628
             S T  I++++  +  V  + +  KNE G +       I VK       VD  D P A   
Sbjct: 21143 SKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVT 21202

Query: 629   TEVGDDWCIMNWEPPAYDGGSPILGYFIERKKKQSSRWMRLNFDLCKET-TFEPKKMIEG 687
               +G +   ++ E P      P + +  +    + S ++R +    K T + +  K   G
Sbjct: 21203 VRIGHN---VHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHG 21259

Query: 688   VAYEVRI--------FAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWR 739
               Y V +          +  I +  PS P  P            +  D +   +V + W 
Sbjct: 21260 GKYTVILDNAVCRIAVPITVITLGPPSKPKGP------------IRFDEIKADSVILSWD 21307

Query: 740   PPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITG 799
              P+  G   +  Y +E      T+ K    +                   + +T F +  
Sbjct: 21308 VPEDNGGGEITCYSIEKRETSQTNWKMVCSS-------------------VARTTFKVPN 21348

Query: 800   LPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNL 859
             L  DA+   RV+A N  G S      QP++   I+   + RIP           G+ V  
Sbjct: 21349 LVKDAEYQFRVRAENRYGVS------QPLVSSIIVAKHQFRIPGP--------PGKPVIY 21394

Query: 860   VIPFQGKPRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERSHSGK------- 908
              +   G     LTW       G+E+     ++   E ++I++ +      SG+       
Sbjct: 21395 NVTSDGM---SLTWDAPVYDGGSEV--TGFHVEKKERNSILWQKVNTSPISGREYRATGL 21449

Query: 909   -----YDLQVKVDKFVETAS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPP 955
                  Y  +V  +     +S        + +  +D PG P  +   DV  E + L W PP
Sbjct: 21450 VEGLDYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYI---DVTRETITLKWNPP 21506

Query: 956   KDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSE 1015
               DG + I GY+I+K                    T+T L  G+ Y FR+ + N  G   
Sbjct: 21507 LRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTIS 21566

Query: 1016  DATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPK 1075
               + +    ++ RD  +   P   +F     P +   L+     +G +  +   V+G P 
Sbjct: 21567 PPSQSS-GIIMTRDENV---PPIVEF----GPEYFDGLIIK---SGESLRIKALVQGRPV 21615

Query: 1076  PKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLE 1135
             P++TW K+ V I       +    G  +L +R  +    G Y  +A N  G+ + E K++
Sbjct: 21616 PRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVK 21675

Query: 1136  VK 1137
             V+
Sbjct: 21676 VQ 21677



 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 203/971 (20%), Positives = 332/971 (34%), Gaps = 208/971 (21%)

Query: 259   DPAYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMT 317
             D  Y   +    R  + +   P   V W K    +   T+   E       L + +CQ +
Sbjct: 13617 DLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKS 13676

Query: 318   DDSEYYVT----AGDEKCSTELFVREPPIMVTKQL--EDTTAYC------------GERV 359
             D  +Y +T    AG ++ +  + V   P + T  +  ++ TA              G  +
Sbjct: 13677 DAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEI 13736

Query: 360   ELECEVSEDDANVKWFKNGEEIIPGPKSRYRI-----------RVEGKKHILIIEGATKA 408
                     D  N KW      +    K+ +R+           RV  +    + EG    
Sbjct: 13737 TNYILEKRDSVNNKWVTCASAV---QKTTFRVTRLHEGMEYTFRVSAENKYGVGEGLKSE 13793

Query: 409   DAAEYSVMTTGGQSSAKLSVDLKPLKILTPLTDQTVNLGKEIC-LKCEISENIPGKWTK- 466
                                VD++   +    TD     G  I     E  E     W + 
Sbjct: 13794 PIVARHPFDVPDAPPPPNIVDVRHDSVSLTWTDPKKTGGSPITGYHLEFKERNSLLWKRA 13853

Query: 467   NGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIIL 526
             N  P++  D  KV              LTE   +Y F   A N+    K  +   P + L
Sbjct: 13854 NKTPIRMRD-FKVT------------GLTEGL-EYEFRVMAINLAGVGKPSLPSEPVVAL 13899

Query: 527   DGLDAD----------NTVTVI-------AGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
             D +D            N+VT+I        G+KL   I    + P K+ W + +      
Sbjct: 13900 DPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKS-WMKANHV---- 13954

Query: 570   SGRIRTESYPDSSTLVIDIAERDDSGVYH--INLKNEAGEAHA-SIKVKVVDFPDPPVAP 626
                    + P+ +  V D+ E    G Y   I  KN AG   A S   + +   D   AP
Sbjct: 13955 -------NVPECAFTVTDLVE---GGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 14004

Query: 627   TVTEVGDDWCIMNWEPPAYDG-----GSPIL--GYFIERKKKQSSRWMRLNFDL----CK 675
             T+            +P   DG     G  I+     I  K    S W +   D+      
Sbjct: 14005 TIV----------LDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDIT 14054

Query: 676   ETTFEPKKMIEGVAYEVR-------IFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDS 728
             + T  P   +  + Y  R       I A N  G     +       L V  PP  + + +
Sbjct: 14055 QITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVK---VTVLDVPGPPGPVEISN 14111

Query: 729   VTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKD 788
             V+    T+ W PP   G + +  Y+LE   +  TS                  W V ++D
Sbjct: 14112 VSAEKATLTWTPPLEDGGSPIKSYILE---KRETSRLL---------------WTVVSED 14153

Query: 789   LIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQT 848
              I   +   T L    +   RV AVN  G  EP   S+P+ + +   PP           
Sbjct: 14154 -IQSCRHVATKLIQGNEYIFRVSAVNHYGKGEP-VQSEPVKMVDRFGPP----------- 14200

Query: 849   YIRRVGEAVNLVIPFQGKPRPELTWKKD----GAEIDKNQINIRNSETDTIIFIRKAERS 904
                  G      +    K    ++WK+     G+EI    +  R  E  ++ ++R  +  
Sbjct: 14201 -----GPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHVERR--EKKSLRWVRAIKTP 14253

Query: 905   HSGKYDLQVKVDKFVETASIDIQIIDR-----------------------PGPPQIVKIE 941
              S   DL+ KV    E ++ + ++                          PGPP    + 
Sbjct: 14254 VS---DLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKDAAYPPGPPSNPHVT 14310

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGN-- 999
             D   ++ +L W  P  DG   ITGY ++        W   I+    T+  IT+ V+ +  
Sbjct: 14311 DTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAW---IKDTTGTALRITQFVVPDLQ 14367

Query: 1000  ---EYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNT 1056
                +Y FR+ + N  G+ E A +         D +I +  +  DF+          L  T
Sbjct: 14368 TKEKYNFRISAINDAGVGEPAVIP--------DVEIVEREMAPDFELDAE------LRRT 14413

Query: 1057  YAI-AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGG 1115
               + AG +  +   ++G P P++TW K+ + + +  R  + + +    L I + + YD G
Sbjct: 14414 LVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKN--RANIENTESFTLLIIPECNRYDTG 14471

Query: 1116  TYCCKAVNDLG 1126
              +     N  G
Sbjct: 14472 KFVMTIENPAG 14482



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 105/480 (21%), Positives = 179/480 (37%), Gaps = 70/480 (14%)

Query: 672   DLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTD 731
             D C+E        +   A E  I  +N I + KP  P+ P            + +D VT 
Sbjct: 15837 DACREDVGHYVVKLTNSAGEA-IETLNVIVLDKPGPPTGP------------VKMDEVTA 15883

Query: 732   TTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLID 791
              ++T+ W PP + G + ++ Y++E                    D     W + +   + 
Sbjct: 15884 DSITLSWGPPKYDGGSSINNYIVE------------------KRDTSTTTWQIVSAT-VA 15924

Query: 792   KTKFTITGLPTDAKIFVRVKAVNAAGAS-----EPKYYSQPILVKEIIEPPKIRIPRH-- 844
             +T      L T  +   R+ A N  G S     EP     P  V      P + +     
Sbjct: 15925 RTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFKVPGPPGTPVVTLSSRDS 15984

Query: 845   LKQTYIRRVGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAE 902
             ++  +   + +  + VI +  + K R  + W K    ++K  I     +T  +    + E
Sbjct: 15985 MEVQWNEPISDGGSRVIGYHLERKERNSILWVK----LNKTPIPQTKFKTTGLEEGVEYE 16040

Query: 903   RSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAA 962
                S +  + +     V    +     D PG P+ + +      +V L W  P  DG + 
Sbjct: 16041 FRVSAENIVGIGKPSKVSECYVARDPCDPPGRPEAIIVTR---NSVTLQWKKPTYDGGSK 16097

Query: 963   ITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGL-SEDATMT 1020
             ITGY ++K +     W      +   T   +T LV  + Y FRV + N  G+ SE +  T
Sbjct: 16098 ITGYIVEKKELPEGRWMKASFTNIIDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSEST 16157

Query: 1021  KESAVIARDG----KIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1076
                A+ ARD     +I  +P Y+D                   AG +  ++  + G P P
Sbjct: 16158 --GAITARDEVDPPRISMDPKYKD--------------TIVVHAGESFKVDADIYGKPIP 16201

Query: 1077  KITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              I W+K    + +  R  + S     +L ++     D G Y  KA N  G   +   ++V
Sbjct: 16202 TIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 16261



 Score = 85.1 bits (209), Expect = 3e-16
 Identities = 100/435 (22%), Positives = 171/435 (39%), Gaps = 65/435 (14%)

Query: 720   PPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPA 779
             PP  + +D V+  ++T+ W PP++ G   +  Y++E     ST+                
Sbjct: 19118 PPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTSTT---------------- 19161

Query: 780   EDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPP-- 837
               W + ++  + +T   I  L T ++   RV A N  G S     S  ++ +    PP  
Sbjct: 19162 --WHIVSQ-AVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSE-SSAVVAEYPFSPPGP 19217

Query: 838   --KIRIPRHLKQTYIRR----VGEAVNLVIPF--QGKPRPELTWKKDGAEIDKNQINIRN 889
                 ++    K T +      V +  + VI +  + K R  + W K       N+I I  
Sbjct: 19218 PGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSK------ANKILI-- 19269

Query: 890   SETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQII------DRPGPPQIVKIEDV 943
                DT + +   +     +Y +  +    +   S   + +      D PG P++  I   
Sbjct: 19270 --ADTQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCEPVPARDPCDPPGQPEVTNITR- 19326

Query: 944   WGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNEYY 1002
               ++V+L W+ P  DG A ITGY +++ +     W      +   T   +TEL     Y 
Sbjct: 19327 --KSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETYFEVTELTEDQRYE 19384

Query: 1003  FRVFSENMC-GLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAG 1061
             FRVF+ N    +SE +  T    +I +D  +    V  D  F +  +           AG
Sbjct: 19385 FRVFARNAADSVSEPSEST--GPIIVKDD-VEPPRVMMDVKFRDVIVVK---------AG 19432

Query: 1062  YNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKA 1121
                 +N  + G P P I+W K+ + I +  R  + S      L ++     D G Y    
Sbjct: 19433 EVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTL 19492

Query: 1122  VNDLGT--VEIECKL 1134
              N  GT  V + CK+
Sbjct: 19493 KNVAGTRSVAVNCKV 19507



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 93/410 (22%), Positives = 160/410 (39%), Gaps = 66/410 (16%)

Query: 263  QVDKGGRVRFVVELADPKLEVKWYKNGQEI----RPSTKYIFEHKGCQRILFINNCQMTD 318
            QV +  R     E+ +  ++  WYK+G EI    +   KY+ E +     +FI+  + +D
Sbjct: 3111 QVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR--IHRMFISETRQSD 3168

Query: 319  DSEYYVTAGDEKCSTELFVREP-PIMVTKQLEDTTAYCGERVELECEVS-EDDANVKWFK 376
              EY   AG  + S  L+V  P P  V ++L+  T   G+       +S      + W+K
Sbjct: 3169 AGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYK 3228

Query: 377  NGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAA--------EYSVMTTGGQSSAKL-- 426
              + +  G K ++    +G+++ L++  A   DAA        +Y V TT    S ++  
Sbjct: 3229 EEQLLSTGFKCKF--LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286

Query: 427  ------SVDLKPLKILTPLTDQTVNLGKEICLKCEIS-ENIPGKWTKNGLPVQESDRLKV 479
                   + + P  I+TPL D   + G+    +C +S  ++   W      ++ S   ++
Sbjct: 3287 VVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRM 3346

Query: 480  VHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLD--ADNT--- 534
                  ++L IA A  EDEG Y F      V   A   V     + L+G     +NT   
Sbjct: 3347 TQFEDTYQLEIAEAYPEDEGTYTF------VASNAVGQVSSTANLSLEGFSKFEENTSNS 3400

Query: 535  ---------------------------VTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIM 567
                                       + V  G  +R    +SG P P+  W    + I+
Sbjct: 3401 QWHVSLSVSFKKEPLGQKPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLIL 3460

Query: 568  EGSGRI-RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
                 +   E     + ++I  A  + +G Y     N AGEA  +  + V
Sbjct: 3461 PTKDVVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score = 84.0 bits (206), Expect = 8e-16
 Identities = 100/460 (21%), Positives = 169/460 (36%), Gaps = 78/460 (16%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  + +  P  P  PF             +  +     ++ W  P   G + +  Y++E 
Sbjct: 12612 IKVVVMDAPGPPQPPF------------DISDIDADACSLSWHIPLEDGGSNITNYIVEK 12659

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
             C                  D+   DW+ A    + KT   +  L    +   RV+A N  
Sbjct: 12660 C------------------DVSRGDWVTALAS-VTKTSCRVGKLIPGQEYIFRVRAENRF 12700

Query: 817   GASEPKYYSQPILVKEI-----IEPPKIRIPRHLKQ----TYIRRVGEAVNLVIPF--QG 865
             G SEP   + P +V +       EP   R+ +  K      + R   +  + +I +  + 
Sbjct: 12701 GISEP--LTSPKMVAQFPFGVPSEPKNARVTKVNKDCIFVAWDRPDSDGGSPIIGYLIER 12758

Query: 866   KPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERS------HSGKYDLQVKVDKFV 919
             K R  L W K       N   +R++E      +   E S      +        K  ++V
Sbjct: 12759 KERNSLLWVK------ANDTLVRSTEYPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYV 12812

Query: 920   ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
              TA + +   D PG P+++   DV    V+L W  PK DG + I GY ++       +W 
Sbjct: 12813 -TARMPV---DPPGKPEVI---DVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWV 12865

Query: 980   ---TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNP 1036
                T      +   T T L    +Y FR  +     +S  +  +    ++A +      P
Sbjct: 12866 RCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENV-----P 12920

Query: 1037  VYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMF 1096
                D   +   + T         AG N  L+ +V G P P ++W K+   +      +M 
Sbjct: 12921 PRIDLSVAMKSLLTVK-------AGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMA 12973

Query: 1097  SNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               + +CTLE+   +  D G Y   A N  G+     KL+V
Sbjct: 12974 MQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 13013



 Score = 82.8 bits (203), Expect = 2e-15
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 21/194 (10%)

Query: 547  IPISGEPPPKAMWSRGDKAIMEGSGRIRTE-------SYPDSSTLVIDIAERDDSGVYHI 599
            + +  EPP         + ++E   R+ T        + PD +  V D+ E  +   + +
Sbjct: 7828 VDLKWEPPKNDGGRPIQRYVIEKKERLGTRWVKAGKTAGPDCNFRVTDVIEGTEVQ-FQV 7886

Query: 600  NLKNEAGEAHASIKVKVVDFPDPPVAPT------VTEVGDDWCIMNWEPPAYDGGSPILG 653
              +NEAG  H S   +++   DP   P+      VT+ G     + W+PP  +GGSPI+G
Sbjct: 7887 RAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIG 7946

Query: 654  YFIERKKKQSSRWMRLNFDLCKETTFEPKKMIEGVA----YEVRIFAVNAIGISKPSMPS 709
            Y +E     + +WMR+N    K+  F   K+ EGV     Y +R+ AVNAIG+S+PS  S
Sbjct: 7947 YHVEMCPVGTEKWMRVNSRPIKDLKF---KVEEGVVPDKEYVLRVRAVNAIGVSEPSEIS 8003

Query: 710  RPFVPLAVTSPPTL 723
               V       PT+
Sbjct: 8004 ENVVAKDPDCKPTI 8017



 Score = 77.8 bits (190), Expect = 5e-14
 Identities = 104/452 (23%), Positives = 164/452 (36%), Gaps = 62/452 (13%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             ++ I + KP  P  P            +  D V+   V + W PP + G   +  Y++E 
Sbjct: 18025 LSVIVLEKPGPPVGP------------VRFDEVSADFVVISWEPPAYTGGCQISNYIVE- 18071

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                                D     W + +   + +T   IT L T  +   R+ A N  
Sbjct: 18072 -----------------KRDTTTTTWHMVSAT-VARTTIKITKLKTGTEYQFRIFAENRY 18113

Query: 817   GASEPKYYSQPILV----KEIIEPPKIRIPRHLKQTYIRRVGEAVN------LVIPFQGK 866
             G S P   S+ ++V    KE   P    +    K   + +  E VN      +    + K
Sbjct: 18114 GKSAP-LDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQK 18172

Query: 867   PRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDI 926
              +  + W K    ++K  I     +T  +    + E   S +  + +     V    +  
Sbjct: 18173 EKNSILWVK----LNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVAR 18228

Query: 927   QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHY 985
                D PG P+ + I      NV L W  P  DG + ITGY ++K D     W      + 
Sbjct: 18229 DPCDPPGRPEAIVITR---NNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNV 18285

Query: 986   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1045
               T  T++ LV    Y FRV + N  G   + +     A+ ARD     N   +      
Sbjct: 18286 LETEFTVSGLVEDQRYEFRVIARNAAGNFSEPS-DSSGAITARDEIDAPNASLD------ 18338

Query: 1046  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-PRYRMFSNQGVCTL 1104
              P +   +V     AG    L   +RG P P + W K+   + +   R  + S     TL
Sbjct: 18339 -PKYKDVIV---VHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTL 18394

Query: 1105  EIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
              ++     DGG Y  K  N  GT  I   ++V
Sbjct: 18395 VVKDCIRTDGGQYILKLSNVGGTKSIPITVKV 18426



 Score = 77.4 bits (189), Expect = 7e-14
 Identities = 102/462 (22%), Positives = 169/462 (36%), Gaps = 81/462 (17%)

Query: 696   AVNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLE 755
             ++  + + KP  P  P            +  D V+  ++T+ W PP + G   +  Y+++
Sbjct: 16942 SIEIVTLDKPDPPKGP------------VKFDDVSAESITLSWNPPLYTGGCQITNYIVQ 16989

Query: 756   YCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNA 815
                                 D     W V +   + +T   +T L T  +   R+ A N 
Sbjct: 16990 ------------------KRDTTTTVWDVVSAT-VARTTLKVTKLKTGTEYQFRIFAENR 17030

Query: 816   AGASEPKYYSQPILVKEIIE---PPKIRIPRHL-KQTYIRRVGEAVN------LVIPFQG 865
              G S     S PI+ +   +   PP       + K + + +  E VN      +    + 
Sbjct: 17031 YGQSFA-LESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLER 17089

Query: 866   KPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSG-KYDLQVKVDKFVETAS- 923
             K R  + W K    ++K  I+      DT     KA+    G +Y+ +V  +  V     
Sbjct: 17090 KERNSILWTK----VNKTIIH------DTQF---KAQNLEEGIEYEFRVYAENIVGVGKA 17136

Query: 924   -------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSM 976
                    +     D PG P+ + ++      + L WT P  DG + ITGY ++K D    
Sbjct: 17137 SKNSECYVARDPCDPPGTPEPIMVKR---NEITLQWTKPVYDGGSMITGYIVEKRDLPDG 17193

Query: 977   EWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCG-LSEDATMTKESAVIARDGKIYK 1034
              W      +   T  T++ L     Y FRV ++N  G +S+ +  T         G I  
Sbjct: 17194 RWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDST---------GPITA 17244

Query: 1035  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
                 E    S  P F   +V     AG    L   V G P P I W++    I +  R  
Sbjct: 17245 KDEVELPRISMDPKFRDTIVVN---AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCE 17301

Query: 1095  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             + +      L ++     DGG Y  +A N  G+      ++V
Sbjct: 17302 IKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKV 17343



 Score = 77.0 bits (188), Expect = 9e-14
 Identities = 106/469 (22%), Positives = 169/469 (36%), Gaps = 97/469 (20%)

Query: 697   VNAIGISKPSMPSRPFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEY 756
             +  I + KP  P+ P            + +D +  T++T+ W PP+  G A L GYV+E 
Sbjct: 23452 IKVIILDKPGPPTGP------------IKIDEIDATSITISWEPPELDGGAPLSGYVVEQ 23499

Query: 757   CFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAA 816
                                D     W+  ++  + ++ F  T L    +   RV A N  
Sbjct: 23500 ------------------RDAHRPGWLPVSES-VTRSTFKFTRLTEGNEYVFRVAATNRF 23540

Query: 817   GASEPKYYSQPILVKEIIE-PPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTW-- 873
             G           L  E+IE    IRIP           G    L I    +    LTW  
Sbjct: 23541 GIGS-------YLQSEVIECRSSIRIP-----------GPPETLQIFDVSRDGMTLTWYP 23582

Query: 874   -KKDGAE------IDKNQINIR-----NSETDTIIFIRKAERSHSGKYDLQVKVDKFVET 921
              + DG        +++ ++        N    T+   R    +   +Y+ +V       +
Sbjct: 23583 PEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGS 23642

Query: 922   AS--------IDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                       + +  I  PG PQ  ++ D    +V+L W+ P+D+G + +TGY I+    
Sbjct: 23643 GKPSRPSKPIVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKV 23702

Query: 974   KSMEWF------TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIA 1027
                EW       T I  Y     T+T L  G EY FRV + N  G  E A        + 
Sbjct: 23703 DQHEWTKCNTTPTKIREY-----TLTHLPQGAEYRFRVLACNAGGPGEPAE-------VP 23750

Query: 1028  RDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAI 1087
                K+ +   Y D++  E     +     +   G    L   ++G P P   W K    I
Sbjct: 23751 GTVKVTEMLEYPDYELDE-----RYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI 23805

Query: 1088  VDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                 R  + +++    L I++    D GTY     N  G   +  K+ V
Sbjct: 23806 --SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRV 23852



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 64/235 (27%), Positives = 91/235 (38%), Gaps = 46/235 (19%)

Query: 932  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRT-SA 990
            P PP  V++ +   E + +TW PP  DG + I GY I+K  K    W    EH     + 
Sbjct: 8208 PDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKRCNEHLVPILTY 8267

Query: 991  TITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1050
            T   L  G EY FRV +EN  G+SE +  T  +  +            +  D  +  + T
Sbjct: 8268 TAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAV------------DPIDAPKVILRT 8315

Query: 1051 QPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD-------PRYRM-------- 1095
               V      G    L+ S+ G+P P ITW+K++  IV +       P  R         
Sbjct: 8316 SLEVKR----GDEIALDASISGSPYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEE 8371

Query: 1096 --------------FSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                           S +G   L +R     D G Y  K  ND G  +  C + V
Sbjct: 8372 EPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 8426



 Score = 73.9 bits (180), Expect = 8e-13
 Identities = 59/203 (29%), Positives = 83/203 (40%), Gaps = 14/203 (6%)

Query: 926   IQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHY 985
             ++  + P PP  + I D+    V+L W  PK DG + ITGY I+   K S +W T I   
Sbjct: 14587 VKASEAPSPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQW-THITTV 14645

Query: 986   HRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSE 1045
                   +  L  G EY F+V + N  G S      +ES  +     + +  +  + D   
Sbjct: 14646 KGLECVVRNLTEGEEYTFQVMAVNSAGRSAP----RESRPVI----VKEQTMLPELDLRG 14697

Query: 1046  APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1105
                  Q LV   A AG N  +   V G PKP +TW K    +    R    +      L 
Sbjct: 14698 ---IYQKLV--IAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILN 14752

Query: 1106  IRKPSPYDGGTYCCKAVNDLGTV 1128
             I +    D G Y   A N +G V
Sbjct: 14753 INECVRSDSGPYPLTARNIVGEV 14775



 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 13/197 (6%)

Query: 930   DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS 989
             ++P PP+ + + D    +  L W  P  DG + ITGY ++   K S  W     H  + +
Sbjct: 22172 EQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEA-GHTKQLT 22230

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMF 1049
              T+  LV   EY FRV ++N  G SE       S+VI ++ +I           ++    
Sbjct: 22231 FTVERLVEKTEYEFRVKAKNDAGYSEPREAF--SSVIIKEPQIEPT--------ADLTGI 22280

Query: 1050  TQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKP 1109
             T  L+   A  G   T++  + G P PK+TW   ++ + +  R  + + +   TL ++  
Sbjct: 22281 TNQLITCKA--GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDS 22338

Query: 1110  SPYDGGTYCCKAVNDLG 1126
                D G Y     N  G
Sbjct: 22339 MRGDSGRYFLTLENTAG 22355



 Score = 72.4 bits (176), Expect = 2e-12
 Identities = 56/222 (25%), Positives = 101/222 (45%), Gaps = 17/222 (7%)

Query: 918   FVETASIDI--QIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKS 975
             FVET+   +  + I  P  P+ +++++V    V LTW PPK DG + I  Y ++     +
Sbjct: 10329 FVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGT 10388

Query: 976   MEWFTVI-EHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
              ++  V  ++      T+  L  G+ Y +RV + N+ G  + +  TK    I    ++  
Sbjct: 10389 EKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKP---ITCKDELAP 10445

Query: 1035  NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
               ++ DF        T  +   +A+ G  +       G PKPK++W K++  +++D R  
Sbjct: 10446 PTLHLDF----RDKLTIRVGEAFALTGRYS-------GKPKPKVSWFKDEADVLEDDRTH 10494

Query: 1095  MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             + +      LE  K    D G YC    N  G+ +  C++ V
Sbjct: 10495 IKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 10536



 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 134/663 (20%), Positives = 230/663 (34%), Gaps = 120/663 (18%)

Query: 2     PEPTKKEENEVPAP----APPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLS 57
             PEP  K    V +P    +P P  P       T P        TP  + Q    +     
Sbjct: 26297 PEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP--------TPTEKVQHLPVSAPPKI 26348

Query: 58    ILFIEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFE 117
               F++       +  ++I  +  V    +LR   + W+K          GK L+    F+
Sbjct: 26349 TQFLK------AEASKEIAKLTCVVESSVLRAKEVTWYKD---------GKKLKENGHFQ 26393

Query: 118   RH-SRVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFK 176
              H S   T+E++I    ++  G Y CE+                                
Sbjct: 26394 FHYSADGTYELKINNLTESDQGEYVCEI-------------------------------- 26421

Query: 177   RSGEGQEDAGELDFSG---------LLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAF 227
              SGEG      L F G         + K  E K+ +++       + +  +P   E I+ 
Sbjct: 26422 -SGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTEST--VTRKTEPKAPEPIS- 26477

Query: 228   QYGITDLRGMLKRLKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYK 287
                                   K      + D     D   +   V    +P+    W K
Sbjct: 26478 ---------------------SKPVIVTGLQDTTVSSDSVAKFA-VKATGEPRPTAIWTK 26515

Query: 288   NGQEIRPSTKYIFEHKGCQRILFINNCQMTDDSEYYVT----AGDEKCSTELFVREPPIM 343
             +G+ I    KY          L I+    +D   Y  T    AG    S +L ++   I 
Sbjct: 26516 DGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKA--IK 26573

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
              T+  + +T    E    +  V +++ + K  ++ E  +   KS+ ++ ++ +   ++I 
Sbjct: 26574 DTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLIS 26633

Query: 404   GATKADAA---EYSVMTTGGQSSAKLSVDLKP-LKILTPLTDQTVNLGKEICLKCEISEN 459
                K  AA   E S++      +++ S +++   +I    T  ++N G+ + LK  I+  
Sbjct: 26634 EEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGA 26693

Query: 460   IPGKWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDYV--------FAPDAYNVT 511
                KW  NG+ +  S+  +    G    L I  A   DEG                Y++T
Sbjct: 26694 TDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLT 26753

Query: 512   LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
             L  ++   D P  I        +  +  G  +     ISGEP P+  W + +  I   S 
Sbjct: 26754 LSKELS--DAPAFI----SQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISS 26806

Query: 572   RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
              +      +  +L I  A   DSG Y I  KN  G+  A+  + V+   + P    V   
Sbjct: 26807 NVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRT 26866

Query: 632   GDD 634
               D
Sbjct: 26867 SGD 26869



 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 107/465 (23%), Positives = 175/465 (37%), Gaps = 76/465 (16%)

Query: 696   AVNAIGISKPSMPSR-PFVPLAVTSPPTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVL 754
             A NA G +K  +  +    P  V  P   +   ++T   +T+ W  P + G A +  Y++
Sbjct: 21661 AKNASGSAKAEIKVKVQDTPGKVVGP---IRFTNITGEKMTLWWDAPLNDGCAPITHYII 21717

Query: 755   EYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVN 814
             E             E    A+ L         +D  +   +T   L    +   RV AVN
Sbjct: 21718 E-----------KRETSRLAWALI--------EDKCEAQSYTAIKLINGNEYQFRVSAVN 21758

Query: 815   AAGASEPKYYSQPILVK---EIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPEL 871
               G   P   S P++ +    + + P I  P ++        G ++ L        RPE 
Sbjct: 21759 KFGVGRP-LDSDPVVAQIQYTVPDAPGIPEPSNI-------TGNSITLTWA-----RPE- 21804

Query: 872   TWKKDGAEIDKNQINIRNSE-TDTIIFIRKAERSHS----------GKYDLQVKVDKF-- 918
                  G+EI +  +  R  + T  +  I K   S +           +Y+  V  +    
Sbjct: 21805 --SDGGSEIQQYILERREKKSTRWVKVISKRPISETRFKVTGLTEGNEYEFHVMAENAAG 21862

Query: 919   VETASIDIQII------DRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 972
             V  AS   ++I      + PGPP +VK+ D     V+L W+ P  DG   I GY I+   
Sbjct: 21863 VGPASGISRLIKCREPVNPPGPPTVVKVTDTSKTTVSLEWSKPVFDGGMEIIGYIIEMCK 21922

Query: 973   KKSMEWFTV-IEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1031
                 +W  V  E   +T  T+T+L  G EY FRV + N  G  +   +T     I    +
Sbjct: 21923 ADLGDWHKVNAEACVKTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVT---GTIKAVDR 21979

Query: 1032  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1091
             +    +  D +F +  +           AG +  L  + +G P P   W K    +    
Sbjct: 21980 LTAPELDIDANFKQTHVVR---------AGASIRLFIAYQGRPTPTAVWSKPDSNL--SL 22028

Query: 1092  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             R  + +     TL +   +  D G Y     N+ G+  I   ++V
Sbjct: 22029 RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSITFTVKV 22073



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 75/303 (24%), Positives = 129/303 (42%), Gaps = 19/303 (6%)

Query: 341  PIMVTKQLEDT----TAYCGERVELECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGK 396
            P+   K+++D     + + G     EC VS   A   W K+G  I   PK  +R   +GK
Sbjct: 4742 PLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPK--HRFIADGK 4799

Query: 397  KHILIIEGATKADAAEYSVMTTGGQ----SSAKLSVDLKPLKILTPLTDQ-TVNLGKEIC 451
               L I     +DA EY+ +   G     S+AKL V+  P++ +  L ++ TV  G+ + 
Sbjct: 4800 DRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLY 4859

Query: 452  LKCEISENIPGKWTKNG-LPVQESDRLKVVHKGRIHKLVIANALTEDEGDY-VFAPDAYN 509
            L CE+++     W K+G + V++  R+     G +  L I +A   D G Y V   +A N
Sbjct: 4860 LSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANN 4919

Query: 510  VTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEG 569
            +   + V V++   +I D L        +      +      +  P   W +G   I   
Sbjct: 4920 LECSSCVKVVE---VIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI-PA 4975

Query: 570  SGRIRTESYPDSSTLVIDI--AERDDSGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPT 627
                +TE   D + L + I  A  +D   Y + ++ +   A  ++  + V+   P    T
Sbjct: 4976 EPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIEDVT 5035

Query: 628  VTE 630
            + E
Sbjct: 5036 IYE 5038



 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 31/92 (33%), Positives = 43/92 (46%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEI 1106
            P     L N   I G + TL C + G P P +TW +    I     +++    G+  L I
Sbjct: 897  PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 956

Query: 1107 RKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
            R+    D G + C AVN+ GTV   C L V+V
Sbjct: 957  REAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 988



 Score = 61.2 bits (147), Expect = 5e-09
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 6/100 (6%)

Query: 931   RPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH-YHRTS 989
             RP PP++ K+     E + + W PP+ DG  +ITGY ++K +K S  W  V +       
Sbjct: 12026 RPDPPEVTKVSK---EEMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSAIPERR 12082

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
               +  L+  +EY FRV +EN  G+ E +  ++   V+A+D
Sbjct: 12083 MKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR--PVVAKD 12120



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/324 (22%), Positives = 129/324 (39%), Gaps = 19/324 (5%)

Query: 829  LVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID----- 881
            L +E   P +   P  + +  ++++ E  ++V   Q  G P+P + WKK G  +      
Sbjct: 1023 LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 882  KNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
            K   N +  E   +I +  A+   +G+Y + V+ +K  ET S    +++      ++K +
Sbjct: 1083 KVSYNKQTGECKLVISMTFAD--DAGEYTIVVR-NKHGET-SASASLLEEADYELLMKSQ 1138

Query: 942  DVWGENVALTWTPPKDDGNAAITGYTIQKADKK-SMEWFTVIEHYHRTSATITELVIGNE 1000
                    +T    +        G+   + +K+   E   + +   + +  +   V   E
Sbjct: 1139 QEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQE 1198

Query: 1001 YYFRVFSENMCGLSEDATM-TKESAVIARDGKIYKNPVYEDFDFSEAPM--FTQPLVNTY 1057
            ++   F E +    E   + T    ++  DG+     +  D   SEA    F   + N  
Sbjct: 1199 FHISSFEERLIKEIEYRIIKTTLEELLEEDGE---EKMAVDISESEAVESGFDSRIKNYR 1255

Query: 1058 AIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRM-FSNQGVCTLEIRKPSPYDGGT 1116
             + G   T +C + G P PKI W K+   I    RY+M F   G  +L I    P D G 
Sbjct: 1256 ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGI 1315

Query: 1117 YCCKAVNDLGTVEIECKLEVKVIA 1140
            Y   A N  G      KL V+  A
Sbjct: 1316 YTAFASNIKGNAICSGKLYVEPAA 1339



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 96/426 (22%), Positives = 148/426 (34%), Gaps = 58/426 (13%)

Query: 717   VTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAY 775
             +  PPT  +  D V+   VT  W PP++ G   +  YV+E     ST+            
Sbjct: 14786 IPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTT------------ 14833

Query: 776   DLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIE 835
                   W+     +I +T +  T L T  +   RVKA N  G   P   S  I+      
Sbjct: 14834 ------WVELATTVI-RTTYKATRLTTGLEYQFRVKAQNRYGVG-PGITSACIVANY--- 14882

Query: 836   PPKIRIPRHLKQ-TYIRRVGEAVNLVIPF------------QGKPRPELTWKKDGAEIDK 882
             P K+  P    Q T + +    ++   P             + K R  + W+     +  
Sbjct: 14883 PFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVP 14942

Query: 883   NQINIRNSETDTIIF-IRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIE 941
               I   +  TD I +  R    + +GK     K  K  E   + +  ID PG P  + I 
Sbjct: 14943 GNIFKSSGLTDGIAYEFRVIAENMAGKS----KPSKPSEPM-LALDPIDPPGKPVPLNIT 14997

Query: 942   DVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTV-IEHYHRTSATITELVIGNE 1000
                   V L W  P+  G   IT Y ++K D  +  W      +      T++ L     
Sbjct: 14998 R---HTVTLKWAKPEYTGGFKITSYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAA 15054

Query: 1001  YYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIA 1060
             Y FRV ++N  G     +   ++     D +  K  V  D  F +  +           A
Sbjct: 15055 YEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKV--DVKFKDTVILK---------A 15103

Query: 1061  GYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCK 1120
             G    L   V G P P + W K+   +    +  +        L  +  +  D G Y   
Sbjct: 15104 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 15163

Query: 1121  AVNDLG 1126
             A N  G
Sbjct: 15164 ATNPGG 15169



 Score = 57.4 bits (137), Expect = 8e-08
 Identities = 95/406 (23%), Positives = 148/406 (36%), Gaps = 54/406 (13%)

Query: 694   IFAVNAIGISKPSMPSRPFVPLAVTSPPT-LLTVDSVTDTTVTMRWRPPDHIGAAGLDGY 752
             I AVN +G +   M       L    PP   +  +SV+   +T+ W PP   G + +  Y
Sbjct: 9824  ITAVNNLGTASKEMRLNV---LGRPGPPVGPIKFESVSADQMTLSWFPPKDDGGSKITNY 9880

Query: 753   VLEYCFEGSTSAKQSDENGEAAYDLPAEDWIVANKDLIDKTKFTITGLPTDAKIFVRVKA 812
             V+E                    +   + W+  + +  + T +TI  L    +   R+ A
Sbjct: 9881  VIE------------------KREANRKTWVHVSSEPKECT-YTIPKLLEGHEYVFRIMA 9921

Query: 813   VNAAGASEPKYYSQPILVKEIIEPPKIRIPRHLKQTYIRRVGEAVNLVIP-FQGKPRPEL 871
              N  G  EP   S+P   + +   P    P     + + R    VN   P + G      
Sbjct: 9922  QNKYGIGEP-LDSEPETARNLFSVPGA--PDKPTVSSVTRNSMTVNWEEPEYDGGSPVTG 9978

Query: 872   TW--KKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQVKVDKF----VETASID 925
              W   KD       ++N    +  T+    K      G  D Q +V       V  AS+ 
Sbjct: 9979  YWLEMKDTTSKRWKRVNRDPIKAMTLGVSYKVTGLIEGS-DYQFRVYAINAAGVGPASLP 10037

Query: 926   IQI------IDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
                      I  PGPP   K+ D    +  L W+PP  DG + +TGY ++  ++   EW 
Sbjct: 10038 SDPATARDPIAPPGPP-FPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWE 10096

Query: 980   TVIEHYHR-TSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVY 1038
                +   R T   +T L  G  Y FRV + N+ G+ E   +T    VI    ++    + 
Sbjct: 10097 KGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTD---VIEMKDRLVSPDLQ 10153

Query: 1039  EDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNK 1084
              D    +              AG    +   V G P P +TW  N+
Sbjct: 10154 LDASVRD---------RIVVHAGGVIRIIAYVSGKPPPTVTWNMNE 10190



 Score = 57.0 bits (136), Expect = 1e-07
 Identities = 43/167 (25%), Positives = 72/167 (43%), Gaps = 11/167 (6%)

Query: 345 TKQLEDTTAYCGERVELECEVSEDDA-NVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIE 403
           T+ L+      G     E  +S      V WF++G+ I        +I     +  L I 
Sbjct: 9   TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68

Query: 404 GATKADAAEYSVMTTGGQSSAKLSVDL------KPLKILTPLTDQTVNLGKEICLKCEIS 457
             TKA++  YS+  T G   A  + +L       P   +  L   TV  G ++ L+  ++
Sbjct: 69  AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128

Query: 458 ENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIANALTEDEGDY 501
             IP    K+ ++G  +Q S   ++  +G ++ L+IA A  ED G Y
Sbjct: 129 -GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 39/140 (27%), Positives = 56/140 (40%), Gaps = 9/140 (6%)

Query: 1003  FRVFSENMCGLSEDATM---TKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI 1059
             F+   E +  +SE       T ES V  +       P+      S  P+    L +T   
Sbjct: 26439 FKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPI------SSKPVIVTGLQDTTVS 26492

Query: 1060  AGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCC 1119
             +   A       G P+P   W K+  AI    +Y++  ++G   LEI K    D G Y C
Sbjct: 26493 SDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTC 26552

Query: 1120  KAVNDLGTVEIECKLEVKVI 1139
                N  G+V   CKL +K I
Sbjct: 26553 TVKNSAGSVSSSCKLTIKAI 26572



 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 74/348 (21%), Positives = 121/348 (34%), Gaps = 77/348 (22%)

Query: 865   GKPRPELTWKKDGAEIDKN-QINIRNSETDTIIFIRKAERSHSGKYD------------- 910
             G+PRP   W KDG  I +  +  +   +    + I K + S SG Y              
Sbjct: 26505 GEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSS 26564

Query: 911   --LQVKVDKFVETASIDIQIIDRPGPPQIVKIED------VWGENVALTWTPP------K 956
               L +K  K  E   +  Q      P +   +++      +  E + ++          K
Sbjct: 26565 CKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALK 26624

Query: 957   DDGNAAITGYTIQKADKKSMEWFTVIEHYHRTS-------------ATITELVIGNEYYF 1003
             ++ +  +    ++K+   S+E   V E   +TS             A  T++ I NE   
Sbjct: 26625 EEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSI-NEGQR 26683

Query: 1004  RVFSENMCGLSE-----------------------DATMT------KESAVIARDGKIYK 1034
              V   N+ G ++                       D T+T      ++  ++    K  +
Sbjct: 26684 LVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKE 26743

Query: 1035  NPVYEDFDF------SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV 1088
               V   +D       S+AP F     +     G N    C + G P P+I W KN + I 
Sbjct: 26744 GIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS 26803

Query: 1089  DDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
                   +  ++ V +LEIR  S  D G Y  KA N  G       L V
Sbjct: 26804 ISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV 26851



 Score = 54.7 bits (130), Expect = 5e-07
 Identities = 52/221 (23%), Positives = 77/221 (34%), Gaps = 45/221 (20%)

Query: 920  ETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWF 979
            +TA  D++++ RP P      E  W             DG   +  YT +          
Sbjct: 1426 QTARFDLKVVGRPMP------ETFWFH-----------DGQQIVNDYTHK---------- 1458

Query: 980  TVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYE 1039
             VI+     S  I      +   + V ++N  G S  + +    AV              
Sbjct: 1459 VVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV-------------- 1504

Query: 1040 DFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFS 1097
              +    PMF + L N     G    +     GNP P I W+KN   IV    P+ R+  
Sbjct: 1505 --EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEG 1562

Query: 1098 NQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
             +G   L+I      D   Y   A+N  G     CK+ V+V
Sbjct: 1563 TKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1603



 Score = 52.8 bits (125), Expect = 2e-06
 Identities = 86/414 (20%), Positives = 162/414 (39%), Gaps = 69/414 (16%)

Query: 263  QVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIF--EHKGCQRILFINNCQMTDD 319
            +V  G  VRF   ++  PK E++W+ N Q I P+   +F  E      ++ I +      
Sbjct: 3429 RVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHA 3488

Query: 320  SEYYV----TAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEVSEDDANVKWF 375
             +Y      +AG+  C+  L        VT +  ++  +  ER+E E E+   + +  + 
Sbjct: 3489 GQYSCKAANSAGEATCAATL-------TVTPKAPESILH--ERIEQEIEMEMKEFSSSFL 3539

Query: 376  KNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGGQSSAKLSVDLKPLKI 435
               EE +   + +   ++     +L          +E  V  T   S  + +  +     
Sbjct: 3540 SAEEEGLHSAELQLS-KINETLELL----------SESPVYPTKFDSEKEGTGPI----F 3584

Query: 436  LTPLTDQTVNLGKEICLKCEISENIPG---KWTKNGLPVQESDRLKVVHKGRIHKLVIAN 492
            +  +++  +++G    L   +   IP    +W  NG+ +  S   K V  G  H L+I  
Sbjct: 3585 IKEVSNADISMGDVATLSVTVI-GIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILF 3643

Query: 493  ALTEDEGDYV-FAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRL------ 545
               EDEG+Y   A + Y  T+ +    I+      +G     T + +A +  +L      
Sbjct: 3644 TKLEDEGEYTCMASNDYGKTICSAYLKINSKG---EGHKDTETESAVAKSLEKLGGPCPP 3700

Query: 546  -------------------EIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVI 586
                               E  + GEP P   W + +K +          +   S T ++
Sbjct: 3701 HFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIV 3760

Query: 587  DIAERDDSGVYHINLKNEAGEAHASIKVKVV----DFPDPPV-APTVTEVGDDW 635
            +  +R+DSG+Y    +N  GE+  + ++ V+    D  D P  A +  E  +D+
Sbjct: 3761 NDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPEAPEDF 3814



 Score = 51.2 bits (121), Expect = 5e-06
 Identities = 56/305 (18%), Positives = 122/305 (40%), Gaps = 22/305 (7%)

Query: 842   PRHLKQTYIRRVGEAVNLVIPFQ--GKPRPELTWKKDGAEID-KNQINIRNSETDTIIFI 898
             P  + Q   + + E  N++   +  G+P PE+ W K+   I   + ++I  S     + I
Sbjct: 26762 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 26821

Query: 899   RKAERSHSGKYDLQVKVDKFVETASIDIQIIDR-PGPPQIVKIEDVWGENVALTWTPPKD 957
             R A  S SGKY ++ K  +   +A+  + ++     P + V +      ++  +++    
Sbjct: 26822 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSV 26881

Query: 958   DGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDA 1017
               +A+    +       S    T ++    ++ +++ +    E +  + S +  G+S   
Sbjct: 26882 QMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM---QESFVEMSSSSFMGISNMT 26938

Query: 1018  TMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAI-AGYNATLNCSVRGNPKP 1076
              +   ++ + + G                P   + L +  +I  G   T+ C+  G P P
Sbjct: 26939 QLESSTSKMLKAG------------IRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTP 26986

Query: 1077  KITWM--KNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
             ++TW     K+   +  R+ + +   + TL I      DGG Y     N+ G+      +
Sbjct: 26987 EVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 27046

Query: 1135  EVKVI 1139
              ++ I
Sbjct: 27047 HIRSI 27051



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 59/283 (20%), Positives = 97/283 (34%), Gaps = 70/283 (24%)

Query: 854  GEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRKAERSHSGKYDLQV 913
            GE+V L     G P P +TW ++  +I+                                
Sbjct: 911  GESVTLECHISGYPSPTVTWYREDYQIE-------------------------------- 938

Query: 914  KVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADK 973
                    +SID QI  + G  +++  E    ++   T +   + G  + + Y   +   
Sbjct: 939  --------SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ--- 987

Query: 974  KSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIY 1033
                   V E + + +  +TE     E   + F E+   +  D ++T+E A        Y
Sbjct: 988  -------VSEEFEKETTAVTEKFTTEE---KRFVESRDVVMTDTSLTEEQAGPGEPAAPY 1037

Query: 1034 KNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRY 1093
                            T+P+V    + G +    C V GNPKP + W K+ V +    RY
Sbjct: 1038 --------------FITKPVVQKL-VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1082

Query: 1094 RMFSNQ--GVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKL 1134
            ++  N+  G C L I      D G Y     N  G       L
Sbjct: 1083 KVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 48.9 bits (115), Expect = 3e-05
 Identities = 86/372 (23%), Positives = 145/372 (38%), Gaps = 68/372 (18%)

Query: 784  VANKDLIDKTKFTITGLPTDAKIFVRV---KAVNAAGASE-PKYYSQPILVKEIIEPPKI 839
            V  +DL+ K    ++G+P + ++ +++   +A+ AA ASE P  +S+ +   E +E   +
Sbjct: 4134 VQGRDLLSKESL-LSGIPEEQRLNLKIQICRALQAAVASEQPGLFSEWLRNIEKVEVEAV 4192

Query: 840  RI---PRHLKQTYI----RRVGEAVNLVIPFQGKPRPELTWKKDGA--EIDKNQINIRNS 890
             I   PRH+   Y+    + V E V ++I         L  +   A   I   +I+I  +
Sbjct: 4193 NITQEPRHIMCMYLVTSAKSVTEEVTIIIEDVDPQMANLKMELRDALCAIIYEEIDILTA 4252

Query: 891  ETDTIIFIRKAERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVA- 949
            E   I            K  LQ ++D F  +  ++           ++  E+V   NV  
Sbjct: 4253 EGPRI--------QQGAKTSLQEEMDSFSGSQKVEPITEPEVESKYLISTEEVSYFNVQS 4304

Query: 950  ----LTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRV 1005
                L  TP      +A+       +D+K  E     E    +S+               
Sbjct: 4305 RVKYLDATPVTKGVASAVV------SDEKQDESLKPSEEKEESSSE-------------- 4344

Query: 1006 FSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNAT 1065
                  G  E AT+  + A    +G + K          + PM   PLV+T +  G    
Sbjct: 4345 -----SGTEEVATVKIQEA----EGGLIKE---------DGPMIHTPLVDTVSEEGDIVH 4386

Query: 1066 LNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDG-GTYCCKAVND 1124
            L  S+  N K ++ W      +  D +++   +Q   TL I K +  D  G Y C+A+ND
Sbjct: 4387 LTTSIT-NAK-EVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALND 4444

Query: 1125 LGTVEIECKLEV 1136
             G      KL V
Sbjct: 4445 SGKTATSAKLTV 4456



 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 51/213 (23%), Positives = 86/213 (40%), Gaps = 21/213 (9%)

Query: 932  PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSAT 991
            P  P+ +   +     + L W  P+ +G + I GY I+K      ++  V +    T++ 
Sbjct: 8923 PTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSF 8982

Query: 992  ITELVIGNEYY-FRVFSENMCGLSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFT 1050
            + E +  ++ Y FRV + N  G SE +       V+ +D ++               +  
Sbjct: 8983 LVENLDEHQMYEFRVKAVNEIGESEPSLPLN---VVIQDDEVPPT----------IKLRL 9029

Query: 1051 QPLVNTYAI-AGYNATLNCSVRGNPKPKITWMKNKVAI------VDDPRYRMFSNQGVCT 1103
                +T  + AG    +   V G P PKI W KN+  I      +   +  +  ++    
Sbjct: 9030 SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTE 9089

Query: 1104 LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
            L I K    D GTY   A N LG+V     +EV
Sbjct: 9090 LSIPKAVREDKGTYTVTASNRLGSVFRNVHVEV 9122



 Score = 47.4 bits (111), Expect = 8e-05
 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 2/96 (2%)

Query: 1044 SEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDD--PRYRMFSNQGV 1101
            ++AP FTQPL +   + G  AT    + G P P+++W ++   I     P  ++  + G 
Sbjct: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62

Query: 1102 CTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
              L I   +  + G Y  KA N  G      +L VK
Sbjct: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 64/324 (19%), Positives = 119/324 (36%), Gaps = 26/324 (8%)

Query: 835  EPPKIRIPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKN-QINIRNSETD 893
            EPP++   + L+   ++  G+         G+P+P+++W K+   +    +    +   +
Sbjct: 3191 EPPQVL--QELQPVTVQS-GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQE 3247

Query: 894  TIIFIRKAERSHSGKYDLQVKVDKFVET--ASIDIQIIDRPGPPQ---------IVKIED 942
              + + +A    +  Y  + K D  V T  AS+ +++ +   P Q         I  ++D
Sbjct: 3248 YTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQD 3307

Query: 943  -VWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEY 1001
             V  E     +       +  ++ Y+  K  K S  +F + +        I E    +E 
Sbjct: 3308 TVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPS-RFFRMTQFEDTYQLEIAEAYPEDEG 3366

Query: 1002 YFRVFSENMCG-------LSEDATMTKESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLV 1054
             +   + N  G       LS +     E         +  +  ++     + P F QPL 
Sbjct: 3367 TYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLS 3426

Query: 1055 NTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV--DDPRYRMFSNQGVCTLEIRKPSPY 1112
            +     G     +  V G PKP+I W  N+  I+   D  +    + G+  + I      
Sbjct: 3427 SLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSE 3486

Query: 1113 DGGTYCCKAVNDLGTVEIECKLEV 1136
              G Y CKA N  G       L V
Sbjct: 3487 HAGQYSCKAANSAGEATCAATLTV 3510



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 36/105 (34%), Positives = 48/105 (45%), Gaps = 4/105 (3%)

Query: 512 LPAKVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSG 571
           +PA V +   P  ++ GL     VTVI G  + LE  ISG P P   W R D  I E S 
Sbjct: 886 VPAPVEIPVTPPTLVSGL---KNVTVIEGESVTLECHISGYPSPTVTWYREDYQI-ESSI 941

Query: 572 RIRTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV 616
             +       + L+I  A  +DSG +  +  NEAG    S  + V
Sbjct: 942 DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 29/93 (31%), Positives = 42/93 (45%), Gaps = 3/93 (3%)

Query: 1047  PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIV---DDPRYRMFSNQGVCT 1103
             P FT PL N  A  G N     ++  +P+P +TW K+   I    +D +Y   S++G+  
Sbjct: 25318 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 25377

Query: 1104  LEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
             L I   +  D   Y   A N  G    + KL V
Sbjct: 25378 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25410



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 1034 KNPVYEDFDFSE----APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVD 1089
            ++PVY     SE     P+F + + N     G  ATL+ +V G PKPKI W  N V +  
Sbjct: 3565 ESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTP 3624

Query: 1090 DPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEV 1136
               Y+   +    +L I      D G Y C A ND G       L++
Sbjct: 3625 SADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI 3671



 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 25/93 (26%), Positives = 42/93 (45%)

Query: 1046 APMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLE 1105
            AP+  + +       G+ A   C ++  P  +  W K    I +  +  + S++ + +LE
Sbjct: 4461 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLE 4520

Query: 1106 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
            I +    D G Y CKA N+ G+V     L V V
Sbjct: 4521 ILRTQVVDCGEYTCKASNEYGSVSCTATLTVTV 4553



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 30/96 (31%), Positives = 39/96 (40%), Gaps = 3/96 (3%)

Query: 1047 PMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSN-QGVCTLE 1105
            P F + L       G  A    +V G P P +TW K    +     Y +  N  G  T  
Sbjct: 3700 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3759

Query: 1106 IRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIAQ 1141
            +  P   D G Y CKA N LG  E  C  E+ V+ +
Sbjct: 3760 VNDPQREDSGLYICKAENMLG--ESTCAAELLVLLE 3793



 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 29/100 (29%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 932   PGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKADKKSMEWFTVIEH--YHRTS 989
             P  P    + +V  ++  +TW  P D G   IT Y ++K +  S  W  V +   +  T 
Sbjct: 10640 PDAPDQPIVTEVTKDSALVTWNKPHDGGKP-ITNYILEKRETMSKRWARVTKDPIHPYTK 10698

Query: 990   ATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARD 1029
               + +L+ G +Y FRV +EN  G+ + +  +K   V A+D
Sbjct: 10699 FRVPDLLEGCQYEFRVSAENEIGIGDPSPPSK--PVFAKD 10736



 Score = 44.7 bits (104), Expect = 5e-04
 Identities = 62/284 (21%), Positives = 105/284 (36%), Gaps = 51/284 (17%)

Query: 869  PELT--WKKDGAEID-KNQINIRNSETDTIIFIRKAERSHSGKYDL----QVKVDK-FVE 920
            P++T  W KD  E+   ++I I+  +    + I     S +GKY +     V   K FVE
Sbjct: 3038 PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3097

Query: 921  TASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNA------AITGYTIQKADKK 974
               + I+ I +       +++ +  +   + +   +DD +A          + +Q+  K 
Sbjct: 3098 GRDVRIRSIKK-------EVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK- 3149

Query: 975  SMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGKIYK 1034
                + V    HR   + T      EY F V   N   ++                 +Y 
Sbjct: 3150 ----YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVT-----------------LYV 3187

Query: 1035 NPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYR 1094
            N         E P   Q L      +G  A     + G P+PKI+W K +  +    + +
Sbjct: 3188 NA-------PEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3240

Query: 1095 MFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKV 1138
               +    TL + +  P D   Y C+A ND G       L V+V
Sbjct: 3241 FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEV 3284



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 1/98 (1%)

Query: 534 TVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDD 593
           ++TV  G+++RL++ ++G P P   + R D A ++ S   +     D  +L+I  A  +D
Sbjct: 112 SMTVRQGSQVRLQVRVTGIPTPVVKFYR-DGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170

Query: 594 SGVYHINLKNEAGEAHASIKVKVVDFPDPPVAPTVTEV 631
           SG Y +N  N  G A ++ ++ V    + P   T T V
Sbjct: 171 SGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIV 208



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 64/320 (20%), Positives = 110/320 (34%), Gaps = 40/320 (12%)

Query: 315   QMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVELECEV-SEDDANVK 373
             Q T + +Y      E  S + F  +    +T ++      CG+       V S+  A VK
Sbjct: 25981 QKTSERKY------EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVK 26034

Query: 374   WFKNGEEIIPGPKSRYRIRVEGKKHILIIEGAT-------------KADAAEYSVM-TTG 419
             W+ NG E+    K  Y     G   + I++  T             K +A++Y+ +  TG
Sbjct: 26035 WYHNGVELQESSKIHYT-NTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTG 26093

Query: 420   GQSSAKLSV---DLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDR 476
             G  +   S    +  P  +   LT              E+  +   +  K+ +       
Sbjct: 26094 GDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESL 26153

Query: 477   LKVVHKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVT 536
                 H       + + AL E   +          TL A++            L    ++T
Sbjct: 26154 SSYEHSASAE--MKSAALEEKSLEEKSTTRKIKTTLAARI------------LTKPRSMT 26199

Query: 537   VIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGV 596
             V  G   R      GEP P   W R  + ++  S R +  +    ST  I   +  D G 
Sbjct: 26200 VYEGESARFSCDTDGEPVPTVTWLRKGQ-VLSTSARHQVTTTKYKSTFEISSVQASDEGN 26258

Query: 597   YHINLKNEAGEAHASIKVKV 616
             Y + ++N  G+  A   + +
Sbjct: 26259 YSVVVENSEGKQEAEFTLTI 26278



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 94/440 (21%), Positives = 160/440 (36%), Gaps = 71/440 (16%)

Query: 246  REEKKSAAFAKILDPAYQVDKGGRVRFVVELAD-PKLEVKWYKNGQEIRPSTKYIFEHKG 304
            ++EK+        +P  +V +G   RF   +   P+ +V WY NGQ IR S ++   + G
Sbjct: 1789 QKEKQKPDIVLYPEPV-RVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG 1847

Query: 305  CQRILFINNCQMTDDSEYYVTAG------DEKCSTELFVREP------------------ 340
                L I +C+  D  E  VTA       + K   E+  RE                   
Sbjct: 1848 I-HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVH 1906

Query: 341  --------------PIMVTKQLEDTTAYCGERVELECEVSEDDANVKWFKNGE-----EI 381
                          P+  T+  E       ER+  E    E +     FK        E 
Sbjct: 1907 EPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEA 1966

Query: 382  IPGPKSRYRIRVEGKKHIL-------------IIEGATKADAAEYSV-MTTGGQSSAKLS 427
            I   + + R + E  + +L             + E   KA A E  + + T      +LS
Sbjct: 1967 ITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELS 2026

Query: 428  VDLKPLKILTPLTDQTVNLGKEICLKCEI--SENIPGKWTKNGLPVQESDRLK-VVHKGR 484
              ++  KI   +  QTV  G +   +  +    +   +W KNG+ ++ SDR+     +  
Sbjct: 2027 PSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDN 2086

Query: 485  IHKLVIANALTEDEGDYVFAPDAYNVTLPAKVH---VIDPPKIILDGLDADNTVTVIAGN 541
            + +LVI +   ED    +    A N+      H   ++   ++I    +  + V      
Sbjct: 2087 VCELVIRDVTAEDSASIMV--KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2144

Query: 542  KLRLEIPISGEPPPKAMWSRGDKAIMEGSG-RIRTE-SYPDSSTLVIDIAERDDSGVYHI 599
                E   S EP  K  W +    + EG   R+ ++      S L ID ++ +D     +
Sbjct: 2145 MATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLV 2203

Query: 600  NLKNEAGEAHASIKVKVVDF 619
              +N    A   ++  VV+F
Sbjct: 2204 EDENVKTTAKLIVEGAVVEF 2223



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 1059 IAGYNATLNCSVRGNPKPKITWMKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYC 1118
            + G  A   C V G P+PK+ W  N   I    R+R+    G+  L+I     YD G   
Sbjct: 1807 LEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVK 1865

Query: 1119 CKAVNDLGTVEIECKLEVK 1137
              A N  G +E + KLE++
Sbjct: 1866 VTAENPEGVIEHKVKLEIQ 1884



 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 59/286 (20%), Positives = 102/286 (35%), Gaps = 24/286 (8%)

Query: 854   GEAVNLVIPFQGKPRPELTWKKDGAEI-DKNQINIRNSETDTIIFIRKAERSHSGKYDLQ 912
             G+    ++  Q KP  E+ W  +G E+ + ++I+  N+     + I       SG Y  +
Sbjct: 26016 GQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTY--R 26073

Query: 913   VKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGNAAITGYTIQKAD 972
                  +   AS D   +D  G            E V  +  P      A    Y +    
Sbjct: 26074 AVCTNYKGEAS-DYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA----YAVSSFK 26128

Query: 973   KKS-MEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMTKESAVIARDGK 1031
             K S ME  + +       + +TE             E++      A+   +SA +     
Sbjct: 26129 KTSEMEASSSVRE---VKSQMTET-----------RESLSSYEHSASAEMKSAALEEKSL 26174

Query: 1032  IYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITWMKNKVAIVDDP 1091
               K+   +      A + T+P   T    G +A  +C   G P P +TW++    +    
Sbjct: 26175 EEKSTTRKIKTTLAARILTKPRSMT-VYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSA 26233

Query: 1092  RYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVK 1137
             R+++ + +   T EI      D G Y     N  G  E E  L ++
Sbjct: 26234 RHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 26279



 Score = 43.5 bits (101), Expect = 0.001
 Identities = 61/263 (23%), Positives = 104/263 (39%), Gaps = 35/263 (13%)

Query: 261   AYQVDKGGRVRFVVEL-ADPKLEVKWYKNGQEIRPSTKYIFEHKGCQRILFINNCQMTDD 319
             +++V  G   RF++ + + P  EVKWY NG E++ S+K  + +      L I +C  TDD
Sbjct: 26010 SHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCH-TDD 26068

Query: 320   SEYY------------------VTAGD-EKCSTELFVREPPIMVTKQLEDTTAYCGERVE 360
             S  Y                  VT GD    +++    E P  V  +L  T AY     +
Sbjct: 26069 SGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFK 26128

Query: 361   LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG 420
                E+ E  ++V+  K+         +  R  +   +H      + +  +A     +   
Sbjct: 26129 KTSEM-EASSSVREVKS-------QMTETRESLSSYEH----SASAEMKSAALEEKSLEE 26176

Query: 421   QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEI-SENIPG-KWTKNGLPVQESDRLK 478
             +S+ +        +ILT     TV  G+     C+   E +P   W + G  +  S R +
Sbjct: 26177 KSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQ 26236

Query: 479   VVHKGRIHKLVIANALTEDEGDY 501
             V          I++    DEG+Y
Sbjct: 26237 VTTTKYKSTFEISSVQASDEGNY 26259



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 41/170 (24%), Positives = 67/170 (39%), Gaps = 16/170 (9%)

Query: 464  WTKNGLPVQESDRLKVVHK-GRIHKLVIANALTEDEGDYVFAPD--------AYNVTLPA 514
            W  +G  +      KVV K      L+I  A   D G++             +  +T+ A
Sbjct: 1444 WFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEA 1503

Query: 515  KVHVIDPPKIILDGLDADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGS-GRI 573
              H + P  +     +    V +  G++L +++  +G P P  +W +    I+     +I
Sbjct: 1504 VEHQVKPMFV-----EKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKI 1558

Query: 574  RTESYPDSSTLVIDIAERDDSGVYHINLKNEAGEAHASIKVKV-VDFPDP 622
            R E     + L ID     DS  Y     N+AG      KV V V+F +P
Sbjct: 1559 RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEP 1608



 Score = 43.1 bits (100), Expect = 0.001
 Identities = 67/327 (20%), Positives = 116/327 (35%), Gaps = 65/327 (19%)

Query: 344   VTKQLEDTTAYCGERVELECEVSEDDAN--VKWFKNGEEIIPGPKSRYRIRVEGKKHILI 401
             V+ Q+       G  V+  C++   D +  V W+    ++    K  Y I  E    IL 
Sbjct: 25198 VSGQIMHAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEK--YEITYEDGVAILY 25255

Query: 402   IEGATKADAAEY--SVMTTGGQSSAKLSVDLK---------------------------- 431
             ++  TK D   Y   V+   G+ S+   + +K                            
Sbjct: 25256 VKDITKLDDGTYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLE 25315

Query: 432   -PLKILTPLTDQTVNLGKEICLKCEISENIPGK--WTKNGLPVQESDRLKVV----HKGR 484
              P +   PL ++T  +G+ +     I+ +      W K+G  ++  D  K       KG 
Sbjct: 25316 RPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG- 25374

Query: 485   IHKLVIANALTEDEGDYV------FAPDAYNVTLPAKVHVIDPP---------KIILDGL 529
             +++L I +  T+D+ +Y       +  D+    L   +H   PP         K +L   
Sbjct: 25375 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLH--PPPTDSTLRPMFKRLLANA 25432

Query: 530   DADNTVTVIAGNKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIA 589
             +         G  +  EI +SG PPP   W +  + +  G          D   L I   
Sbjct: 25433 ECQE------GQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDT 25486

Query: 590   ERDDSGVYHINLKNEAGEAHASIKVKV 616
               +D+G Y +   N AG       ++V
Sbjct: 25487 LPEDTGYYRVTATNTAGSTSCQAHLQV 25513



 Score = 42.7 bits (99), Expect = 0.002
 Identities = 33/111 (29%), Positives = 46/111 (41%), Gaps = 5/111 (4%)

Query: 1021 KESAVIARDGKI----YKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKP 1076
            +E   +A +GKI    +K    E     EAP   + + +     G +A     V G P P
Sbjct: 2002 EEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDP 2061

Query: 1077 KITWMKNKVAIVDDPR-YRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLG 1126
            +  W KN V I    R Y  +    VC L IR  +  D  +   KA+N  G
Sbjct: 2062 ECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2112



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 31/101 (30%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 1022 ESAVIARDGKIYKNPVYEDFDFSEAPM-FTQPLVNTYAIAGYNATLNCSVRGNPKPKITW 1080
            E  + A+