Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 116284392

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|116284392 mucin 2 precursor [Homo sapiens]
         (5179 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|116284392 mucin 2 precursor [Homo sapiens]                        1.102e+04   0.0  
gi|239749951 PREDICTED: similar to mucin 2 [Homo sapiens]            2806   0.0  
gi|153945878 mucin 5, subtype B, tracheobronchial [Homo sapiens]     1670   0.0  
gi|161019170 mucin 5AC [Homo sapiens]                                1643   0.0  
gi|169202626 PREDICTED: similar to mucin 5, partial [Homo sapiens]   1516   0.0  
gi|91982772 mucin 17 [Homo sapiens]                                  1214   0.0  
gi|151301154 mucin 6, gastric [Homo sapiens]                         1191   0.0  
gi|167736355 mucin 4 isoform a [Homo sapiens]                         832   0.0  
gi|239750277 PREDICTED: hypothetical protein XP_002347351 [Homo ...   773   0.0  
gi|239744587 PREDICTED: hypothetical protein XP_002343203 [Homo ...   766   0.0  
gi|239743293 PREDICTED: mucin 12 [Homo sapiens]                       758   0.0  
gi|89191868 von Willebrand factor preproprotein [Homo sapiens]        753   0.0  
gi|169205253 PREDICTED: hypothetical protein [Homo sapiens]           664   0.0  
gi|83367077 mucin 16 [Homo sapiens]                                   625   e-178
gi|239755545 PREDICTED: otogelin isoform 1 [Homo sapiens]             615   e-175
gi|239755543 PREDICTED: otogelin isoform 2 [Homo sapiens]             615   e-175
gi|239749989 PREDICTED: otogelin isoform 2 [Homo sapiens]             615   e-175
gi|239749987 PREDICTED: otogelin isoform 1 [Homo sapiens]             615   e-175
gi|239744300 PREDICTED: otogelin isoform 2 [Homo sapiens]             615   e-175
gi|239744298 PREDICTED: otogelin isoform 1 [Homo sapiens]             615   e-175
gi|239755901 PREDICTED: chromosome 12 open reading frame 64 [Hom...   555   e-157
gi|239750386 PREDICTED: chromosome 12 open reading frame 64 [Hom...   555   e-157
gi|239744688 PREDICTED: hypothetical protein LOC283310 [Homo sap...   555   e-157
gi|134031945 SCO-spondin [Homo sapiens]                               550   e-155
gi|239755460 PREDICTED: similar to mucin, partial [Homo sapiens]      537   e-151
gi|169168665 PREDICTED: hypothetical protein [Homo sapiens]           498   e-140
gi|239740898 PREDICTED: hypothetical protein [Homo sapiens]           498   e-140
gi|239754269 PREDICTED: hypothetical protein [Homo sapiens]           498   e-140
gi|239740674 PREDICTED: hypothetical protein [Homo sapiens]           498   e-140
gi|239740645 PREDICTED: hypothetical protein [Homo sapiens]           498   e-140

>gi|116284392 mucin 2 precursor [Homo sapiens]
          Length = 5179

 Score = 1.102e+04 bits (28595), Expect = 0.0
 Identities = 5179/5179 (100%), Positives = 5179/5179 (100%)

Query: 1    MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD 60
            MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD
Sbjct: 1    MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD 60

Query: 61   YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP 120
            YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
Sbjct: 61   YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP 120

Query: 121  HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE 180
            HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
Sbjct: 121  HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE 180

Query: 181  FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL 240
            FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Sbjct: 181  FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL 240

Query: 241  VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV 300
            VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
Sbjct: 241  VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV 300

Query: 301  YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY 360
            YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
Sbjct: 301  YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY 360

Query: 361  TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG 420
            TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
Sbjct: 361  TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG 420

Query: 421  DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA 480
            DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA
Sbjct: 421  DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA 480

Query: 481  SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK 540
            SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
Sbjct: 481  SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK 540

Query: 541  TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR 600
            TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
Sbjct: 541  TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR 600

Query: 601  CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS 660
            CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS
Sbjct: 601  CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS 660

Query: 661  CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC 720
            CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
Sbjct: 661  CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC 720

Query: 721  YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR 780
            YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR
Sbjct: 721  YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR 780

Query: 781  ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN 840
            ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
Sbjct: 781  ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN 840

Query: 841  TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF 900
            TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
Sbjct: 841  TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF 900

Query: 901  SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV 960
            SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
Sbjct: 901  SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV 960

Query: 961  ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS 1020
            ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
Sbjct: 961  ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS 1020

Query: 1021 WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC 1080
            WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
Sbjct: 1021 WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC 1080

Query: 1081 SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR 1140
            SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
Sbjct: 1081 SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR 1140

Query: 1141 SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA 1200
            SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
Sbjct: 1141 SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA 1200

Query: 1201 SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT 1260
            SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT
Sbjct: 1201 SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT 1260

Query: 1261 RPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD 1320
            RPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD
Sbjct: 1261 RPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD 1320

Query: 1321 GDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCY 1380
            GDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCY
Sbjct: 1321 GDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCY 1380

Query: 1381 DYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSP 1440
            DYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSP
Sbjct: 1381 DYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSP 1440

Query: 1441 PITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP 1500
            PITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP
Sbjct: 1441 PITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP 1500

Query: 1501 SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTT 1560
            SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTT
Sbjct: 1501 SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTT 1560

Query: 1561 TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP 1620
            TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP
Sbjct: 1561 TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP 1620

Query: 1621 PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT 1680
            PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT
Sbjct: 1621 PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT 1680

Query: 1681 PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP 1740
            PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP
Sbjct: 1681 PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP 1740

Query: 1741 TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFH 1800
            TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFH
Sbjct: 1741 TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFH 1800

Query: 1801 KPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGV 1860
            KPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGV
Sbjct: 1801 KPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGV 1860

Query: 1861 IPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPT 1920
            IPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPT
Sbjct: 1861 IPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPT 1920

Query: 1921 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 1980
            TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
Sbjct: 1921 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 1980

Query: 1981 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2040
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
Sbjct: 1981 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2040

Query: 2041 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2100
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
Sbjct: 2041 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2100

Query: 2101 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2160
            QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
Sbjct: 2101 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2160

Query: 2161 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2220
            TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 2161 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2220

Query: 2221 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2280
            TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
Sbjct: 2221 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2280

Query: 2281 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2340
            PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
Sbjct: 2281 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2340

Query: 2341 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2400
            TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
Sbjct: 2341 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2400

Query: 2401 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2460
            TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
Sbjct: 2401 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2460

Query: 2461 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2520
            PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
Sbjct: 2461 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2520

Query: 2521 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2580
            PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
Sbjct: 2521 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2580

Query: 2581 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2640
            TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
Sbjct: 2581 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2640

Query: 2641 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2700
            TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
Sbjct: 2641 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2700

Query: 2701 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2760
            PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
Sbjct: 2701 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2760

Query: 2761 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2820
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP
Sbjct: 2761 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2820

Query: 2821 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2880
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT
Sbjct: 2821 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2880

Query: 2881 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2940
            GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT
Sbjct: 2881 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2940

Query: 2941 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3000
            TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 2941 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3000

Query: 3001 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3060
            TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
Sbjct: 3001 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3060

Query: 3061 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3120
            PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI
Sbjct: 3061 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3120

Query: 3121 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3180
            TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG
Sbjct: 3121 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3180

Query: 3181 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3240
            TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT
Sbjct: 3181 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3240

Query: 3241 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3300
            VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT
Sbjct: 3241 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3300

Query: 3301 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3360
            TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
Sbjct: 3301 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3360

Query: 3361 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3420
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
Sbjct: 3361 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3420

Query: 3421 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3480
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
Sbjct: 3421 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3480

Query: 3481 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3540
            QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
Sbjct: 3481 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3540

Query: 3541 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3600
            TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 3541 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3600

Query: 3601 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3660
            TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
Sbjct: 3601 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3660

Query: 3661 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3720
            PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
Sbjct: 3661 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3720

Query: 3721 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3780
            TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
Sbjct: 3721 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3780

Query: 3781 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3840
            TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
Sbjct: 3781 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3840

Query: 3841 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3900
            PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
Sbjct: 3841 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3900

Query: 3901 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3960
            PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
Sbjct: 3901 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3960

Query: 3961 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4020
            TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
Sbjct: 3961 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4020

Query: 4021 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 4080
            TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
Sbjct: 4021 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 4080

Query: 4081 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4140
            PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
Sbjct: 4081 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4140

Query: 4141 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTH 4200
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTH
Sbjct: 4141 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTH 4200

Query: 4201 TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPT 4260
            TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPT
Sbjct: 4201 TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPT 4260

Query: 4261 TTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSII 4320
            TTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSII
Sbjct: 4261 TTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSII 4320

Query: 4321 RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTP 4380
            RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTP
Sbjct: 4321 RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTP 4380

Query: 4381 SPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATCKYNNT 4440
            SPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATCKYNNT
Sbjct: 4381 SPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATCKYNNT 4440

Query: 4441 VEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQ 4500
            VEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQ
Sbjct: 4441 VEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQ 4500

Query: 4501 GNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQV 4560
            GNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQV
Sbjct: 4501 GNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQV 4560

Query: 4561 QVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKG 4620
            QVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKG
Sbjct: 4561 QVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKG 4620

Query: 4621 QCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGK 4680
            QCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGK
Sbjct: 4621 QCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGK 4680

Query: 4681 TTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAAL 4740
            TTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAAL
Sbjct: 4681 TTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAAL 4740

Query: 4741 CAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEG 4800
            CAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEG
Sbjct: 4741 CAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEG 4800

Query: 4801 TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT 4860
            TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT
Sbjct: 4801 TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT 4860

Query: 4861 HCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWC 4920
            HCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWC
Sbjct: 4861 HCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWC 4920

Query: 4921 ESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELM 4980
            ESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELM
Sbjct: 4921 ESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELM 4980

Query: 4981 EAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNIT 5040
            EAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNIT
Sbjct: 4981 EAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNIT 5040

Query: 5041 CPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG 5100
            CPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG
Sbjct: 5041 CPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG 5100

Query: 5101 SCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCG 5160
            SCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCG
Sbjct: 5101 SCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCG 5160

Query: 5161 LPTGTSRRARRSPRHLGSG 5179
            LPTGTSRRARRSPRHLGSG
Sbjct: 5161 LPTGTSRRARRSPRHLGSG 5179


>gi|239749951 PREDICTED: similar to mucin 2 [Homo sapiens]
          Length = 2639

 Score = 2806 bits (7275), Expect = 0.0
 Identities = 1307/1350 (96%), Positives = 1316/1350 (97%), Gaps = 8/1350 (0%)

Query: 3830 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3889
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3890 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3949
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3950 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4009
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 4010 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4069
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 4070 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4129
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 4130 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 4189
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 4190 PTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 4249
            PT   TGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 4250 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTP 4309
            TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTP
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTP 1769

Query: 4310 TPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTL 4369
            TPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTL
Sbjct: 1770 TPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTL 1829

Query: 4370 EFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCD 4429
            EFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCD
Sbjct: 1830 EFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCD 1889

Query: 4430 CFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHY 4489
            CFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHY
Sbjct: 1890 CFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHY 1949

Query: 4490 VTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVL 4549
            VTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVL
Sbjct: 1950 VTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVL 2009

Query: 4550 IKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRL 4609
            IKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRL
Sbjct: 2010 IKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRL 2069

Query: 4610 PYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTK 4669
            PYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTK
Sbjct: 2070 PYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTK 2129

Query: 4670 RPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSL 4729
            RPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSL
Sbjct: 2130 RPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSL 2189

Query: 4730 ECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNT 4789
            ECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNT
Sbjct: 2190 ECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNT 2249

Query: 4790 VLVEGCFCPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIIC 4849
            VLVEGCFCPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIIC
Sbjct: 2250 VLVEGCFCPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIIC 2309

Query: 4850 QPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKM 4909
            QPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKM
Sbjct: 2310 QPKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKM 2369

Query: 4910 VPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPC 4969
            VPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPC
Sbjct: 2370 VPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPC 2429

Query: 4970 NTSCSPGFELMEAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIH 5029
            NTSCSPGFELMEAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIH
Sbjct: 2430 NTSCSPGFELMEAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIH 2489

Query: 5030 NQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGC 5089
            NQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGC
Sbjct: 2490 NQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGC 2549

Query: 5090 TKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHI 5149
            TKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHI
Sbjct: 2550 TKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHI 2609

Query: 5150 ESCQCQDTVCGLPTGTSRRARRSPRHLGSG 5179
            ESCQCQDTVCGLPTGTSRRARRSPRHLGSG
Sbjct: 2610 ESCQCQDTVCGLPTGTSRRARRSPRHLGSG 2639



 Score = 2305 bits (5973), Expect = 0.0
 Identities = 1166/1544 (75%), Positives = 1224/1544 (79%), Gaps = 88/1544 (5%)

Query: 445  KTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQV 504
            KTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQV
Sbjct: 346  KTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQV 405

Query: 505  QLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCH 564
            QLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCH
Sbjct: 406  QLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCH 465

Query: 565  DKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNN 624
            DKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNN
Sbjct: 466  DKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNN 525

Query: 625  EDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEA 684
            EDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEA
Sbjct: 526  EDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEA 585

Query: 685  DSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRD 744
            DSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRD
Sbjct: 586  DSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRD 645

Query: 745  GRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPD 804
            GRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPD
Sbjct: 646  GRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPD 705

Query: 805  GLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYG 864
            GLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYG
Sbjct: 706  GLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYG 765

Query: 865  SGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFM 924
            SGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFM
Sbjct: 766  SGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFM 825

Query: 925  GRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSY 984
            GRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSY
Sbjct: 826  GRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSY 885

Query: 985  KGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRR 1044
            KGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRR
Sbjct: 886  KGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRR 945

Query: 1045 SWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTK 1104
            SWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTK
Sbjct: 946  SWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTK 1005

Query: 1105 EGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCY 1164
            EGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCY
Sbjct: 1006 EGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCY 1065

Query: 1165 PRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPE 1224
            PRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPE
Sbjct: 1066 PRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPE 1125

Query: 1225 EGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITTRPSTLTTFTTITLPTTPTTFTTTT 1284
            EGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITTRPSTLTTFTTITLPTTPTTFTTTT
Sbjct: 1126 EGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITTRPSTLTTFTTITLPTTPTTFTTTT 1185

Query: 1285 TTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDP 1344
            TTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDP
Sbjct: 1186 TTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDP 1245

Query: 1345 HLSLEQLGQKVQ--CDVSVGFICKNEDQFGNG--PFGLCYDYKIRVNCCWPMDKCITTPS 1400
            HLSLEQLGQKVQ  CDVSVG ICKNEDQ   G  P   C +Y+I V CC    +C+T P+
Sbjct: 1246 HLSLEQLGQKVQLVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCC----ECVTQPT 1301

Query: 1401 PPTTT----PSPPP-TSTTTLPPT--------TTPSPPTTTTT---TPPPTTTPSP---P 1441
              TTT    P+P P T+TTT+ PT        TTP+P TTTTT   TP PT T +P   P
Sbjct: 1302 TMTTTTTENPTPTPITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTPTPTGTQTPTTTP 1361

Query: 1442 ITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPS 1501
            ITTTTT  PT TP+   + TTTP  TTT   PT TP+   T  S P TTTTT  PT TP+
Sbjct: 1362 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPT 1421

Query: 1502 PPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTT 1561
              T TP T P +TTT   T TP+P  T T  P PT   +  T TP   PT T T  PTTT
Sbjct: 1422 -GTQTPTTTPITTTT---TVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGTQT--PTTT 1475

Query: 1562 PSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTT---TPPPTTTPSP---PTTTTTTPPPT 1615
            P    TTTTT  PT TP+   T TP+  T TTT   TP PT T +P   P TTTTT  PT
Sbjct: 1476 PI---TTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTVTPT 1532

Query: 1616 TTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTT---TPSPPTTTTPSPP---I 1669
             TP+   T   TP ++TTT+ PT TP+   T TTTP  TT   TP+P  T T +P    I
Sbjct: 1533 PTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTVLI 1592

Query: 1670 TTTTTPPPTTTPSSPITTTPSPPTTTMT---TPSPTTTPSS---PITTTTTPSSTTTPS- 1722
            TTTTT  PT TP+S  +TT +P TTT T   TP+PT T +    PI+TTTT + T TP+ 
Sbjct: 1593 TTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPTPTT 1652

Query: 1723 ----PPPTTMTTP-SPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTT 1777
                PP  T T P +  TT +PP  + T     +TSSPLT +    S  PP     ST  
Sbjct: 1653 GSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAP 1712

Query: 1778 PTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANIS--------------- 1822
            P+TP  P     G   S  P+       T   G   G   A   S               
Sbjct: 1713 PSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPT 1772

Query: 1823 -------CRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQC 1875
                    R T     P   L   + C ++       E+   G      + +N  ++   
Sbjct: 1773 PLSTPSIIRTTGLRPYPSSVL---ICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLS--- 1826

Query: 1876 CECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTP 1919
            C       +  +T +  PTP  +TP  +  + TP+    GT+ P
Sbjct: 1827 CTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPP 1870



 Score =  881 bits (2277), Expect = 0.0
 Identities = 479/743 (64%), Positives = 530/743 (71%), Gaps = 56/743 (7%)

Query: 1732 SPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGW 1791
            S TT PS  TT  T   PTT ++  TTT    + T PT S   +TTP   C+    W+ W
Sbjct: 1158 SITTRPSTLTTFTTITLPTTPTTFTTTT----TTTTPTSSTVLSTTPKLCCL----WSDW 1209

Query: 1792 LDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTV--VCDVSVGLI 1849
            ++   P+     GD E    VCG     +I CR+   P + + QLGQ V  VCDVSVGLI
Sbjct: 1210 INEDHPSSGSDDGDRETFDGVCGA--PEDIECRSVKDPHLSLEQLGQKVQLVCDVSVGLI 1267

Query: 1850 CKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTP 1909
            CKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTP   TPITTTTTVTP
Sbjct: 1268 CKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTP---TPITTTTTVTP 1324

Query: 1910 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 1969
            TPTPT TQ+ T TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP
Sbjct: 1325 TPTPTSTQSTTPTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 1384

Query: 1970 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2029
            ITTTTTVTPTPTPTGTQTPT+TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT
Sbjct: 1385 ITTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 1444

Query: 2030 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2089
            GTQ PT T ITTT+TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTT
Sbjct: 1445 GTQAPTPTAITTTSTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTT 1504

Query: 2090 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2149
            TVTPTPTPTGTQTPT+TPITTTTTVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTP
Sbjct: 1505 TVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTP 1564

Query: 2150 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2209
            TTTPITTTTTVTPTPTPTGTQTPTT  ITTTTT+TPTPTPT T++ T TPITTTTTVT T
Sbjct: 1565 TTTPITTTTTVTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTAT 1624

Query: 2210 PTPTGTQTPTTTPITTTTTVTPTPTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT- 2263
            PTPTGTQTPT  PI+TTTTVTPTPTPT   T  PT   T PI   TT  P P  +  QT 
Sbjct: 1625 PTPTGTQTPTMIPISTTTTVTPTPTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTS 1684

Query: 2264 -PTTTPITTTTTVTPTPTP----TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPIT 2316
              T++P+T +TT+  T  P    T T  P+  T P TT+   T +P P+ T +P  TP  
Sbjct: 1685 RSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTR 1744

Query: 2317 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2376
             TTT +     +   TP+T   TTT+  TPTPTP  T +     I  TT + P P    +
Sbjct: 1745 GTTTGS-----SSAPTPSTVQTTTTSAWTPTPTPLSTPS-----IIRTTGLRPYP----S 1790

Query: 2377 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV-----------TPTPTPTGTQTP 2425
                   +  T          GT   T   +  + +            TP+PTPT +++ 
Sbjct: 1791 SVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKST 1850

Query: 2426 TTTPITTTTTVTPTPTPTGTQTP 2448
             T    ++T   PTP   GT+ P
Sbjct: 1851 PTPSKPSSTPSKPTP---GTKPP 1870



 Score =  731 bits (1887), Expect = 0.0
 Identities = 399/592 (67%), Positives = 433/592 (73%), Gaps = 42/592 (7%)

Query: 3715 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3774
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3775 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3834
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3835 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3894
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3895 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3954
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3955 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4014
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 4015 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 4074
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 4075 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 4123
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 4124 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4181
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 4182 TTVTPTPTPTGT-----QTGPPTHTSTAPIAEL--TTSNPPPESSTPQTSRSTSSPLTES 4234
            +  TPTPTP  T      TG   + S+  I  +   T   P E     T   T   +   
Sbjct: 1765 SAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVN-- 1822

Query: 4235 TTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGT 4286
                 +L   +E  + + PSTP +PT T    T  P PS  +S P  PT GT
Sbjct: 1823 ----CSLSCTLEFYNWSCPSTP-SPTPTPSKST--PTPSKPSSTPSKPTPGT 1867



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 1967 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2026
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2027 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2086
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2087 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2146
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2147 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2206
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2207 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2266
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2267 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2326
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2327 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 2375
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 2376 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2433
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 2434 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2493
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 2494 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2540
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2059 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2118
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2119 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2178
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2179 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2238
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2239 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2298
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2299 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2358
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2359 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2418
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2419 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 2467
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 2468 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2525
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 2526 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2585
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 2586 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2632
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2151 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2210
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2211 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2270
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2271 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2330
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2331 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2390
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2391 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2450
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2451 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2510
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2511 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 2559
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 2560 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2617
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 2618 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2677
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 2678 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2724
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2243 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2302
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2303 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2362
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2363 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2422
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2423 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2482
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2483 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2542
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2543 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2602
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2603 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 2651
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 2652 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2709
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 2710 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2769
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 2770 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2816
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2335 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2394
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2395 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2454
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2455 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2514
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2515 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2574
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2575 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2634
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2635 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2694
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2695 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 2743
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 2744 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2801
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 2802 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2861
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 2862 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2908
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2427 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2486
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2487 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2546
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2547 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2606
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2607 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2666
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2667 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2726
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2727 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2786
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2787 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 2835
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 2836 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2893
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 2894 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2953
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 2954 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3000
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2519 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2578
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2579 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2638
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2639 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2698
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2699 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2758
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2759 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2818
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2819 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2878
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2879 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 2927
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 2928 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2985
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 2986 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3045
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3046 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3092
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2611 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2670
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2671 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2730
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2731 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2790
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2791 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2850
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2851 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2910
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 2911 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2970
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 2971 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3019
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3020 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3077
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3078 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3137
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3138 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3184
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2703 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2762
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2763 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2822
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2823 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2882
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2883 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2942
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 2943 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3002
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3003 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3062
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3063 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3111
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3112 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3169
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3170 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3229
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3230 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3276
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2795 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2854
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2855 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2914
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 2915 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2974
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 2975 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3034
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3035 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3094
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3095 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3154
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3155 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3203
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3204 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3261
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3262 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3321
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3322 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3368
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2887 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2946
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 2947 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3006
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3007 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3066
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3067 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3126
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3127 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3186
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3187 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3246
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3247 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3295
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3296 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3353
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3354 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3413
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3414 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3460
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 2979 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3038
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3039 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3098
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3099 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3158
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3159 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3218
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3219 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3278
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3279 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3338
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3339 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3387
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3388 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3445
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3446 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3505
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3506 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3552
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 3071 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3130
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3131 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3190
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3191 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3250
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3251 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3310
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3311 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3370
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3371 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3430
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3431 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3479
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3480 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3537
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3538 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3597
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3598 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3644
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 3163 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3222
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3223 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3282
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3283 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3342
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3343 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3402
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3403 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3462
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3463 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3522
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3523 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3571
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3572 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3629
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3630 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3689
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3690 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3736
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 3255 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3314
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3315 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3374
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3375 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3434
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3435 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3494
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3495 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3554
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3555 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3614
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3615 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3663
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3664 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3721
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3722 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3781
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3782 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3828
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 3347 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3406
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3407 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3466
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3467 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3526
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3527 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3586
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3587 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3646
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3647 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3706
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3707 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3755
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3756 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3813
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3814 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3873
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3874 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3920
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 3439 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3498
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3499 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3558
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3559 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3618
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3619 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3678
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3679 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3738
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3739 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3798
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3799 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3847
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3848 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3905
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3906 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3965
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 3966 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4012
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  730 bits (1884), Expect = 0.0
 Identities = 394/598 (65%), Positives = 432/598 (72%), Gaps = 49/598 (8%)

Query: 3531 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3590
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3591 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3650
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3651 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3710
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3711 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3770
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3771 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3830
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3831 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3890
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3891 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 3939
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 3940 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3997
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 3998 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 4057
            +  TPTPTP  T +     I  TT + P P    +       +  T          GT  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGTYG 1815

Query: 4058 PTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4104
             T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1816 DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  729 bits (1882), Expect = 0.0
 Identities = 393/594 (66%), Positives = 430/594 (72%), Gaps = 64/594 (10%)

Query: 3623 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3682
            T P T TTT T  PTPT        PITTTTTVTPTPTPT TQ+ T TPITTTTTVTPTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTVTPTPTPTSTQSTTPTPITTTTTVTPTP 1349

Query: 3683 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3742
            TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TPIT
Sbjct: 1350 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPIT 1409

Query: 3743 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3802
            TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPTGT
Sbjct: 1410 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGT 1469

Query: 3803 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3862
            QTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTTTV
Sbjct: 1470 QTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTV 1529

Query: 3863 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3922
            TPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
Sbjct: 1530 TPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1589

Query: 3923 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3982
              ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPT
Sbjct: 1590 VLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPT 1649

Query: 3983 PT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP----TG 4031
            PT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    T 
Sbjct: 1650 PTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTS 1709

Query: 4032 TQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4089
            T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   TTT
Sbjct: 1710 TAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTTTT 1764

Query: 4090 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-------------------TGTQTPTTT 4130
            +  TPTPTP  T +     I  TT + P P+                     GT   T  
Sbjct: 1765 SAWTPTPTPLSTPS-----IIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCY 1819

Query: 4131 PITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4173
             +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1820 FVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  721 bits (1860), Expect = 0.0
 Identities = 416/733 (56%), Positives = 467/733 (63%), Gaps = 65/733 (8%)

Query: 1924 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP---ITTTTTVTPTP 1980
            I + TT   T T   T T  TTP T TTT T T TPT +   +TTP      +  +    
Sbjct: 1156 ICSITTRPSTLTTFTTITLPTTPTTFTTTTT-TTTPTSSTVLSTTPKLCCLWSDWINEDH 1214

Query: 1981 TPTGTQ------------TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2028
              +G+              P      +      +    G +      ++           
Sbjct: 1215 PSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQLVCDVSVGLICKNEDQK 1274

Query: 2029 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--------PITTTTTVTPTPTPTGTQTP 2080
             G   P    +     V      T   T TTT        PITTTTTVTPTPTPT TQ+ 
Sbjct: 1275 PGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPTPITTTTTVTPTPTPTSTQST 1334

Query: 2081 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2140
            T TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
Sbjct: 1335 TPTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 1394

Query: 2141 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2200
            PTPTGTQTPT+TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T I
Sbjct: 1395 PTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAI 1454

Query: 2201 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2260
            TTT+TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTG
Sbjct: 1455 TTTSTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTG 1514

Query: 2261 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2320
            TQTPT+TPITTTTTVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTT
Sbjct: 1515 TQTPTSTPITTTTTVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTT 1574

Query: 2321 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 2380
            VTPTPTPTGTQTPTT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT
Sbjct: 1575 VTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPT 1634

Query: 2381 TTPITTTTTVTPTPTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTT 2433
              PI+TTTTVTPTPTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +
Sbjct: 1635 MIPISTTTTVTPTPTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTES 1694

Query: 2434 TTVTPTPTP----TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2487
            TT+  T  P    T T  P+  T P TT+   T +P P+ T +P  TP   TTT +    
Sbjct: 1695 TTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS---- 1750

Query: 2488 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2547
             +   TP+T   TTT+  TPTPTP  T +     I  TT + P P    +       +  
Sbjct: 1751 -SSAPTPSTVQTTTTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLND 1800

Query: 2548 TTTVTPTPTPTGTQTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTT 2596
            T          GT   T   +  + +            TP+PTPT +++  T    ++T 
Sbjct: 1801 TYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTP 1860

Query: 2597 VTPTPTPTGTQTP 2609
              PTP   GT+ P
Sbjct: 1861 SKPTP---GTKPP 1870



 Score =  721 bits (1860), Expect = 0.0
 Identities = 416/733 (56%), Positives = 467/733 (63%), Gaps = 65/733 (8%)

Query: 2568 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP---ITTTTTVTPTP 2624
            I + TT   T T   T T  TTP T TTT T T TPT +   +TTP      +  +    
Sbjct: 1156 ICSITTRPSTLTTFTTITLPTTPTTFTTTTT-TTTPTSSTVLSTTPKLCCLWSDWINEDH 1214

Query: 2625 TPTGTQ------------TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2672
              +G+              P      +      +    G +      ++           
Sbjct: 1215 PSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQLVCDVSVGLICKNEDQK 1274

Query: 2673 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--------PITTTTTVTPTPTPTGTQTP 2724
             G   P    +     V      T   T TTT        PITTTTTVTPTPTPT TQ+ 
Sbjct: 1275 PGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPTPITTTTTVTPTPTPTSTQST 1334

Query: 2725 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2784
            T TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
Sbjct: 1335 TPTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 1394

Query: 2785 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2844
            PTPTGTQTPT+TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T I
Sbjct: 1395 PTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAI 1454

Query: 2845 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2904
            TTT+TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTG
Sbjct: 1455 TTTSTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTG 1514

Query: 2905 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2964
            TQTPT+TPITTTTTVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTT
Sbjct: 1515 TQTPTSTPITTTTTVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTT 1574

Query: 2965 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3024
            VTPTPTPTGTQTPTT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT
Sbjct: 1575 VTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPT 1634

Query: 3025 TTPITTTTTVTPTPTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTT 3077
              PI+TTTTVTPTPTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +
Sbjct: 1635 MIPISTTTTVTPTPTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTES 1694

Query: 3078 TTVTPTPTP----TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3131
            TT+  T  P    T T  P+  T P TT+   T +P P+ T +P  TP   TTT +    
Sbjct: 1695 TTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS---- 1750

Query: 3132 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3191
             +   TP+T   TTT+  TPTPTP  T +     I  TT + P P    +       +  
Sbjct: 1751 -SSAPTPSTVQTTTTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLND 1800

Query: 3192 TTTVTPTPTPTGTQTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTT 3240
            T          GT   T   +  + +            TP+PTPT +++  T    ++T 
Sbjct: 1801 TYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTP 1860

Query: 3241 VTPTPTPTGTQTP 3253
              PTP   GT+ P
Sbjct: 1861 SKPTP---GTKPP 1870



 Score =  721 bits (1860), Expect = 0.0
 Identities = 416/733 (56%), Positives = 467/733 (63%), Gaps = 65/733 (8%)

Query: 3212 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP---ITTTTTVTPTP 3268
            I + TT   T T   T T  TTP T TTT T T TPT +   +TTP      +  +    
Sbjct: 1156 ICSITTRPSTLTTFTTITLPTTPTTFTTTTT-TTTPTSSTVLSTTPKLCCLWSDWINEDH 1214

Query: 3269 TPTGTQ------------TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3316
              +G+              P      +      +    G +      ++           
Sbjct: 1215 PSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQLVCDVSVGLICKNEDQK 1274

Query: 3317 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--------PITTTTTVTPTPTPTGTQTP 3368
             G   P    +     V      T   T TTT        PITTTTTVTPTPTPT TQ+ 
Sbjct: 1275 PGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPTPITTTTTVTPTPTPTSTQST 1334

Query: 3369 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3428
            T TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
Sbjct: 1335 TPTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 1394

Query: 3429 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3488
            PTPTGTQTPT+TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T I
Sbjct: 1395 PTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAI 1454

Query: 3489 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3548
            TTT+TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTG
Sbjct: 1455 TTTSTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTG 1514

Query: 3549 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3608
            TQTPT+TPITTTTTVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTT
Sbjct: 1515 TQTPTSTPITTTTTVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTT 1574

Query: 3609 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3668
            VTPTPTPTGTQTPTT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT
Sbjct: 1575 VTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPT 1634

Query: 3669 TTPITTTTTVTPTPTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTT 3721
              PI+TTTTVTPTPTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +
Sbjct: 1635 MIPISTTTTVTPTPTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTES 1694

Query: 3722 TTVTPTPTP----TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3775
            TT+  T  P    T T  P+  T P TT+   T +P P+ T +P  TP   TTT +    
Sbjct: 1695 TTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS---- 1750

Query: 3776 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3835
             +   TP+T   TTT+  TPTPTP  T +     I  TT + P P    +       +  
Sbjct: 1751 -SSAPTPSTVQTTTTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLND 1800

Query: 3836 TTTVTPTPTPTGTQTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTT 3884
            T          GT   T   +  + +            TP+PTPT +++  T    ++T 
Sbjct: 1801 TYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTP 1860

Query: 3885 VTPTPTPTGTQTP 3897
              PTP   GT+ P
Sbjct: 1861 SKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 393/611 (64%), Positives = 433/611 (70%), Gaps = 53/611 (8%)

Query: 3646 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3703
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3704 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3763
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3764 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3823
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3824 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3883
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3884 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3943
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3944 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 4003
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 4004 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 4052
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 4053 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4110
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 4111 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4170
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 4171 QTPTTTPITTTTTV-----------TPTPTPTGTQTGP-PTHTSTAPIAELTTSNPP--P 4216
               T   +  + +            TP+PTPT +++ P P+  S+ P      + PP  P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECP 1873

Query: 4217 ESSTPQTSRST 4227
            +   P+    T
Sbjct: 1874 DFDPPRQENET 1884



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2082 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2139
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2140 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2199
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2200 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2259
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2260 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2319
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2320 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2379
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2380 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2439
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2440 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2488
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2489 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2546
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2547 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2606
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2607 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2655
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2105 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2162
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2163 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2222
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2223 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2282
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2283 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2342
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2343 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2402
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2403 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2462
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2463 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2511
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2512 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2569
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2570 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2629
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2630 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2678
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2128 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2185
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2186 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2245
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2246 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2305
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2306 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2365
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2366 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2425
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2426 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2485
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2486 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2534
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2535 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2592
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2593 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2652
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2653 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2701
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2174 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2231
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2232 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2291
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2292 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2351
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2352 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2411
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2412 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2471
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2472 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2531
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2532 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2580
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2581 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2638
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2639 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2698
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2699 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2747
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2197 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2254
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2255 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2314
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2315 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2374
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2375 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2434
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2435 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2494
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2495 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2554
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2555 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2603
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2604 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2661
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2662 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2721
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2722 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2770
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2220 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2277
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2278 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2337
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2338 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2397
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2398 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2457
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2458 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2517
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2518 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2577
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2578 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2626
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2627 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2684
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2685 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2744
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2745 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2793
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2266 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2323
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2324 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2383
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2384 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2443
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2444 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2503
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2504 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2563
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2564 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2623
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2624 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2672
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2673 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2730
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2731 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2790
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2791 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2839
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2289 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2346
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2347 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2406
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2407 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2466
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2467 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2526
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2527 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2586
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2587 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2646
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2647 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2695
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2696 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2753
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2754 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2813
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2814 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2862
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2312 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2369
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2370 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2429
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2430 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2489
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2490 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2549
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2550 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2609
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2610 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2669
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2670 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2718
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2719 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2776
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2777 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2836
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2837 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2885
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2358 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2415
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2416 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2475
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2476 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2535
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2536 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2595
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2596 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2655
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2656 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2715
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2716 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2764
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2765 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2822
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2823 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2882
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2883 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2931
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2381 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2438
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2439 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2498
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2499 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2558
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2559 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2618
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2619 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2678
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2679 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2738
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2739 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2787
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2788 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2845
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2846 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2905
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2906 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2954
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2404 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2461
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2462 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2521
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2522 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2581
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2582 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2641
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2642 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2701
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2702 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2761
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2762 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2810
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2811 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2868
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2869 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2928
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2929 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2977
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2450 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2507
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2508 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2567
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2568 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2627
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2628 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2687
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2688 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2747
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2748 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2807
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2808 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2856
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2857 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2914
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2915 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2974
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2975 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3023
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2473 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2530
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2531 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2590
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2591 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2650
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2651 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2710
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2711 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2770
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2771 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2830
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2831 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2879
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2880 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2937
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2938 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2997
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 2998 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3046
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2496 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2553
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2554 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2613
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2614 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2673
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2674 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2733
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2734 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2793
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2794 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2853
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2854 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2902
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2903 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2960
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 2961 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3020
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3021 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3069
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2542 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2599
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2600 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2659
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2660 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2719
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2720 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2779
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2780 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2839
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2840 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2899
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2900 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2948
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2949 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3006
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3007 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3066
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3067 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3115
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2565 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2622
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2623 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2682
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2683 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2742
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2743 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2802
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2803 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2862
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 2863 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2922
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 2923 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 2971
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 2972 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3029
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3030 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3089
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3090 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3138
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2726 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2783
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2784 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2843
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2844 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2903
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2904 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2963
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2964 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3023
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3024 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3083
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3084 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3132
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3133 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3190
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3191 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3250
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3251 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3299
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2749 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2806
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2807 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2866
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2867 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2926
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2927 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2986
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 2987 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3046
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3047 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3106
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3107 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3155
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3156 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3213
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3214 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3273
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3274 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3322
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2772 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2829
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2830 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2889
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2890 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2949
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2950 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3009
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3010 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3069
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3070 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3129
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3130 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3178
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3179 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3236
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3237 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3296
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3297 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3345
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2818 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2875
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2876 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2935
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2936 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2995
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 2996 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3055
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3056 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3115
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3116 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3175
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3176 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3224
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3225 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3282
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3283 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3342
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3343 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3391
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2841 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2898
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2899 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2958
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2959 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3018
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3019 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3078
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3079 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3138
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3139 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3198
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3199 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3247
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3248 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3305
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3306 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3365
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3366 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3414
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2864 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2921
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2922 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2981
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 2982 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3041
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3042 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3101
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3102 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3161
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3162 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3221
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3222 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3270
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3271 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3328
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3329 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3388
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3389 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3437
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2910 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2967
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2968 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3027
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3028 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3087
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3088 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3147
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3148 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3207
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3208 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3267
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3268 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3316
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3317 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3374
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3375 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3434
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3435 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3483
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2933 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 2990
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 2991 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3050
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3051 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3110
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3111 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3170
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3171 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3230
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3231 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3290
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3291 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3339
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3340 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3397
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3398 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3457
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3458 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3506
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 2956 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3013
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3014 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3073
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3074 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3133
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3134 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3193
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3194 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3253
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3254 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3313
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3314 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3362
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3363 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3420
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3421 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3480
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3481 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3529
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3002 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3059
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3060 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3119
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3120 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3179
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3180 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3239
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3240 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3299
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3300 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3359
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3360 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3408
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3409 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3466
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3467 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3526
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3527 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3575
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3025 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3082
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3083 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3142
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3143 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3202
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3203 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3262
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3263 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3322
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3323 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3382
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3383 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3431
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3432 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3489
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3490 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3549
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3550 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3598
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3048 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3105
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3106 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3165
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3166 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3225
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3226 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3285
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3286 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3345
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3346 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3405
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3406 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3454
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3455 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3512
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3513 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3572
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3573 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3621
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3094 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3151
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3152 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3211
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3212 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3271
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3272 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3331
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3332 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3391
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3392 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3451
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3452 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3500
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3501 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3558
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3559 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3618
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3619 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3667
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3117 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3174
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3175 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3234
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3235 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3294
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3295 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3354
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3355 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3414
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3415 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3474
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3475 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3523
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3524 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3581
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3582 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3641
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3642 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3690
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3140 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3197
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3198 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3257
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3258 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3317
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3318 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3377
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3378 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3437
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3438 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3497
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3498 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3546
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3547 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3604
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3605 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3664
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3665 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3713
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3186 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3243
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3244 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3303
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3304 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3363
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3364 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3423
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3424 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3483
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3484 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3543
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3544 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3592
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3593 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3650
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3651 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3710
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3711 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3759
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3209 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3266
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3267 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3326
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3327 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3386
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3387 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3446
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3447 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3506
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3507 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3566
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3567 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3615
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3616 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3673
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3674 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3733
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3734 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3782
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3370 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3427
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3428 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3487
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3488 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3547
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3548 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3607
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3608 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3667
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3668 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3727
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3728 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3776
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3777 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3834
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3835 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3894
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3895 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3943
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3393 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3450
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3451 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3510
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3511 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3570
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3571 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3630
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3631 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3690
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3691 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3750
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3751 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3799
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3800 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3857
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3858 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3917
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3918 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3966
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3416 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3473
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3474 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3533
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3534 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3593
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3594 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3653
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3654 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3713
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3714 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3773
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3774 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3822
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3823 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3880
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3881 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3940
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3941 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3989
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3462 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3519
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3520 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3579
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3580 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3639
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3640 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3699
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3700 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3759
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3760 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3819
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3820 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3868
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3869 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3926
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3927 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3986
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 3987 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4035
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3485 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3542
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3543 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3602
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3603 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3662
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3663 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3722
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3723 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3782
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3783 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3842
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3843 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3891
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3892 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3949
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3950 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4009
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 4010 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4058
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3508 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3565
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3566 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3625
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3626 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3685
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3686 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3745
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3746 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3805
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3806 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3865
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3866 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3914
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3915 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3972
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 3973 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4032
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 4033 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4081
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3554 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3611
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3612 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3671
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3672 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3731
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3732 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3791
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3792 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3851
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3852 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3911
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3912 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3960
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3961 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4018
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 4019 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4078
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 4079 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4127
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1846), Expect = 0.0
 Identities = 392/600 (65%), Positives = 430/600 (71%), Gaps = 53/600 (8%)

Query: 3577 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3634
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3635 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3694
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3695 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3754
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3755 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3814
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3815 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3874
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3875 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3934
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 3935 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 3983
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 3984 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4041
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 4042 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4101
            TT+  TPTPTP  T +     I  TT + P P    +       +  T          GT
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----SSVLICCVLNDTYYAPGEEVYNGT 1813

Query: 4102 QTPTTTPITTTTTV-----------TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4150
               T   +  + +            TP+PTPT +++  T    ++T   PTP   GT+ P
Sbjct: 1814 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTP---GTKPP 1870



 Score =  715 bits (1845), Expect = 0.0
 Identities = 394/612 (64%), Positives = 430/612 (70%), Gaps = 60/612 (9%)

Query: 3669 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTP 3726
            T P T TTT T  PTPT        PITTTTTV    TPTPT TQ+ T TPITTTTTVTP
Sbjct: 1298 TQPTTMTTTTTENPTPT--------PITTTTTV--TPTPTPTSTQSTTPTPITTTTTVTP 1347

Query: 3727 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3786
            TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT+TP
Sbjct: 1348 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTP 1407

Query: 3787 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3846
            ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T ITTT+TVTPTPTPT
Sbjct: 1408 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPT 1467

Query: 3847 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3906
            GTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTGTQTPT+TPITTTT
Sbjct: 1468 GTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTT 1527

Query: 3907 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3966
            TVTPTPTPTGTQTPT TPI+TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
Sbjct: 1528 TVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 1587

Query: 3967 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 4026
            TT  ITTTTT+TPTPTPT T++ T TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPT
Sbjct: 1588 TTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPT 1647

Query: 4027 PTPT--GTQTPT---TTPITTTTTVTPTPTPTGTQT--PTTTPITTTTTVTPTPTP---- 4075
            PTPT   T  PT   T PI   TT  P P  +  QT   T++P+T +TT+  T  P    
Sbjct: 1648 PTPTTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEM 1707

Query: 4076 TGTQTPT--TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4133
            T T  P+  T P TT+   T +P P+ T +P  TP   TTT +     +   TP+T   T
Sbjct: 1708 TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS-----SSAPTPSTVQTT 1762

Query: 4134 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4193
            TT+  TPTPTP  T +     I  TT + P P          + +     +  T    G 
Sbjct: 1763 TTSAWTPTPTPLSTPS-----IIRTTGLRPYP----------SSVLICCVLNDTYYAPGE 1807

Query: 4194 QTGPPTHTSTAPIAELTT---------SNPPPESSTPQTSRSTSSPLTESTTLLSTLPPA 4244
            +    T+  T      +          S P   S TP  S+ST +P   S+T      P+
Sbjct: 1808 EVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSST------PS 1861

Query: 4245 IEMTSTAPPSTP 4256
                 T PP  P
Sbjct: 1862 KPTPGTKPPECP 1873



 Score =  697 bits (1799), Expect = 0.0
 Identities = 332/343 (96%), Positives = 332/343 (96%), Gaps = 5/343 (1%)

Query: 1   MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD 60
           MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD
Sbjct: 1   MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD 60

Query: 61  YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP 120
           YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
Sbjct: 61  YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP 120

Query: 121 HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE 180
           HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
Sbjct: 121 HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE 180

Query: 181 FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL 240
           FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
Sbjct: 181 FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL 240

Query: 241 VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATL-----CPKTC 295
           VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTAT        KTC
Sbjct: 241 VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATSAVSPGASKTC 300

Query: 296 PGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYD 338
           PGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEG   D
Sbjct: 301 PGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGAQAD 343



 Score =  469 bits (1208), Expect = e-131
 Identities = 298/593 (50%), Positives = 336/593 (56%), Gaps = 67/593 (11%)

Query: 3856 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP---ITTTTTVTPTP 3912
            I + TT   T T   T T  TTP T TTT T T TPT +   +TTP      +  +    
Sbjct: 1156 ICSITTRPSTLTTFTTITLPTTPTTFTTTTT-TTTPTSSTVLSTTPKLCCLWSDWINEDH 1214

Query: 3913 TPTGTQ------------TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3960
              +G+              P      +      +    G +      ++           
Sbjct: 1215 PSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQLVCDVSVGLICKNEDQK 1274

Query: 3961 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--------PITTTTTVTPTPTPTGTQTP 4012
             G   P    +     V      T   T TTT        PITTTTTVTPTPTPT TQ+ 
Sbjct: 1275 PGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPTPITTTTTVTPTPTPTSTQST 1334

Query: 4013 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 4072
            T TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
Sbjct: 1335 TPTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 1394

Query: 4073 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 4132
            PTPTGTQTPT+TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ PT T I
Sbjct: 1395 PTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAI 1454

Query: 4133 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 4192
            TTT+TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT T ITTTTTVTPTPTPTG
Sbjct: 1455 TTTSTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTG 1514

Query: 4193 TQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAP 4252
            TQT  PT T   PI   TT  P P  +  QT   T +P++ +TT+  T  P    T T  
Sbjct: 1515 TQT--PTST---PITTTTTVTPTPTPTGTQT--PTPTPISTTTTVTPTPTPTGTQTPTTT 1567

Query: 4253 PSTPTAPTTTSGGHTLSPPPST---TTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTP 4309
            P T T   T +   T +  P+T   TT+   TPT   T+  S+  TP T  TTTT   TP
Sbjct: 1568 PITTTTTVTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPIT--TTTTVTATP 1625

Query: 4310 TPTPLSTPSII---RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLS 4366
            TPT   TP++I    TT + P P+                      T G T    + S +
Sbjct: 1626 TPTGTQTPTMIPISTTTTVTPTPTP---------------------TTGSTGPPTHTSTA 1664

Query: 4367 CTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSST------PSKPTPGTKPPECP 4413
               E    S P   S TP  S+ST +P   S+T      P+     T PP  P
Sbjct: 1665 PIAEL-TTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTP 1716



 Score =  262 bits (669), Expect = 7e-69
 Identities = 230/646 (35%), Positives = 273/646 (42%), Gaps = 192/646 (29%)

Query: 1526 PTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTT 1585
            PTT TTT     T   PT TPIT   +TTT+ PT TP+   +TT TP  TTT   PT T 
Sbjct: 1300 PTTMTTT-----TTENPTPTPIT---TTTTVTPTPTPTSTQSTTPTPITTTTTVTPTPTP 1351

Query: 1586 PSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPP 1645
                T TTT    TTT +P  T T T  PTTTP   TTT    PT T T  PT+TP    
Sbjct: 1352 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTSTPITTT 1411

Query: 1646 TTTT-TPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTT 1704
            TT T TP PT T +P TT     PITTTTT  PT TP+     TP+  TTT T  +PT T
Sbjct: 1412 TTVTPTPTPTGTQTPTTT-----PITTTTTVTPTPTPTGTQAPTPTAITTTSTV-TPTPT 1465

Query: 1705 PSSPITTTTTPSSTTT---PSPPPTTMTTPSPTTTPSPPTTTMTTLPP---TTTSSPLTT 1758
            P+   T TTTP +TTT   P+P PT   TP+PT   +  T T T  P    T TS+P+TT
Sbjct: 1466 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITT 1525

Query: 1759 TPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWA 1818
            T    ++TP   +P  T T T    P+   T    +  P   +    T            
Sbjct: 1526 TT---TVTP---TPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTP----------- 1568

Query: 1819 ANISCRATMYPD-VPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCE 1877
              I+   T+ P   P G    T V                                    
Sbjct: 1569 --ITTTTTVTPTPTPTGTQTPTTVL----------------------------------- 1591

Query: 1878 CVTQPTTMTTTTTENPTPPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 1936
             +T  TTMT T T   T  TT TPITTTTTVT TPTPTGTQTPT  PI+TTTTVTPTPTP
Sbjct: 1592 -ITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPTP 1650

Query: 1937 TG------------------------------TQTPTTTPITTTTTV----------TPT 1956
            T                               T   T++P+T +TT+          T T
Sbjct: 1651 TTGSTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTST 1710

Query: 1957 PTPTGTQTPTTT--------PITTTTTVTPTPT---PTGTQ---TPTTTPITTTTTVTPT 2002
              P+    PTTT        P +TTT+   TPT    TG+    TP+T   TTT+  TPT
Sbjct: 1711 APPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPT 1770

Query: 2003 PTP-------------------------------------TGTQTPT------------- 2012
            PTP                                      GT   T             
Sbjct: 1771 PTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLE 1830

Query: 2013 ----TTPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTP 2051
                + P T + T TP   TPTP+    P++TP   T    P   P
Sbjct: 1831 FYNWSCPSTPSPTPTPSKSTPTPS---KPSSTPSKPTPGTKPPECP 1873



 Score =  220 bits (561), Expect = 2e-56
 Identities = 161/535 (30%), Positives = 241/535 (45%), Gaps = 83/535 (15%)

Query: 251  QQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMD 310
            Q++RC C  G    C  +    + C           TA      C  NL  L +  P   
Sbjct: 637  QEERCVCRDG-RLHCRQIRLIGQSC-----------TAPKIHMDC-SNLTALATSKPRAL 683

Query: 311  TCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDC 370
            +C  L       E  + GC CP+G + D  G  GCV   +C C  +  LY+ G +I  DC
Sbjct: 684  SCQTLAAGYYHTEC-VSGCVCPDGLMDD--GRGGCVVEKECPCVHNNDLYSSGAKIKVDC 740

Query: 371  EQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAK---GDHND--S 425
              C C  GRWVC    C GTC++ G  H  TFDGK Y F G C YV  +   G ++   S
Sbjct: 741  NTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGS 800

Query: 426  YALLGELAPCGSTDKQTCLKTV-------VLLADKKKNVVVFKSDGSVLLNELQVNLPHV 478
            ++++ E  PCG+T   TC K +        L  + K  VV+ + +G            HV
Sbjct: 801  FSIITENVPCGTTG-VTCSKAIKIFMGRTELKLEDKHRVVIQRDEGH-----------HV 848

Query: 479  TASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDD 538
              +    R    +++V  + G+   V       +F+ L  + +G V GLCGNF+    +D
Sbjct: 849  AYT---TREVGQYLVVESSTGI--IVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNND 903

Query: 539  FKTASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPF 598
            F T   +V ++   F N+WK   +C D +    +PCSLN    ++AE  CS+LK   + F
Sbjct: 904  FTTRDHMVVSSELDFGNSWKEAPTCPD-VSTNPEPCSLNPHRRSWAEKQCSILK--SSVF 960

Query: 599  GRCHSAVDPAEYYKRCKYDTCNCQNNED--CLCAALSSYARACTAKGVMLWGWR------ 650
              CHS VDP  +Y+ C +D+C+C    D  C C+A++SYA+ CT +G  ++ WR      
Sbjct: 961  SICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVF-WRTPDLCP 1019

Query: 651  --------EHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGC--GC 700
                     H C      C N            +TCR+++   S+    +  ++GC   C
Sbjct: 1020 IFCDYYNPPHECEWHYEPCGNRSF---------ETCRTINGIHSNISVSY--LEGCYPRC 1068

Query: 701  PDH--TFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQE--ERCVC-RDGRLHCR 750
            P     + ++  +CV   KC CY    +   G  V  +E  + CVC    ++ CR
Sbjct: 1069 PKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCR 1123



 Score =  184 bits (466), Expect = 3e-45
 Identities = 151/406 (37%), Positives = 180/406 (44%), Gaps = 127/406 (31%)

Query: 1397 TTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTT-TPPPTTTPSP---PITTTTTPPPTT 1452
            TTP   TTT +P PT T T  PT T    TTT T TP PT T +P   PITTTTT  PT 
Sbjct: 1474 TTPITTTTTVTPTPTPTGTQTPTPTAITTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTP 1533

Query: 1453 TPS-------PPISTTTTPPPTTTPS---PPTTTPSPPTTTPSP---------PTT---- 1489
            TP+        PISTTTT  PT TP+    PTTTP   TTT +P         PTT    
Sbjct: 1534 TPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTVLIT 1593

Query: 1490 TTTTPPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPIT- 1548
            TTTT  PT TP+   +T +TP  +TTT+  T TP+   T T  P  TTT   PT TP T 
Sbjct: 1594 TTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPTPTTG 1653

Query: 1549 ---PPTSTTTLP--PTTTPSPPPTTTTT--------------------PP--------PT 1575
               PPT T+T P    TT +PPP ++T                     PP        P 
Sbjct: 1654 STGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPP 1713

Query: 1576 TTPSPPTTT----TPSPPTITTTTPPPTTT----------PSPPTTTTTT-------PPP 1614
            +TP+ PTTT    T SPP  TTT+PP T T          P+P T  TTT       P P
Sbjct: 1714 STPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTP 1773

Query: 1615 TTTPSPPTTTPITPPTSTTTL--------------------------------------- 1635
             +TPS   TT + P  S+  +                                       
Sbjct: 1774 LSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYN 1833

Query: 1636 ---PPTTTPSPPPTTTTTPP--PTTTPSPPTTTTPSPPITTTTTPP 1676
               P T +P+P P+ +T  P  P++TPS PT  T  PP      PP
Sbjct: 1834 WSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGT-KPPECPDFDPP 1878



 Score =  140 bits (352), Expect = 4e-32
 Identities = 118/466 (25%), Positives = 199/466 (42%), Gaps = 63/466 (13%)

Query: 4428 CDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDP 4487
            C C      Y++  +I KV+C      TC  G            C    C   C+ +G  
Sbjct: 721  CPCVHNNDLYSSGAKI-KVDCNTC---TCKRGRW---------VCTQAVCHGTCSIYGSG 767

Query: 4488 HYVTFDGLYYSYQGNCTYVLVEEI---SPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHE 4544
            HY+TFDG YY + G+C+YV V++    + S+ +F +  +N  C     V+C + + +   
Sbjct: 768  HYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTG-VTCSKAIKIFMG 826

Query: 4545 TQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLS 4604
              E+ ++  H + +Q   +     VA   ++ G         Y+V     G++V ++  +
Sbjct: 827  RTELKLEDKHRVVIQ---RDEGHHVAYTTREVG--------QYLVVESSTGIIVIWDKRT 875

Query: 4605 FSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHS 4664
                     +     G CG   + +++D       +VS+     + W       P CP  
Sbjct: 876  TVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSW----KEAPTCPDV 931

Query: 4665 SSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFM 4724
            S        T P      PH+       C ++K S+F+ CH+ V P+ +Y+ACV DSC  
Sbjct: 932  S--------TNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSC 983

Query: 4725 -PGSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVEC----PSHR---EYQACGPA 4774
              G   E  C+++ +YA  C ++  C+ WR  T   C + C    P H     Y+ CG  
Sbjct: 984  DTGGDCECFCSAVASYAQECTKEGACVFWR--TPDLCPIFCDYYNPPHECEWHYEPCGNR 1041

Query: 4775 EEPTCKSSSSQQNNTVL--VEGCF--CPEGTMNYAPGFDVCVKT--CGCVGPD-NVPREF 4827
               TC++ +   +N  +  +EGC+  CP+    Y      CV    CGC   D + P   
Sbjct: 1042 SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA 1101

Query: 4828 GEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLATEV 4873
                E  CK+CVC    S ++C+P+   +  + +  +DG +   E+
Sbjct: 1102 SVPTEETCKSCVC-TNSSQVVCRPE---EGKILNQTQDGAFCYWEI 1143



 Score =  140 bits (352), Expect = 4e-32
 Identities = 118/466 (25%), Positives = 199/466 (42%), Gaps = 63/466 (13%)

Query: 820  CPCVHNNDLYSSGAKI-KVDCNTC---TCKRGRW---------VCTQAVCHGTCSIYGSG 866
            C C      Y++  +I KV+C      TC  G            C    C   C+ +G  
Sbjct: 1888 CDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDP 1947

Query: 867  HYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTG-VTCSKAIKIFMG 925
            HY+TFDG YY + G+C+YV V++    + S+ +F +  +N  C     V+C + + +   
Sbjct: 1948 HYVTFDGLYYSYQGNCTYVLVEEI---SPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHE 2004

Query: 926  RTELKLEDKHRVVIQ---RDEGHHVAYTTREVG--------QYLVVESSTGIIVIWDKRT 974
              E+ ++  H + +Q   +     VA   ++ G         Y+V     G++V ++  +
Sbjct: 2005 TQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLS 2064

Query: 975  TVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSW----KEAPTCPDV 1030
                     +     G CG   + +++D       +VS+     + W       P CP  
Sbjct: 2065 FSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHS 2124

Query: 1031 S--------TNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSC 1082
            S        T P      PH+       C ++K S+F+ CH+ V P+ +Y+ACV DSC  
Sbjct: 2125 SSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFM 2184

Query: 1083 DTGGDCECFCSAVASYAQECTKEGACVFWR--TPDLCPIFCDYYNPPHECEWHYEPCGNR 1140
              G   E  C+++ +YA  C ++  C+ WR  T   C + C    P H     Y+ CG  
Sbjct: 2185 -PGSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVEC----PSHR---EYQACGPA 2234

Query: 1141 SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA 1200
               TC++ +   +N  +  +EGC+  CP+    Y      CV    CGC   D + P   
Sbjct: 2235 EEPTCKSSSSQQNNTVL--VEGCF--CPEGTMNYAPGFDVCVKT--CGCVGPD-NVPREF 2287

Query: 1201 SVPTEETCKSCVC-TNSSQVVCRPE---EGKILNQTQDGAFCYWEI 1242
                E  CK+CVC    S ++C+P+   +  + +  +DG +   E+
Sbjct: 2288 GEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLATEV 2333



 Score =  127 bits (319), Expect = 3e-28
 Identities = 100/376 (26%), Positives = 163/376 (43%), Gaps = 36/376 (9%)

Query: 34   HNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRG---SYKEFAVHLKRGPGQAEAPAG 90
            H  CS +G+ HY TFDG  + F G C Y    D  G   S   F++  +  P        
Sbjct: 758  HGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTC 817

Query: 91   VESILLTIKDDTIYL-TRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNR 149
             ++I + +    + L  +H  V+         +       +   Y  V S  G+ ++W++
Sbjct: 818  SKAIKIFMGRTELKLEDKHRVVIQ----RDEGHHVAYTTREVGQYLVVESSTGIIVIWDK 873

Query: 150  EDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDG--VLFSPLEFGNMQKINQPDVVCE 207
               + ++L   ++   CGLCG+++  +S ++F +    V+ S L+FGN  K       C 
Sbjct: 874  RTTVFIKLAPSYKGTVCGLCGNFDH-RSNNDFTTRDHMVVSSELDFGNSWK---EAPTCP 929

Query: 208  DPEEEVAPASCSEHR-----AECERLLTAEAFADCQDLVPLEPYLRACQQDRCRC-PGGD 261
            D      P S + HR      +C  +L +  F+ C   V  +P+  AC  D C C  GGD
Sbjct: 930  DVSTNPEPCSLNPHRRSWAEKQCS-ILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGD 988

Query: 262  -TCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTC-------PGNLVYLESGSPCMDTCS 313
              C CS VA ++++C+  G     WRT  LCP  C            Y   G+   +TC 
Sbjct: 989  CECFCSAVASYAQECTKEGACV-FWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCR 1047

Query: 314  HLE-VSSLCEEHRMDGCF--CPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITND- 369
             +  + S      ++GC+  CP+     +     CV   +C C +    Y PG  +  + 
Sbjct: 1048 TINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEE 1107

Query: 370  -CEQCVC-NAGRWVCK 383
             C+ CVC N+ + VC+
Sbjct: 1108 TCKSCVCTNSSQVVCR 1123



 Score =  114 bits (286), Expect = 2e-24
 Identities = 88/321 (27%), Positives = 141/321 (43%), Gaps = 27/321 (8%)

Query: 84  QAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRA-G 142
           QA+ P  V  +    K+  ++ +    +LN   V+ PH +    + +  +Y  + S A G
Sbjct: 341 QADLPKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIG 400

Query: 143 LTLMWNREDALML--ELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSP-LEFGNMQKI 199
           + L       + L   LD   +    GLCG++NGL+      + G++ +    F N  K 
Sbjct: 401 VRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKA 460

Query: 200 NQPDVVCEDPEE--------EVAPASCSEHRAECERLLTAEA-FADCQDLVPLEPYLRAC 250
                 C D  +         +  A+ +EH   C  L   E  F  C   V    Y + C
Sbjct: 461 QSS---CHDKLDWLDDPCSLNIESANYAEHW--CSLLKKTETPFGRCHSAVDPAEYYKRC 515

Query: 251 QQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPK---TCPGNLVYLESGSP 307
           + D C C   + C+C+ ++ ++R C+  G     WR   +C K   +CP + V+L + + 
Sbjct: 516 KYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWR-EHVCNKDVGSCPNSQVFLYNLTT 574

Query: 308 CMDTCSHL-EVSSLCEE--HRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQ 364
           C  TC  L E  S C E    +DGC CP+ T  D+ G   CVP+++C C   G     G 
Sbjct: 575 CQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKG--RCVPLAKCSCYHRGLYLEAGD 632

Query: 365 EITNDCEQCVCNAGRWVCKDL 385
            +    E+CVC  GR  C+ +
Sbjct: 633 VVVRQEERCVCRDGRLHCRQI 653



 Score =  114 bits (285), Expect = 3e-24
 Identities = 122/519 (23%), Positives = 195/519 (37%), Gaps = 55/519 (10%)

Query: 382  CKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAK--GDHNDSYALLGELAPCGSTD 439
            C    C   C   G  H  TFDG  Y++ G+C YVL +      D++ +  +   C   D
Sbjct: 1932 CWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPND 1991

Query: 440  KQTCLKTVVLLADKK----KNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVS 495
            K +C +T+++  + +    K V +      V +N   V LP+      V++    +++  
Sbjct: 1992 KVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDI 2051

Query: 496  MAIGVRLQVQLAPVMQLFVTLDQASQG-QVQGLCGNFNGLEGDDFKTASGLVEATGAGFA 554
              +GV +       +   V L     G   +G CG       DD    SG + +     A
Sbjct: 2052 PELGVLVSYN---GLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAA 2108

Query: 555  NTW----KAQSSCHDKLDWLDDPCSLNIESANYAEH-------WCSLLKKTETPFGRCHS 603
            + W     ++  C         P            H        C L+K  ++ F +CH+
Sbjct: 2109 DQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIK--DSLFAQCHA 2166

Query: 604  AVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPN 663
             V P  YY  C +D+C         CA+L +YA  C  + + L  WR H     +  CP+
Sbjct: 2167 LVPPQHYYDACVFDSC-FMPGSSLECASLQAYAALCAQQNICL-DWRNHTHGACLVECPS 2224

Query: 664  SQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCY-H 722
             + +       + TC+S S   ++ +     V+GC CP+ T     G  V +  C C   
Sbjct: 2225 HREYQACGPAEEPTCKSSSSQQNNTV----LVEGCFCPEGTMNYAPGFDVCVKTCGCVGP 2280

Query: 723  RGLYLEAGDVVVRQEERCVCRDG--RLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR 780
              +  E G+      + CVC +G   + C+  R     C+   +     + T LAT    
Sbjct: 2281 DNVPREFGEHFEFDCKNCVCLEGGSGIICQPKR-----CSQKPVTHCVEDGTYLATEVNP 2335

Query: 781  ALSCQTLAAGYYHTECV--SGCVCPDGLMDDGR---GGCV----VEKECPCVHNNDLYSS 831
            A +C  +     +T        VCP G     +   G C      E +  CVH N  Y  
Sbjct: 2336 ADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGNAEYQP 2395

Query: 832  GAKI-KVDCNTCTCK--------RGRWVCTQAVCHGTCS 861
            G+ +    C  C C              CT   C+ +CS
Sbjct: 2396 GSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCS 2434



 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 90/342 (26%), Positives = 145/342 (42%), Gaps = 33/342 (9%)

Query: 857  HGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTC 916
            H  CS +G+ HY TFDG  + F G C Y    D  G   S   F++  +  P        
Sbjct: 34   HNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRG---SYKEFAVHLKRGPGQAEAPAG 90

Query: 917  SKAIKIFMGRTELKLEDKHRVVIQ----RDEGHHVAYTTREVGQYLVVESSTGIIVIWDK 972
             ++I + +    + L  +H  V+         +       +   Y  V S  G+ ++W++
Sbjct: 91   VESILLTIKDDTIYL-TRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNR 149

Query: 973  RTTVFIKLAPSYKGTVCGLCGNFDH-RSNNDFTTRDHMVVSSELDFGNSWK---EAPTCP 1028
               + ++L   ++   CGLCG+++  +S ++F +    V+ S L+FGN  K       C 
Sbjct: 150  EDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDG--VLFSPLEFGNMQKINQPDVVCE 207

Query: 1029 DVSTNPEPCSLNPHRRSWAEKQCS-ILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGD 1087
            D      P S + HR      +C  +L +  F+ C   V  +P+  AC  D C C  GGD
Sbjct: 208  DPEEEVAPASCSEHR-----AECERLLTAEAFADCQDLVPLEPYLRACQQDRCRC-PGGD 261

Query: 1088 CECFCSAVASYAQECTKEGACV-FWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCR 1146
              C CS VA ++++C+  G     WRT             P      Y   G+   +TC 
Sbjct: 262  -TCVCSTVAEFSRQCSHAGGRPGNWRTATSAVSPGASKTCPGNLV--YLESGSPCMDTCS 318

Query: 1147 TINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVT--ADK 1186
             +  + S      ++GC+  CP+     + DL K V   ADK
Sbjct: 319  HLE-VSSLCEEHRMDGCF--CPEGA---QADLPKTVVLLADK 354



 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 86/334 (25%), Positives = 143/334 (42%), Gaps = 26/334 (7%)

Query: 391 CALEGGSHITTFDGKTYTFHGDCYYVLA---KGDHNDSYALLGELAPCGSTDKQTCLKTV 447
           C+  G  H  TFDG  + F G C Y  A   +G + + +A+  +  P G  +    ++++
Sbjct: 37  CSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKE-FAVHLKRGP-GQAEAPAGVESI 94

Query: 448 VLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLA 507
           +L     K+  ++ +    +LN   V+ PH +    + +  +Y  + S A G+ L     
Sbjct: 95  LLTI---KDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRA-GLTLMWNRE 150

Query: 508 PVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKL 567
             + L   LD   +    GLCG++NGL+      + G++ +    F N  K         
Sbjct: 151 DALML--ELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSP-LEFGNMQKINQP----- 202

Query: 568 DWLDDPCSLNIESANYAEHW--CSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNE 625
           D + +     +  A+ +EH   C  L   E  F  C   V    Y + C+ D C C   +
Sbjct: 203 DVVCEDPEEEVAPASCSEHRAECERLLTAEA-FADCQDLVPLEPYLRACQQDRCRCPGGD 261

Query: 626 DCLCAALSSYARACTAKGVMLWGWREHVCNKDVG---SCPNSQVFLYNLTTCQQTCRSLS 682
            C+C+ ++ ++R C+  G     WR        G   +CP + V+L + + C  TC  L 
Sbjct: 262 TCVCSTVAEFSRQCSHAGGRPGNWRTATSAVSPGASKTCPGNLVYLESGSPCMDTCSHL- 320

Query: 683 EADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLA 716
           E  S C E    +DGC CP+    D     V LA
Sbjct: 321 EVSSLCEE--HRMDGCFCPEGAQADLPKTVVLLA 352



 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 100/401 (24%), Positives = 154/401 (38%), Gaps = 46/401 (11%)

Query: 37   CSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILL 96
            C+ WG+ HY TFDG  + + G C Y    +   S   F V++                L+
Sbjct: 1941 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLI 2000

Query: 97   TIKD--DTIYLTRHL------AVLNGAVVSTPHYSPGLLIEKSDA-YTKVYSRAGLTLMW 147
               +  + +  T H+        +N   V+ P+   GL + +S   Y       G+ + +
Sbjct: 2001 VRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSY 2060

Query: 148  NREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQ-KINQP---- 202
            N     +     +F N+T G CG      S    L  G + S  E    Q  +N P    
Sbjct: 2061 NGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPH 2120

Query: 203  ----DVVCEDPEEEVAPASCSEHRAECE-----RLLTAEAFADCQDLVPLEPYLRACQQD 253
                    + P   V     +    +C      +L+    FA C  LVP + Y  AC  D
Sbjct: 2121 CPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFD 2180

Query: 254  RCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTAT--LCPKTCPGNLVYLESGSPCMDT 311
             C  P G +  C+++  ++  C+       +WR  T   C   CP +  Y   G     T
Sbjct: 2181 SCFMP-GSSLECASLQAYAALCAQQ-NICLDWRNHTHGACLVECPSHREYQACGPAEEPT 2238

Query: 312  CSHLEVSSLCEEHR---MDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTP---GQE 365
            C     SS  +++    ++GCFCPEGT+    G   CV      C   G    P   G+ 
Sbjct: 2239 CK----SSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKT----CGCVGPDNVPREFGEH 2290

Query: 366  ITNDCEQCVCNAG--RWVCKDLPC---PGTCALEGGSHITT 401
               DC+ CVC  G    +C+   C   P T  +E G+++ T
Sbjct: 2291 FEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLAT 2331



 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 105/469 (22%), Positives = 171/469 (36%), Gaps = 53/469 (11%)

Query: 4522 IDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVY 4581
            +D   C    +   P+T+++  + +    K V +      V +N   V LP+      V+
Sbjct: 331  MDGCFCPEGAQADLPKTVVLLADKK----KNVVVFKSDGSVLLNELQVNLPHVTASFSVF 386

Query: 4582 QSGINYVVDIPELGVLVSYN---GLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSG 4638
            +    +++    +GV +       +   V L     G   +G CG       DD    SG
Sbjct: 387  RPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQ-VQGLCGNFNGLEGDDFKTASG 445

Query: 4639 EIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIK- 4697
             + +     A+ W     ++  C         P            H        C L+K 
Sbjct: 446  LVEATGAGFANTW----KAQSSCHDKLDWLDDPCSLNIESANYAEH-------WCSLLKK 494

Query: 4698 -DSLFAQCHALVPPQHYYDACVFDSC-FMPGSSLECASLQAYAALCAQQNICL-DWRNHT 4754
             ++ F +CH+ V P  YY  C +D+C         CA+L +YA  C  + + L  WR H 
Sbjct: 495  TETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHV 554

Query: 4755 HGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTV----LVEGCFCPEGTMNYAPGFDV 4810
                +  CP+ + +       + TC+S S   ++ +     V+GC CP+ T     G  V
Sbjct: 555  CNKDVGSCPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCV 614

Query: 4811 CVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKR-----CSQKPVTHCVED 4865
             +  C C     +  E G+      + CVC +G   + C+  R     C+   +     +
Sbjct: 615  PLAKCSCY-HRGLYLEAGDVVVRQEERCVCRDG--RLHCRQIRLIGQSCTAPKIHMDCSN 671

Query: 4866 GTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGV 4925
             T LAT    A +C  +     +T        VCP G     +   G C      E +  
Sbjct: 672  LTALATSKPRALSCQTLAAGYYHTECV--SGCVCPDGLMDDGR---GGCV----VEKECP 722

Query: 4926 CVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCS 4974
            CVH N  Y  G+ +    C  C C              CT   C+ +CS
Sbjct: 723  CVHNNDLYSSGAKI-KVDCNTCTCK--------RGRWVCTQAVCHGTCS 762



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 79/335 (23%), Positives = 124/335 (37%), Gaps = 35/335 (10%)

Query: 4481 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLI 4540
            C+ WG+ HY TFDG  + + G C Y    +   S   F V++                L+
Sbjct: 37   CSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILL 96

Query: 4541 VRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSY 4600
               +  + +  T H+        +N   V+ P+   GL + +S   Y       G+ + +
Sbjct: 97   TIKD--DTIYLTRHL------AVLNGAVVSTPHYSPGLLIEKSDA-YTKVYSRAGLTLMW 147

Query: 4601 NGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPH 4660
            N     +     +F N+T G CG      S    L  G + S  E    Q  +N P    
Sbjct: 148  NREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQ-KINQP---- 202

Query: 4661 CPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFD 4720
                    + P   V     +    +C      +L+    FA C  LVP + Y  AC  D
Sbjct: 203  ----DVVCEDPEEEVAPASCSEHRAECE-----RLLTAEAFADCQDLVPLEPYLRACQQD 253

Query: 4721 SCFMP-GSSLECASLQAYAALCAQQ-NICLDWRNHTHG---ACLVECPSHREYQACGPAE 4775
             C  P G +  C+++  ++  C+       +WR  T          CP +  Y   G   
Sbjct: 254  RCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATSAVSPGASKTCPGNLVYLESGSPC 313

Query: 4776 EPTCK----SSSSQQNNTVLVEGCFCPEGTMNYAP 4806
              TC     SS  +++    ++GCFCPEG     P
Sbjct: 314  MDTCSHLEVSSLCEEHR---MDGCFCPEGAQADLP 345



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 51/176 (28%), Positives = 74/176 (42%), Gaps = 34/176 (19%)

Query: 1269 TTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDDGDRETFDG 1328
            TT + P TPT  TTT +++ PT STV +TT       S W     P S            
Sbjct: 1734 TTTSPPGTPTRGTTTGSSSAPTPSTVQTTTT------SAWTPTPTPLS------------ 1775

Query: 1329 VCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFG-LCYDYKIRVN 1387
                P  I    ++    S+      + C ++  +    E+ + NG +G  CY     ++
Sbjct: 1776 ---TPSIIRTTGLRPYPSSV-----LICCVLNDTYYAPGEEVY-NGTYGDTCYFVNCSLS 1826

Query: 1388 CCWPMDK--CITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPP 1441
            C        C +TPSP   TP+P  ++ T   P++TPS P T  T PP      PP
Sbjct: 1827 CTLEFYNWSCPSTPSP---TPTPSKSTPTPSKPSSTPSKP-TPGTKPPECPDFDPP 1878


>gi|153945878 mucin 5, subtype B, tracheobronchial [Homo sapiens]
          Length = 5765

 Score = 1670 bits (4324), Expect = 0.0
 Identities = 1369/4041 (33%), Positives = 1806/4041 (44%), Gaps = 559/4041 (13%)

Query: 1484 PSPPTTTTTTPPPTTTPSPPTTTPITPPAST-TTLPPTTTPSPPTTTTTTPPPTTTPSPP 1542
            PS P T++T  P +T   P TT  +T P +T TT   T + + PT+T  T PP   P   
Sbjct: 1889 PSTPATSSTATPSST---PGTTWILTKPTTTATTTASTGSTATPTSTLRTAPP---PKVL 1942

Query: 1543 TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTT--TPSPPTITTTTPPPTT 1600
            TTT  TP   T T    T  S P T T  P   +T + PT T  TP P +   TT    +
Sbjct: 1943 TTTATTP---TVTSSKATPSSSPGTATALPALRSTATTPTATSVTPIPSSSLGTTWTRLS 1999

Query: 1601 TPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTT------LPPTTTPSP------PPTTT 1648
              + PT T +T  P++TP    T+ +   T+TTT        P++TP        P TTT
Sbjct: 2000 QTTTPTATMSTATPSSTPETAHTSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTT 2059

Query: 1649 TTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSP 1708
            T    T + SP T  TP   I+TTTTP   TT  S +T +  P TT   T   TTT    
Sbjct: 2060 TGFTATPSSSPGTALTPPVWISTTTTP---TTRGSTVTPSSIPGTTHTATVLTTTT---- 2112

Query: 1709 ITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPP 1768
             TT  T S  T  S   T+ T PS TTT +  T T +T  P++T     TTP+PP +T  
Sbjct: 2113 -TTVATGSMATPSSSTQTSGTPPSLTTTATTITATGSTTNPSSTPG---TTPIPPVLTTT 2168

Query: 1769 TFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMY 1828
              +P +T+   TP            S     H P            P   A    R+ + 
Sbjct: 2169 ATTPAATSNTVTP-----------SSALGTTHTPPV----------PNTMATTHGRS-LP 2206

Query: 1829 PDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTT 1888
            P  P     +T     + G++      +P  V                  ++ P   + T
Sbjct: 2207 PSSP--HTVRTAWTSATSGILGTTHITEPSTVTSHTLAATTGTTQHSTPALSSPHPSSRT 2264

Query: 1889 TTENPTPPTTTPITTT----TTVTPTPTPTGTQT-----PTTTPITTTTTVT-------- 1931
            T   P+P TTTP  TT    TT T TP+ T T T     PT+ PITT  T+         
Sbjct: 2265 TESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWS 2324

Query: 1932 -------PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTP--- 1978
                   P P P+G    T + I          P       Q     P+     V     
Sbjct: 2325 EWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSL 2384

Query: 1979 -----------------------------------TPTPTGTQTPTTTPITT------TT 1997
                                               TP  + T  P++TP TT      TT
Sbjct: 2385 DFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTT 2444

Query: 1998 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2057
            T T T +   T TP++TP TT     P+ T T T  PT +  T ++T     TP    T 
Sbjct: 2445 TATTTESTGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTATASSTQATAGTPH-VSTT 2502

Query: 2058 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2117
             TTP  T++  TP  +P    T T  P   +T  TPT T + T  P+++  TT T ++ T
Sbjct: 2503 ATTPTVTSSKATPFSSPG---TATALPALRSTATTPTAT-SFTAIPSSSLGTTWTRLSQT 2558

Query: 2118 PTPTGTQ---TPTTTPIT--TTTTVTPTPTPTGTQ----TPTTTPITTTTTVTPTPTPTG 2168
             TPT T    TP++TP T  T+T +T T T TG      TP++TP T  TT   T T TG
Sbjct: 2559 TTPTATMSTATPSSTPETVHTSTVLTTTATTTGATGSVATPSSTPGTAHTTKVLTTTTTG 2618

Query: 2169 -TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2227
             T TP+++P T  T       P    T TTTP T  +TVTP+  P  T TPT    TTTT
Sbjct: 2619 FTATPSSSPGTARTL------PVWIST-TTTPTTRGSTVTPSSIPGTTHTPTVLTTTTTT 2671

Query: 2228 TVTPT-PTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2285
              T +  TP+  TQT  T P  TTT  T T T + T  P++TP TT       P P    
Sbjct: 2672 VATGSMATPSSSTQTSGTPPSLTTTATTITATGS-TTNPSSTPGTT-------PIPPVLT 2723

Query: 2286 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT--TPITTTTT 2343
            T  TTP  T++TVTP+     T TP   P TT TT   + +P+   T  T  T  T+ T 
Sbjct: 2724 TTATTPAATSSTVTPSSALGTTHTPPV-PNTTATTHGRSLSPSSPHTVRTAWTSATSGTL 2782

Query: 2344 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 2403
             T   T   T T  T   TT TT   TP  +        P + TT   P+P   GT TP 
Sbjct: 2783 GTTHITEPSTGTSHTPAATTGTTQHSTPALSSPH-----PSSRTTESPPSP---GTTTPG 2834

Query: 2404 TTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVT---------------PTPTPT 2443
             T  T+ TT T TP+ T T T     PT+ PITT  T+                P P P+
Sbjct: 2835 HTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGPS 2894

Query: 2444 GTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGT--------- 2491
            G    T + I          P       Q     P+     V       G          
Sbjct: 2895 GGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVG 2954

Query: 2492 ------------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2533
                                P+T   ++T T + TP  T   T  TT  TTT T   T  
Sbjct: 2955 KFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQTTAATTTATTGSTAI 3014

Query: 2534 PTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2592
            P+ T      P   T+T T TPT T ++ T +++P T TT    T T T +   + TPI 
Sbjct: 3015 PSSTPGTAPPPKVLTSTAT-TPTATSSKATSSSSPRTATTLPVLTSTATKSTATSFTPIP 3073

Query: 2593 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2652
            + T  T    P      TTTP+ T +T+ P+ TP  T T T      TTT   +   T +
Sbjct: 3074 SFTLGTTGTLPE----QTTTPMATMSTIHPSSTPETTHTSTVLTTKATTTRATSSMSTPS 3129

Query: 2653 QTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2710
             TP TT I T  TT  T T     T TP++TP TT     P+ T T      T P  +T 
Sbjct: 3130 STPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTEPSTTAT-----VTVPTGSTA 3184

Query: 2711 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPT---- 2765
            T + T    GT    T+  TT T ++   TP+ +  T T  P   +T  TPT T      
Sbjct: 3185 TASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTATALPALRSTATTPTATSVTAIP 3244

Query: 2766 ----GTQ----TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPTPT 2811
                GT     + TTTP  T +T TP+ TP    T T    TTTTT       TP+ TP 
Sbjct: 3245 SSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTTTTTRATGSVATPSSTP- 3303

Query: 2812 GTQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPT 2863
            GT   T  P TTTT  T TP+ +P    TP      TTTP T  +TVTP+  P  T T T
Sbjct: 3304 GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIPGTTHTAT 3363

Query: 2864 TTPITTTTTVTPT-PTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2921
                TTTT  T +  TP+  TQT  T P  TTT  T T T + T  P++TP TT      
Sbjct: 3364 VLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTATTITATGS-TTNPSSTPGTT------ 3416

Query: 2922 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2981
             P P    T  TTP  T++TVTP+     T TP   P+  TT  T      G   P ++P
Sbjct: 3417 -PIPPVLTTTATTPAATSSTVTPSSALGTTHTP---PVPNTTATTH-----GRSLPPSSP 3467

Query: 2982 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPT 3039
             T  T  T   +     T  T P +T T+ TP  T + TQ  TP  +    ++  T +P 
Sbjct: 3468 HTVRTAWTSATSGILGTTHITEP-STVTSHTPAATTSTTQHSTPALSSPHPSSRTTESPP 3526

Query: 3040 PTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVT------------- 3081
              GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T               
Sbjct: 3527 SPGTTTPGHTRGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDY 3586

Query: 3082 --PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3136
              P P P+G    T + I          P       Q     P+     V       G  
Sbjct: 3587 SYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLV 3646

Query: 3137 TPTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT------TTTVTPT 3175
                  +                       TP  + T TP++TP TT      TTT T T
Sbjct: 3647 CRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTKLTTTATTT 3706

Query: 3176 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3235
             +   T TP++TP TT     P+ T T T  PT +  T ++T     TP    T  TTP 
Sbjct: 3707 ESTGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTATASSTQATAGTPH-VSTTATTPT 3764

Query: 3236 TTTTTVTPTPTP-TGTQTPT-----TTPITTTTTVTPTPTPTGTQT---PTTTPITTTTT 3286
             T++  TP  +P T T  P      TTP  T+ T  P+ +   T T    TTTP  T +T
Sbjct: 3765 VTSSKATPFSSPGTATALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMST 3824

Query: 3287 VTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQTPTTTPITTTT--TVTPTPT 3338
             TP+ TP    T T    T TTT       TP+ TP GT   T  P TTTT  TVTP+ +
Sbjct: 3825 ATPSSTPETAHTSTVLTTTATTTRATGSVATPSSTP-GTAHTTKVPTTTTTGFTVTPSSS 3883

Query: 3339 PTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-PTPTG-TQT 3390
            P   +TP      TTTP T+ +TVTP+  P  T TPT    TTTT  T +  TP+  TQT
Sbjct: 3884 PGTARTPPVWISTTTTPTTSGSTVTPSSVPGTTHTPTVLTTTTTTVATGSMATPSSSTQT 3943

Query: 3391 PTTTP--ITTTTTVTPTPTPTG-TQTPTTTPIT---TTTTVTPTPTPTGTQTPTTTPITT 3444
              T P  ITT TT+T T + T  + TP TTPI    TTT  TP  T + T TP++   TT
Sbjct: 3944 SGTPPSLITTATTITATGSTTNPSSTPGTTPIPPVLTTTATTPAAT-SSTVTPSSALGTT 4002

Query: 3445 TTTVTPTPTPT--GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3502
             T   P  T T  G     ++P T  T  T   + T   T  T P +T T+ TP  T   
Sbjct: 4003 HTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEP-STGTSHTPAATTGT 4061

Query: 3503 TQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTT 3555
            TQ  TP  +    ++  T +P   GT TP  T  T+ TT T TP+ T T T     PT+ 
Sbjct: 4062 TQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSA 4121

Query: 3556 PITTTTTVT---------------PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQT 3597
            PITT  T                 P P P+G    T + I          P       Q 
Sbjct: 4122 PITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQA 4181

Query: 3598 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV---------------TPTPTPTGTQ 3642
                P+     V       G        +                       TP  + T 
Sbjct: 4182 QPGVPLGELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTA 4241

Query: 3643 TPTTTPITT------TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3696
             P++TP TT      TTT T T +   T TP++TP T        P P    +P TTP  
Sbjct: 4242 MPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTA-------PPPKVLTSPATTPTA 4294

Query: 3697 TTTTVTPTPTPTGTQTPTTTPI-------TTTTTVTPTPTPT-GT----QTPTTTPITTT 3744
            T++  T + +P   +T TT P+       +T T+VTP P+ T GT       TTTP+ T 
Sbjct: 4295 TSSKATSSSSP---RTATTLPVLTSTATKSTATSVTPIPSSTLGTTGTLPEQTTTPVATM 4351

Query: 3745 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT------TTTVTPTPT 3798
            +T+ P+ TP  T T T      TTT   + T T + TP TT I T      TTT    PT
Sbjct: 4352 STIHPSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTAATTTAATGPT 4411

Query: 3799 PTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3856
             T + TP TT I T  TTT T T +   T TP++TP TT     P+ T T T  PT +  
Sbjct: 4412 ATPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTA 4470

Query: 3857 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3916
            T ++T     TP    T  TTP  T++  TP+ +P    T T  P   +T  TPT T + 
Sbjct: 4471 TASSTQATAGTP-HVSTTATTPTVTSSKATPSSSP---GTATALPALRSTATTPTAT-SF 4525

Query: 3917 TQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPTG----TQTPT 3967
            T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T TG      TP+
Sbjct: 4526 TAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTATATTTGATGSVATPS 4585

Query: 3968 TTPITTTTTVTPTPTPTG-TQTPTTTPITTTTT---VTPTPTPTGTQTPTTTPITTTTTV 4023
            +TP T  TT  PT T TG T TP+++P T  T    ++ T TPT     TTTP T+ +TV
Sbjct: 4586 STPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPT-----TTTPTTSGSTV 4640

Query: 4024 TPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-- 4078
            TP+  P  T T      TTTT  T    TP+ + TQT  T P  TTT  T T T + T  
Sbjct: 4641 TPSSIPGTTHTARVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTTTATTITATGSTTNP 4699

Query: 4079 -QTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 4134
              TP TTPIT   T T T TP  T    T +++P T TT    T T T +   + TPI +
Sbjct: 4700 SSTPGTTPITPVLTSTAT-TPAATSSKATSSSSPRTATTLPVLTSTATKSTATSFTPIPS 4758

Query: 4135 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 4194
            +T  T    P  T TP +T  T  T+ TP  T T T   TT  +T  T  T TP+ T   
Sbjct: 4759 STLWTTWTVPAQTTTPMSTMSTIHTSSTPETTHTSTVLTTTATMTRATNSTATPSSTLGT 4818

Query: 4195 TGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPS 4254
            T   T  +T       T +    SSTP T+   + P T +T ++ T             S
Sbjct: 4819 TRILTELTTTATTTAATGSTATLSSTPGTTWILTEPSTIATVMVPT------------GS 4866

Query: 4255 TPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTP- 4313
            T TA +T    HT     +  T P  T        +S+ P+ STV TT T A  P+  P 
Sbjct: 4867 TATASSTLGTAHTPKVVTTMATMPTAT--------ASTVPSSSTVGTTRTPAVLPSSLPT 4918

Query: 4314 --LSTPSIIRTTGLRP--YPS---SVLICCVLNDTYYAPGEEVYNGTYGDTCYF-VNCSL 4365
              +ST S    T LRP  +PS   S    C     +++PGE +YN T    C+F   C+ 
Sbjct: 4919 FSVSTVSSSVLTTLRPTGFPSSHFSTPCFCRAFGQFFSPGEVIYNKTDRAGCHFYAVCNQ 4978

Query: 4366 SCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETW 4425
             C ++ +  +CP++P P  +   S+P+P+               P C +  P RQ NETW
Sbjct: 4979 HCDIDRFQGACPTSPPPVSSAPLSSPSPA---------------PGCDNAIPLRQVNETW 5023

Query: 4426 WLCDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDP-DGCCWHWECDCYCTGW 4484
             L +C +A C  +N   +V ++ +P    TC N   P++V DP   C +H+EC+C C+ W
Sbjct: 5024 TLENCTVARCVGDN--RVVLLDPKPVANVTCVNKHLPIKVSDPSQPCDFHYECECICSMW 5081

Query: 4485 GDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVS---CPRTLIV 4541
            G  HY TFDG  Y+++GNCTYVL+ EI     N  +Y+DN++C  +   +   CPR L +
Sbjct: 5082 GGSHYSTFDGTSYTFRGNCTYVLMREIHARFGNLSLYLDNHYCTASATAAAARCPRALSI 5141

Query: 4542 RHETQEVLIKTVHMMPMQVQ--VQVNRQAVALPYKKYGLEVYQSGINYV-VDIPELGVLV 4598
             +++ ++++ TV M+  + +  +  ++  V+  + K G+ V   G   + VDIP LGV V
Sbjct: 5142 HYKSMDIVL-TVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPALGVSV 5200

Query: 4599 SYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSK 4658
            ++NG  F  RLPY  F NNT+GQCGTCTN   DDC+   G   ++C+  A  WLV D  K
Sbjct: 5201 TFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRK 5260

Query: 4659 PHC--PHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDA 4716
              C  P  +  T  PA  V      TP   C P PLC L+   +FA+CH LVPP  +++A
Sbjct: 5261 DGCWAPTGTPPTASPAAPVSSTPTPTP---CPPQPLCDLMLSQVFAECHNLVPPGPFFNA 5317

Query: 4717 CVFDSCFMPGSSLECASLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEE 4776
            C+ D C      + C SL+AYA LC  + +C DWR  T G C + CP  + Y+ CGP + 
Sbjct: 5318 CISDHC-RGRLEVPCQSLEAYAELCRARGVCSDWRGATGGLCDLTCPPTKVYKPCGPIQP 5376

Query: 4777 PTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCK 4836
             TC S +       + EGCFCPE  + +     +CV+ C CVGPD  P+  GE +  +C+
Sbjct: 5377 ATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMGICVQACPCVGPDGFPKFPGERWVSNCQ 5436

Query: 4837 NCVCLEGGSGIICQPKRC-SQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEK 4895
            +CVC EG   + C+P  C +Q     C   G    T     + CC  TVC CNT+ C + 
Sbjct: 5437 SCVCDEGSVSVQCKPLPCDAQGQPPPCNRPGFVTVTRPRAENPCCPETVCVCNTTTCPQS 5496

Query: 4896 PSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGNAEYQPGSPVYSS-KCQDCVCTDKVD 4954
              VCP G E       G CCP + C  + +C +    Y  G+    +  C  C C   + 
Sbjct: 5497 LPVCPPGQESICTQEEGDCCPTFRCRPQ-LCSYNGTFYGVGATFPGALPCHMCTC---LS 5552

Query: 4955 NNTLLNVIACTHVPC-NTSCSPGFELMEAPGECCKKCEQTHCIIKRPDNQHVILKPGDFK 5013
             +T    + C    C NT+C  GFE     G+CC +C QT C+   PD Q V L    + 
Sbjct: 5553 GDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQCCGECVQTACL--TPDGQPVQLNE-TWV 5609

Query: 5014 SDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICIPGSITFMPNGCCKTCTPRNETRV 5073
            +   +NCT + C       + +    +CP  D S C  GS+     GCC +C   +    
Sbjct: 5610 NSHVDNCTVYLCEAEGGVHLLTPQPASCP--DVSSC-RGSL--RKTGCCYSCEEDS---- 5660

Query: 5074 PCSTVPVTTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVV 5133
             C     TT + + GC   V +  C GSC     YSA+AQA+ H C+CC+E +  +  V 
Sbjct: 5661 -CQVRINTTILWHQGCETEVNITFCEGSCPGASKYSAEAQAMQHQCTCCQERRVHEETVP 5719

Query: 5134 LSCPNGGSLTHTYTHIESCQC 5154
            L CPNG ++ HTYTH++ C C
Sbjct: 5720 LHCPNGSAILHTYTHVDECGC 5740



 Score = 1434 bits (3712), Expect = 0.0
 Identities = 698/1470 (47%), Positives = 899/1470 (61%), Gaps = 62/1470 (4%)

Query: 32   HGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGV 91
            H   VCSTWG+FHYKTFDGDVFRFPGLC+Y F+  CR +Y++F V L+RG     +   V
Sbjct: 72   HNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQLRRG--LVGSRPVV 129

Query: 92   ESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNRED 151
              +++  +   +  +    ++NG     P+   GLL+E+S  Y KV  R  LT +WN ED
Sbjct: 130  TRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGED 189

Query: 152  ALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEE 211
            + +LELD K+ N TCGLCGD+NGL +++EF +     +PL+FGN+QK++ P   C DP  
Sbjct: 190  SALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPLP 249

Query: 212  EVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCRCPGGDTCVCSTVAEF 271
              A  +C++    C R L   AFA+C  LV    YL AC QD CRCP   TC C+T  E+
Sbjct: 250  LPA-GNCTDEEGICHRTLLGPAFAECHALVDSTAYLAACAQDLCRCP---TCPCATFVEY 305

Query: 272  SRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFC 331
            SRQC+HAGG+P NWR   LCP+TCP N+ + E GSPC DTCS+ + + LCE+H +DGCFC
Sbjct: 306  SRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFC 365

Query: 332  PEG---TVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLPCP 388
            P G   TV DDI  SGC+P+ QC C   G  Y+PG      C  C C+ G W C+DLPCP
Sbjct: 366  PPGRSCTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQDLPCP 425

Query: 389  GTCALEGGSHITTFDGKTYTFHGDCYYVLAKGDHNDSYALLGELAPCGSTDKQTCLKTVV 448
            GTC+++GG+HI+T+D K Y  HGDC YVL+K   + S+ +L EL  CG TD + CLK V 
Sbjct: 426  GTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLTDNENCLKAVT 485

Query: 449  LLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAP 508
            L  D     +  ++DG V LN +   LP   A+ ++F PSS+ I+V   +G++L VQL P
Sbjct: 486  LSLDGGDTAIRVQADGGVFLNSIYTQLPLSAANITLFTPSSFFIVVQTGLGLQLLVQLVP 545

Query: 509  VMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLD 568
            +MQ+FV LD A QGQ+ GLCGNFN  + DDF   SG+VEATGA FANTWKAQ++C +  +
Sbjct: 546  LMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANARN 605

Query: 569  WLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCL 628
              +DPCSL++E+ NYA HWCS L    + F RCHS ++P  ++  C +DTCNC+ +EDCL
Sbjct: 606  SFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSEDCL 665

Query: 629  CAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEADSHC 688
            CAALSSY  AC AKGV L  WR+ VC K + +CP SQ + Y +  CQ TCR LSEAD  C
Sbjct: 666  CAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCRGLSEADVTC 725

Query: 689  LEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLH 748
               F PVDGC CP  TFL++ G CVP  +C CY  G  L  G+VV  +   C C  G+L 
Sbjct: 726  SVSFVPVDGCTCPAGTFLNDAGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGKLS 785

Query: 749  CRQIRL-IGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLM 807
            C    L     C AP +++DCSN +A         SC TL  G + T CVSGCVCP GL+
Sbjct: 786  CLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLV 845

Query: 808  DDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYGSGH 867
             DG GGC+ E++CPCVHN   Y  G  I+VDCNTCTC+  RW C+  +C GTC  YG GH
Sbjct: 846  SDGSGGCIAEEDCPCVHNEATYKPGETIRVDCNTCTCRNRRWECSHRLCLGTCVAYGDGH 905

Query: 868  YITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRT 927
            +ITFDG  Y F+G C Y+  QDYCG N++ G+F I+TEN+PCGTTG TCSKAIK+F+   
Sbjct: 906  FITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVESY 965

Query: 928  ELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGT 987
            EL L++     + R  G    Y  R +G +LV+E+  G+ V WD++T+VFI+L   YKG 
Sbjct: 966  ELILQEGTFKAVARGPGGDPPYKIRYMGIFLVIETH-GMAVSWDRKTSVFIRLHQDYKGR 1024

Query: 988  VCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWA 1047
            VCGLCGNFD  + NDF TR   VV   L+FGNSWK +P+CPD     +PC+ NP R+SWA
Sbjct: 1025 VCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWA 1084

Query: 1048 EKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGA 1107
            +KQCSIL    F+ C S+VD   +YEACV+D+C+CD+GGDCECFC+AVA+YAQ C   G 
Sbjct: 1085 QKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAGL 1144

Query: 1108 CVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRC 1167
            CV WRTPD CP+FCD+YNP   CEWHY+PCG    +TCR  +G H  + +  LEGCYP+C
Sbjct: 1145 CVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTCRNPSG-HCLVDLPGLEGCYPKC 1203

Query: 1168 PKDRPIYEEDLKKCVTADKCGCYVED-THYPPGASVPTEETCKSCVCTNS--------SQ 1218
            P  +P + ED  KCV   +CGCY +D  +Y  GA VPT E C+SC CT S          
Sbjct: 1204 PPSQPFFNEDQMKCVA--QCGCYDKDGNYYDVGARVPTAENCQSCNCTPSGIQCAHSLEA 1261

Query: 1219 VVCRPE------EGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITTRPSTLTTFTTIT 1272
              C  E      +  I N T     C   ICG NGT+ +    C  T             
Sbjct: 1262 CTCTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTP------------ 1309

Query: 1273 LPTTPTTFTTTTT--TTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDDGDRETFDG-- 1328
              TTP TFTT     +TT  +  V +   +  C WS W N   P  G   GD ETF+   
Sbjct: 1310 -ATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLR 1368

Query: 1329 -----VCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCYDYK 1383
                 VC    DIECR+ + P + LE+LGQ+V CD   G +C N  Q  + P  LC+DY+
Sbjct: 1369 QRGYQVCPVLADIECRAAQLPDMPLEELGQQVDCDRMRGLMCANSQQ--SPP--LCHDYE 1424

Query: 1384 IRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPI- 1442
            +RV CC   +     PSP   T   P  S +T P   T   PT TT T   T   +P I 
Sbjct: 1425 LRVLCC---EYVPCGPSPAPGTSPQPSLSASTEPAVPT---PTQTTATEKTTLWVTPSIR 1478

Query: 1443 TTTTTPPPTTTPSPPISTTTTPPPTTTPSP 1472
            +T      T + S P++ T + P TTT  P
Sbjct: 1479 STAALTSQTGSSSGPVTVTPSAPGTTTCQP 1508



 Score = 1355 bits (3507), Expect = 0.0
 Identities = 1179/3378 (34%), Positives = 1507/3378 (44%), Gaps = 494/3378 (14%)

Query: 1198 PGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICS 1257
            PG +  T  T  +   T  S    RP +   L  T            P GT         
Sbjct: 1689 PGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTMAT----SRARPTGTASTASKEPL 1744

Query: 1258 ITTRPSTLTTFTTITLPTTPTTFTTTTT---TTTPTSSTVLSTTPKLCCLWSDWINEDHP 1314
             T+   TLT+  + +   T T  T TT    T T TS       PK  C W++W + D P
Sbjct: 1745 TTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTTRCQPK--CEWTEWFDVDFP 1802

Query: 1315 SSGSDDGDRETFDGV-------CGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKN 1367
            +SG   GD ETF+ +       C AP+ IECR+   P +S++Q+GQ + C +  G  CKN
Sbjct: 1803 TSGVAGGDMETFENIRAAGGKMCWAPKSIECRAENYPEVSIDQVGQVLTCSLETGLTCKN 1862

Query: 1368 EDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTT-TPSPPPTSTTTLPPTTTPSPPT 1426
            EDQ G   F +C++Y +RV CC     C +TP+  +T TPS  P +T  L      + PT
Sbjct: 1863 EDQTGR--FNMCFNYNVRVLCCDDYSHCPSTPATSSTATPSSTPGTTWIL------TKPT 1914

Query: 1427 TTTTTPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSP 1486
            TT TT   T + + P +T  T PP     P + TTT   PT T S  T + SP T T  P
Sbjct: 1915 TTATTTASTGSTATPTSTLRTAPP-----PKVLTTTATTPTVTSSKATPSSSPGTATALP 1969

Query: 1487 PTTTTTTPPPTTTPSPPTTTPI-----------TPPASTTTLPPTTTPSPP------TTT 1529
               +T T P  T+ +P  ++ +           TP A+ +T  P++TP         T T
Sbjct: 1970 ALRSTATTPTATSVTPIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTAT 2029

Query: 1530 TTTPPPTTTPSPPTTTPITPPTS----TTTLPPTTTPSPPPTTTTTPP--------PTT- 1576
             TT   T + + P++TP T  T+    TTT   T TPS  P T  TPP        PTT 
Sbjct: 2030 ATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTR 2089

Query: 1577 ----TPSPPTTTTPSPPTITTTTPPPTT----TPSPPTTTTTTPPPTTTPSPPTTTPITP 1628
                TPS    TT +   +TTTT    T    TPS  T T+ TPP  TT +  TT   T 
Sbjct: 2090 GSTVTPSSIPGTTHTATVLTTTTTTVATGSMATPSSSTQTSGTPPSLTTTA--TTITATG 2147

Query: 1629 PTSTTTLPPTTTPSPP--PTTTTTPPPTT---TPSPPTTTTPSPPI--TTTTTPPPTTTP 1681
             T+  +  P TTP PP   TT TTP  T+   TPS    TT +PP+  T  TT   +  P
Sbjct: 2148 STTNPSSTPGTTPIPPVLTTTATTPAATSNTVTPSSALGTTHTPPVPNTMATTHGRSLPP 2207

Query: 1682 SSPIT--------TTPSPPTTTMTTPSPTTTPSSPITTTTTPSST-TTPSPPPTTMTTPS 1732
            SSP T        T+    TT +T PS  T+ +   TT TT  ST    SP P++ TT S
Sbjct: 2208 SSPHTVRTAWTSATSGILGTTHITEPSTVTSHTLAATTGTTQHSTPALSSPHPSSRTTES 2267

Query: 1733 P----TTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNW 1788
            P    TTTP   T T  T    T S   T+T LP S   PT +P  TT  T  C P C W
Sbjct: 2268 PPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSS---PTSAPI-TTVVTMGCEPQCAW 2323

Query: 1789 TGWLDSGKPNFHKPGGDTELIGDVCGPGWAA-----NISCRATMYPDVPIGQLGQTVVCD 1843
            + WLD   P     GGD +   ++   G A       + CRA   P VP+ +LGQ V C 
Sbjct: 2324 SEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECS 2383

Query: 1844 VSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENP--TPPTTTPI 1901
            +  GL+C+N +Q    V     C NYEI V CC     P+T  T++T  P  TP TT  +
Sbjct: 2384 LDFGLVCRNREQ----VGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWIL 2439

Query: 1902 T-TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 1960
            T  TTT T T +   T TP++TP TT     P+ T T T  PT +  T ++T     TP 
Sbjct: 2440 TELTTTATTTESTGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTATASSTQATAGTP- 2497

Query: 1961 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2020
               T  TTP  T++  TP  +P    T T  P   +T  TPT T + T  P+++  TT T
Sbjct: 2498 HVSTTATTPTVTSSKATPFSSP---GTATALPALRSTATTPTAT-SFTAIPSSSLGTTWT 2553

Query: 2021 TVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPTG----TQTPTTTPITTTTTVTPT 2071
             ++ T TPT T    TP++TP T  T+T +T T T TG      TP++TP T  TT   T
Sbjct: 2554 RLSQTTTPTATMSTATPSSTPETVHTSTVLTTTATTTGATGSVATPSSTPGTAHTTKVLT 2613

Query: 2072 PTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2130
             T TG T TP+++P T  T       P    T TTTP T  +TVTP+  P  T TPT   
Sbjct: 2614 TTTTGFTATPSSSPGTART------LPVWIST-TTTPTTRGSTVTPSSIPGTTHTPTVLT 2666

Query: 2131 ITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2187
             TTTT  T    TP+ + TQT  T P  TTT  T T T + T  P++TP T       TP
Sbjct: 2667 TTTTTVATGSMATPS-SSTQTSGTPPSLTTTATTITATGS-TTNPSSTPGT-------TP 2717

Query: 2188 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT--TP 2245
             P    T  TTP  T++TVTP+     T TP   P TT TT   + +P+   T  T  T 
Sbjct: 2718 IPPVLTTTATTPAATSSTVTPSSALGTTHTP-PVPNTTATTHGRSLSPSSPHTVRTAWTS 2776

Query: 2246 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2305
             T+ T  T   T   T T  T   TT TT   TP  +        P + TT   P+P   
Sbjct: 2777 ATSGTLGTTHITEPSTGTSHTPAATTGTTQHSTPALSSPH-----PSSRTTESPPSP--- 2828

Query: 2306 GTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV---------------T 2345
            GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T+                
Sbjct: 2829 GTTTPGHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSY 2888

Query: 2346 PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT--- 2399
            P P P+G    T + I          P       Q     P+     V       G    
Sbjct: 2889 PMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCR 2948

Query: 2400 ------------------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2435
                                      P+T   ++T T + TP  T   T  TT  TTT T
Sbjct: 2949 NREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQTTAATTTAT 3008

Query: 2436 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPTGTQTP 2494
               T  P+ T      P   T+T T TPT T ++ T +++P T TT    T T T +   
Sbjct: 3009 TGSTAIPSSTPGTAPPPKVLTSTAT-TPTATSSKATSSSSPRTATTLPVLTSTATKSTAT 3067

Query: 2495 TTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2553
            + TPI + T  T     TGT    TTTP+ T +T+ P+ TP  T T T      TTT   
Sbjct: 3068 SFTPIPSFTLGT-----TGTLPEQTTTPMATMSTIHPSSTPETTHTSTVLTTKATTTRAT 3122

Query: 2554 TPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2611
            +   T + TP TT I T  TT  T T     T TP++TP TT     P+ T T      T
Sbjct: 3123 SSMSTPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTEPSTTAT-----VT 3177

Query: 2612 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTP 2670
             P  +T T + T    GT    T+  TT T ++   TP+ +  T T  P   +T  TPT 
Sbjct: 3178 VPTGSTATASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTATALPALRSTATTPTA 3237

Query: 2671 TPT--------GTQ----TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------V 2712
            T          GT     + TTTP  T +T TP+ TP    T T    TTTTT       
Sbjct: 3238 TSVTAIPSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTTTTTRATGSVA 3297

Query: 2713 TPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTP 2764
            TP+ TP GT   T  P TTTT  T TP+ +P    TP      TTTP T  +TVTP+  P
Sbjct: 3298 TPSSTP-GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIP 3356

Query: 2765 TGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2821
              T T T    TTTT  T    TP+ + TQT  T P  TTT  T T T + T  P++TP 
Sbjct: 3357 GTTHTATVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTTTATTITATGS-TTNPSSTPG 3414

Query: 2822 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2881
            T       TP P    T  TTP  T++TVTP+     T TP   P+  TT  T      G
Sbjct: 3415 T-------TPIPPVLTTTATTPAATSSTVTPSSALGTTHTP---PVPNTTATT-----HG 3459

Query: 2882 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTT 2939
               P ++P T  T  T   +     T  T P +T T+ TP  T + TQ  TP  +    +
Sbjct: 3460 RSLPPSSPHTVRTAWTSATSGILGTTHITEP-STVTSHTPAATTSTTQHSTPALSSPHPS 3518

Query: 2940 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV------ 2988
            +  T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T       
Sbjct: 3519 SRTTESPPSPGTTTPGHTRGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQC 3578

Query: 2989 ---------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3036
                      P P P+G    T + I          P       Q     P+     V  
Sbjct: 3579 AWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVE 3638

Query: 3037 TPTPTGT---------------------------QTPTTTPITTTTTVTPTPTPTGTQTP 3069
                 G                              P+T   ++T T + TP  T   T 
Sbjct: 3639 CSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTK 3698

Query: 3070 TTTPITTT----TTVTPTPTPTGTQTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITT 3122
             TT  TTT    +T TP+ TP GT    T P TT T   P   T T + TQ    TP  +
Sbjct: 3699 LTTTATTTESTGSTATPSSTP-GTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVS 3757

Query: 3123 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3182
            TT  TPT T     +   TP ++  T T  P    T    TTP  T+ T  P+ +   T 
Sbjct: 3758 TTATTPTVT-----SSKATPFSSPGTATALPALRST---ATTPTATSFTAIPSSSLGTTW 3809

Query: 3183 T---PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQTPTTT 3233
            T    TTTP  T +T TP+ TP    T T    T TTT       TP+ TP GT   T  
Sbjct: 3810 TRLSQTTTPTATMSTATPSSTPETAHTSTVLTTTATTTRATGSVATPSSTP-GTAHTTKV 3868

Query: 3234 PITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3285
            P TTTT  TVTP+ +P   +TP      TTTP T+ +TVTP+  P  T TPT    TTTT
Sbjct: 3869 PTTTTTGFTVTPSSSPGTARTPPVWISTTTTPTTSGSTVTPSSVPGTTHTPTVLTTTTTT 3928

Query: 3286 TVT---PTPTPTGTQTPTTTP--ITTTTTVTPTPTPTG-TQTPTTTPI---TTTTTVTPT 3336
              T    TP+ + TQT  T P  ITT TT+T T + T  + TP TTPI    TTT  TP 
Sbjct: 3929 VATGSMATPS-SSTQTSGTPPSLITTATTITATGSTTNPSSTPGTTPIPPVLTTTATTPA 3987

Query: 3337 PTPTGTQTPTTTPITTTTTVTPTPTPT--GTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3394
             T + T TP++   TT T   P  T T  G     ++P T  T  T   + T   T  T 
Sbjct: 3988 AT-SSTVTPSSALGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITE 4046

Query: 3395 PITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3452
            P +T T+ TP  T   TQ  TP  +    ++  T +P   GT TP  T  T+ TT T TP
Sbjct: 4047 P-STGTSHTPAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATP 4105

Query: 3453 TPTGTQT-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT-- 3490
            + T T T     PT+ PITT  T                 P P P+G    T + I    
Sbjct: 4106 SKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAG 4165

Query: 3491 -TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----------------------- 3526
                  P       Q     P+     V       G                        
Sbjct: 4166 GAVCEQPLGLECRAQAQPGVPLGELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFC 4225

Query: 3527 ----QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT---------- 3572
                  P+T   ++T   + TP  T   T  TT  TTT +   T TP+ T          
Sbjct: 4226 CNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVL 4285

Query: 3573 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPI-------TTTTTVTPTPTPT-GT----QT 3620
             +P TTP  T++  T + +P   +T TT P+       +T T+VTP P+ T GT      
Sbjct: 4286 TSPATTPTATSSKATSSSSP---RTATTLPVLTSTATKSTATSVTPIPSSTLGTTGTLPE 4342

Query: 3621 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT------ 3674
             TTTP+ T +T+ P+ TP  T T T      TTT   + T T + TP TT I T      
Sbjct: 4343 QTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTAA 4402

Query: 3675 TTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3732
            TTT    PT T + TP TT I T  TTT T T +   T TP++TP TT     P+ T T 
Sbjct: 4403 TTTAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTTWILTEPSTTATV 4462

Query: 3733 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3792
            T  PT +  T ++T     TP    T  TTP  T++  TP+ +P    T T  P   +T 
Sbjct: 4463 T-VPTGSTATASSTQATAGTP-HVSTTATTPTVTSSKATPSSSP---GTATALPALRSTA 4517

Query: 3793 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPTG 3847
             TPT T + T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T TG
Sbjct: 4518 TTPTAT-SFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTATATTTG 4576

Query: 3848 ----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTT---VTPTPTPTGTQTPTT 3899
                  TP++TP T  TT  PT T TG T TP+++P T  T    ++ T TPT     TT
Sbjct: 4577 ATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPT-----TT 4631

Query: 3900 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTP 3956
            TP T+ +TVTP+  P  T T      TTTT  T    TP+ + TQT  T P  TTT  T 
Sbjct: 4632 TPTTSGSTVTPSSIPGTTHTARVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTTTATTI 4690

Query: 3957 TPTPTGT---QTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPITTTTTVTPTPTPTGTQ 4010
            T T + T    TP TTPIT   T T T TP  T    T +++P T TT    T T T + 
Sbjct: 4691 TATGSTTNPSSTPGTTPITPVLTSTAT-TPAATSSKATSSSSPRTATTLPVLTSTATKST 4749

Query: 4011 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 4070
              + TPI ++T  T    P  T TP +T  T  T+ TP  T T T   TT  +T  T  T
Sbjct: 4750 ATSFTPIPSSTLWTTWTVPAQTTTPMSTMSTIHTSSTPETTHTSTVLTTTATMTRATNST 4809

Query: 4071 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGT--QTPTTTPI-TTTTTVTPTPTPTGTQTP 4127
             TP+ T   T   T +TTT T T     T T   TP TT I T  +T+     PTG+   
Sbjct: 4810 ATPSSTLGTTRILTELTTTATTTAATGSTATLSSTPGTTWILTEPSTIATVMVPTGSTAT 4869

Query: 4128 TTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 4185
             ++ + T  T  V  T     T T +T P ++T   T TP    +  PT +  T +++V 
Sbjct: 4870 ASSTLGTAHTPKVVTTMATMPTATASTVPSSSTVGTTRTPAVLPSSLPTFSVSTVSSSVL 4929

Query: 4186 PTPTPTGTQTGPPTHTST 4203
             T  PTG    P +H ST
Sbjct: 4930 TTLRPTGF---PSSHFST 4944



 Score = 1146 bits (2964), Expect = 0.0
 Identities = 1071/3196 (33%), Positives = 1359/3196 (42%), Gaps = 516/3196 (16%)

Query: 1570 TTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPP 1629
            TTPPPTT     TTTT        +TP PT++P      T  PP +TT  P  +  +T P
Sbjct: 1611 TTPPPTTELETATTTTTQA---LFSTPQPTSSPG----LTRAPPASTTAVPTLSEGLTSP 1663

Query: 1630 TSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITT----TTTPPPTTTPSSPI 1685
              T+TL   TT  P     TTP  +T P+ P   T + P  +    TT    T  PS P 
Sbjct: 1664 RYTSTLGTATTGGP-----TTPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPP 1718

Query: 1686 TTTPSPPTTTMTTPSPTTTPSS--PITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTT 1743
            T  P+   T+   P+ T + +S  P+TT+  P+ T+  S      +TP   TT SP    
Sbjct: 1719 TLAPTTMATSRARPTGTASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSP---- 1774

Query: 1744 MTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPG 1803
               L  TTTS                         TT C P C WT W D   P     G
Sbjct: 1775 ---LTNTTTSQ-----------------------GTTRCQPKCEWTEWFDVDFPTSGVAG 1808

Query: 1804 GDTELIGDVCGPG----WA-ANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPG 1858
            GD E   ++   G    WA  +I CRA  YP+V I Q+GQ + C +  GL CKNEDQ   
Sbjct: 1809 GDMETFENIRAAGGKMCWAPKSIECRAENYPEVSIDQVGQVLTCSLETGLTCKNEDQT-- 1866

Query: 1859 GVIPMAFCLNYEINVQCCE----CVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPT 1914
            G   M  C NY + V CC+    C + P T +T T      P++TP TT     PT T T
Sbjct: 1867 GRFNM--CFNYNVRVLCCDDYSHCPSTPATSSTAT------PSSTPGTTWILTKPTTTAT 1918

Query: 1915 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 1974
             T   T +  T T+T+   P P    T  TTP  T++  TP+ +P    T T  P   +T
Sbjct: 1919 -TTASTGSTATPTSTLRTAPPPKVLTTTATTPTVTSSKATPSSSP---GTATALPALRST 1974

Query: 1975 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPT 2029
              TPT T   T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T T
Sbjct: 1975 ATTPTATSV-TPIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTATATTT 2033

Query: 2030 G----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2084
            G      TP++TP T  TT  PT T TG T TP+++P T         TP    + TTTP
Sbjct: 2034 GATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTAL-------TPPVWISTTTTP 2086

Query: 2085 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTP 2141
             T  +TVTP+  P  T T T    TTTT  T    TP+ + TQT  T P  TTT  T T 
Sbjct: 2087 TTRGSTVTPSSIPGTTHTATVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTTTATTITA 2145

Query: 2142 TPTGT---QTPTTTPI---TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT--GTQ 2193
            T + T    TP TTPI    TTT  TP  T + T TP++   TT T   P    T  G  
Sbjct: 2146 TGSTTNPSSTPGTTPIPPVLTTTATTPAAT-SNTVTPSSALGTTHTPPVPNTMATTHGRS 2204

Query: 2194 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT-TVTPTPTPTGTQTPTTTPITTTTTV 2252
             P ++P T  T  T   +     T  T P T T+ T+  T   T   TP  +    ++  
Sbjct: 2205 LPPSSPHTVRTAWTSATSGILGTTHITEPSTVTSHTLAATTGTTQHSTPALSSPHPSSRT 2264

Query: 2253 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV--------- 2298
            T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T+         
Sbjct: 2265 TESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWS 2324

Query: 2299 ------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2349
                   P P P+G    T + I          P       Q     P+     V     
Sbjct: 2325 EWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSL 2384

Query: 2350 PTGTQTPTTTPI---------------TTTTTVTPTPTPTGTQTPTTTPITT------TT 2388
              G        +                       TP  + T  P++TP TT      TT
Sbjct: 2385 DFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTT 2444

Query: 2389 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2448
            T T T +   T TP++TP TT     P+ T T T  PT +  T ++T     TP    T 
Sbjct: 2445 TATTTESTGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTATASSTQATAGTP-HVSTT 2502

Query: 2449 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2508
             TTP  T++  TP  +P    T T  P   +T  TPT T + T  P+++  TT T ++ T
Sbjct: 2503 ATTPTVTSSKATPFSSP---GTATALPALRSTATTPTAT-SFTAIPSSSLGTTWTRLSQT 2558

Query: 2509 PTPTGTQ---TPTTTPIT--TTTTVTPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG 2559
             TPT T    TP++TP T  T+T +T T T TG      TP++TP T  TT   T T TG
Sbjct: 2559 TTPTATMSTATPSSTPETVHTSTVLTTTATTTGATGSVATPSSTPGTAHTTKVLTTTTTG 2618

Query: 2560 -TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2618
             T TP+++P T  T       P    T TTTP T  +TVTP+  P  T TPT    TTTT
Sbjct: 2619 FTATPSSSPGTART------LPVWIST-TTTPTTRGSTVTPSSIPGTTHTPTVLTTTTTT 2671

Query: 2619 TVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2675
              T    TP+ + TQT  T P  TTT  T T T + T  P++TP T       TP P   
Sbjct: 2672 VATGSMATPS-SSTQTSGTPPSLTTTATTITATGS-TTNPSSTPGT-------TPIPPVL 2722

Query: 2676 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT--TPITTTT 2733
             T  TTP  T++TVTP+     T TP   P TT TT   + +P+   T  T  T  T+ T
Sbjct: 2723 TTTATTPAATSSTVTPSSALGTTHTP-PVPNTTATTHGRSLSPSSPHTVRTAWTSATSGT 2781

Query: 2734 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2793
              T   T   T T  T   TT TT   TP  +        P + TT   P+P   GT TP
Sbjct: 2782 LGTTHITEPSTGTSHTPAATTGTTQHSTPALSSPH-----PSSRTTESPPSP---GTTTP 2833

Query: 2794 TTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV---------------TPTPTP 2833
              T  T+ TT T TP+ T T T     PT+ PITT  T+                P P P
Sbjct: 2834 GHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGP 2893

Query: 2834 TGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-------- 2882
            +G    T + I          P       Q     P+     V       G         
Sbjct: 2894 SGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQV 2953

Query: 2883 -------------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2923
                                 P+T   ++T T + TP  T   T  TT  TTT T   T 
Sbjct: 2954 GKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQTTAATTTATTGSTA 3013

Query: 2924 TPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2982
             P+ T      P   T+T T TPT T ++ T +++P T TT    T T T +   + TPI
Sbjct: 3014 IPSSTPGTAPPPKVLTSTAT-TPTATSSKATSSSSPRTATTLPVLTSTATKSTATSFTPI 3072

Query: 2983 TTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3041
             + T  T     TGT    TTTP+ T +T+ P+ TP  T T T      TTT   +   T
Sbjct: 3073 PSFTLGT-----TGTLPEQTTTPMATMSTIHPSSTPETTHTSTVLTTKATTTRATSSMST 3127

Query: 3042 GTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3099
             + TP TT I T  TT  T T     T TP++TP TT     P+ T T      T P  +
Sbjct: 3128 PSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTEPSTTAT-----VTVPTGS 3182

Query: 3100 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPT-- 3156
            T T + T    GT    T+  TT T ++   TP+ +  T T  P   +T  TPT T    
Sbjct: 3183 TATASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTATALPALRSTATTPTATSVTA 3242

Query: 3157 ------GTQ----TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPT 3200
                  GT     + TTTP  T +T TP+ TP    T T    TTTTT       TP+ T
Sbjct: 3243 IPSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTTTTTRATGSVATPSST 3302

Query: 3201 PTGTQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQT 3252
            P GT   T  P TTTT  T TP+ +P    TP      TTTP T  +TVTP+  P  T T
Sbjct: 3303 P-GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIPGTTHT 3361

Query: 3253 PTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3309
             T    TTTT  T    TP+ + TQT  T P  TTT  T T T + T  P++TP T    
Sbjct: 3362 ATVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTTTATTITATGS-TTNPSSTPGT---- 3415

Query: 3310 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3369
               TP P    T  TTP  T++TVTP+     T TP   P+  TT  T      G   P 
Sbjct: 3416 ---TPIPPVLTTTATTPAATSSTVTPSSALGTTHTP---PVPNTTATT-----HGRSLPP 3464

Query: 3370 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTP 3427
            ++P T  T  T   +     T  T P +T T+ TP  T + TQ  TP  +    ++  T 
Sbjct: 3465 SSPHTVRTAWTSATSGILGTTHITEP-STVTSHTPAATTSTTQHSTPALSSPHPSSRTTE 3523

Query: 3428 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV----------- 3471
            +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T            
Sbjct: 3524 SPPSPGTTTPGHTRGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEW 3583

Query: 3472 ----TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3524
                 P P P+G    T + I          P       Q     P+     V       
Sbjct: 3584 LDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDF 3643

Query: 3525 GT---------------------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3557
            G                              P+T   ++T T + TP  T   T  TT  
Sbjct: 3644 GLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTKLTTTA 3703

Query: 3558 TTT----TTVTPTPTPTGTQTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVT 3610
            TTT    +T TP+ TP GT    T P TT T   P   T T + TQ    TP  +TT  T
Sbjct: 3704 TTTESTGSTATPSSTP-GTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATT 3762

Query: 3611 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT---P 3667
            PT T     +   TP ++  T T  P    T    TTP  T+ T  P+ +   T T    
Sbjct: 3763 PTVT-----SSKATPFSSPGTATALPALRST---ATTPTATSFTAIPSSSLGTTWTRLSQ 3814

Query: 3668 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQTPTTTPITTT 3721
            TTTP  T +T TP+ TP    T T    T TTT       TP+ TP GT   T  P TTT
Sbjct: 3815 TTTPTATMSTATPSSTPETAHTSTVLTTTATTTRATGSVATPSSTP-GTAHTTKVPTTTT 3873

Query: 3722 T--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-- 3771
            T  TVTP+ +P   +TP      TTTP T+ +TVTP+  P  T TPT    TTTT  T  
Sbjct: 3874 TGFTVTPSSSPGTARTPPVWISTTTTPTTSGSTVTPSSVPGTTHTPTVLTTTTTTVATGS 3933

Query: 3772 -PTPTPTGTQTPTTTP--ITTTTTVTPTPTPTG-TQTPTTTPI---TTTTTVTPTPTPTG 3824
              TP+ + TQT  T P  ITT TT+T T + T  + TP TTPI    TTT  TP  T + 
Sbjct: 3934 MATPS-SSTQTSGTPPSLITTATTITATGSTTNPSSTPGTTPIPPVLTTTATTPAAT-SS 3991

Query: 3825 TQTPTTTPITTTTTVTPTPTPT--GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3882
            T TP++   TT T   P  T T  G     ++P T  T  T   + T   T  T P +T 
Sbjct: 3992 TVTPSSALGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEP-STG 4050

Query: 3883 TTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3940
            T+ TP  T   TQ  TP  +    ++  T +P   GT TP  T  T+ TT T TP+ T T
Sbjct: 4051 TSHTPAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRT 4110

Query: 3941 QT-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT---TTTV 3977
             T     PT+ PITT  T                 P P P+G    T + I         
Sbjct: 4111 STLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCE 4170

Query: 3978 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT---------------------------Q 4010
             P       Q     P+     V       G                             
Sbjct: 4171 QPLGLECRAQAQPGVPLGELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGH 4230

Query: 4011 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 4070
             P+T   ++T   + TP  T   T  TT  TTT +   T TP  + TP T P     T +
Sbjct: 4231 CPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATP--SSTPGTAPPPKVLT-S 4287

Query: 4071 PTPTPTGTQ---TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QT 4126
            P  TPT T    T +++P T TT    T T T +   + TPI ++T  T     TGT   
Sbjct: 4288 PATTPTATSSKATSSSSPRTATTLPVLTSTATKSTATSVTPIPSSTLGT-----TGTLPE 4342

Query: 4127 PTTTPITTTTTVTPTPTPTGTQTPT--TTPITTTTTVTPTPTPTGTQ------TPTTTPI 4178
             TTTP+ T +T+ P+ TP  T T T  TT  TTT   + T TP+ T       T  TT  
Sbjct: 4343 QTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTAA 4402

Query: 4179 TTTTTVTPTPTPTGT--QTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTT 4236
            TTT    PT TP+ T   T   T  +T      +T +    SSTP T+   + P T +T 
Sbjct: 4403 TTTAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTTWILTEPSTTATV 4462

Query: 4237 LLSTLPPAIEMTSTAPPSTP------TAPTTTSGGHTLSPPPSTTTSPP---GTPTRGTT 4287
             + T   A   ++ A   TP      T PT TS   T S  P T T+ P    T T  T 
Sbjct: 4463 TVPTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPSSSPGTATALPALRSTATTPTA 4522

Query: 4288 TGSSSAPTPS-------TVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLND 4340
            T  ++ P+ S         QTTT +A   T TP STP  + T       S+VL       
Sbjct: 4523 TSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHT-------STVLTATA--T 4573

Query: 4341 TYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNW--SCPSTP-------SPTPTPSKSTP 4391
            T  A G      +   T +      + T  F     S P T        S T TP+ +TP
Sbjct: 4574 TTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTTTP 4633

Query: 4392 TPSKPSSTPSKPTPGT 4407
            T S  + TPS   PGT
Sbjct: 4634 TTSGSTVTPSS-IPGT 4648



 Score = 1072 bits (2772), Expect = 0.0
 Identities = 1088/3394 (32%), Positives = 1392/3394 (41%), Gaps = 655/3394 (19%)

Query: 1478 SPPTTTPSPPTTTTTTPPPTTTPSPPTTTPIT--PPASTTTLPPTT--TPSPPTTTTTTP 1533
            +PP TT     TTTTT    +TP P ++  +T  PPASTT +P  +    SP  T+T   
Sbjct: 1612 TPPPTTELETATTTTTQALFSTPQPTSSPGLTRAPPASTTAVPTLSEGLTSPRYTSTLGT 1671

Query: 1534 PPTTTPSPP--TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTI 1591
              T  P+ P  +T P  P  +T+TLP   T S  P TT +        PPT    +P T+
Sbjct: 1672 ATTGGPTTPAGSTEPTVPGVATSTLP---TRSALPGTTGSLGTWRPSQPPTL---APTTM 1725

Query: 1592 TTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTP 1651
             T+   PT T S    T +  P TT+ +P  T+ ++   + T+ P T T   P T TTT 
Sbjct: 1726 ATSRARPTGTAS----TASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTS 1781

Query: 1652 PPTTTPSP------------PTTTTPSPPITT-----TTTPPPTTTPSSPITTTPSPPTT 1694
              TT   P            PT+      + T              P S      + P  
Sbjct: 1782 QGTTRCQPKCEWTEWFDVDFPTSGVAGGDMETFENIRAAGGKMCWAPKSIECRAENYPEV 1841

Query: 1695 TMTTPSPTTTPSSPITTTTTPSSTT---------------------TPSPPPTTMT---- 1729
            ++       T S     T      T                      PS P T+ T    
Sbjct: 1842 SIDQVGQVLTCSLETGLTCKNEDQTGRFNMCFNYNVRVLCCDDYSHCPSTPATSSTATPS 1901

Query: 1730 -TPSPTTTPSPPTTTMTTLPPT----TTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVP 1784
             TP  T   + PTTT TT   T    T +S L T P P  +T    +P  T++  TP   
Sbjct: 1902 STPGTTWILTKPTTTATTTASTGSTATPTSTLRTAPPPKVLTTTATTPTVTSSKATPS-- 1959

Query: 1785 LCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISC-RATMYPDVPIGQLGQTVVCD 1843
                             PG  T L      P   +  +   AT    +P   LG T    
Sbjct: 1960 ---------------SSPGTATAL------PALRSTATTPTATSVTPIPSSSLGTTW--- 1995

Query: 1844 VSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPIT- 1902
                                          +  +  T   TM+T T      P++TP T 
Sbjct: 1996 -----------------------------TRLSQTTTPTATMSTAT------PSSTPETA 2020

Query: 1903 -TTTTVTPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPT 1956
             T+T +T T T TG      TP++TP T  TT  PT T TG T TP+++P T        
Sbjct: 2021 HTSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTAL------ 2074

Query: 1957 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTT 2013
             TP    + TTTP T  +TVTP+  P  T T T    TTTT  T    TP+ + TQT  T
Sbjct: 2075 -TPPVWISTTTTPTTRGSTVTPSSIPGTTHTATVLTTTTTTVATGSMATPS-SSTQTSGT 2132

Query: 2014 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2073
             P  TTT  T T T + T  P++TP T       TP P    T  TTP  T+ TVTP+  
Sbjct: 2133 PPSLTTTATTITATGS-TTNPSSTPGT-------TPIPPVLTTTATTPAATSNTVTPSSA 2184

Query: 2074 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2133
               T TP   P T  TT   +  P+   T  T   + T+ +  T   T   T T+  +  
Sbjct: 2185 LGTTHTP-PVPNTMATTHGRSLPPSSPHTVRTAWTSATSGILGTTHITEPSTVTSHTLAA 2243

Query: 2134 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2193
            TT  T   TP      +  P + TT   P+P   GT TP  T  T+ TT T TP+ T T 
Sbjct: 2244 TTGTTQHSTPA---LSSPHPSSRTTESPPSP---GTTTPGHTTATSRTTATATPSKTRTS 2297

Query: 2194 T-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT---TTTVT 2230
            T     PT+ PITT  T+                P P P+G    T + I          
Sbjct: 2298 TLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQ 2357

Query: 2231 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGT---------------------------QT 2263
            P       Q     P+     V       G                              
Sbjct: 2358 PLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHC 2417

Query: 2264 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTT----TTVTPTPTPTGTQTPTTTPITTTT 2319
            P+T   ++T   + TP  T   T  TT  TTT    +T TP+ TP GT    T P TT T
Sbjct: 2418 PSTPATSSTAMPSSTPGTTWILTELTTTATTTESTGSTATPSSTP-GTTWILTEPSTTAT 2476

Query: 2320 TVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT-------TTVTP 2369
               P   T T + TQ    TP  +TT  TPT T +   TP ++P T T       T  TP
Sbjct: 2477 VTVPTGSTATASSTQATAGTPHVSTTATTPTVT-SSKATPFSSPGTATALPALRSTATTP 2535

Query: 2370 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPTG--- 2421
            T T + T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T TG   
Sbjct: 2536 TAT-SFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTATTTGATG 2594

Query: 2422 -TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2479
               TP++TP T  TT   T T TG T TP+++P T  T       P    T TTTP T  
Sbjct: 2595 SVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTART------LPVWIST-TTTPTTRG 2647

Query: 2480 TTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2536
            +TVTP+  P  T TPT    TTTT  T    TP+ + TQT  T P  TTT  T T T + 
Sbjct: 2648 STVTPSSIPGTTHTPTVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTTTATTITATGS- 2705

Query: 2537 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2596
            T  P++TP T       TP P    T  TTP  T++TVTP+     T TP   P TT TT
Sbjct: 2706 TTNPSSTPGT-------TPIPPVLTTTATTPAATSSTVTPSSALGTTHTP-PVPNTTATT 2757

Query: 2597 VTPTPTPTGTQTPTT--TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2654
               + +P+   T  T  T  T+ T  T   T   T T  T   TT TT   TP  +    
Sbjct: 2758 HGRSLSPSSPHTVRTAWTSATSGTLGTTHITEPSTGTSHTPAATTGTTQHSTPALSSPH- 2816

Query: 2655 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTT 2709
                P + TT   P+P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT 
Sbjct: 2817 ----PSSRTTESPPSP---GTTTPGHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTV 2869

Query: 2710 TTV---------------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTP 2751
             T+                P P P+G    T + I          P       Q     P
Sbjct: 2870 VTMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVP 2929

Query: 2752 ITTTTTVTPTPTPTGT---------------------------QTPTTTPITTTTTVTPT 2784
            +     V       G                              P+T   ++T T + T
Sbjct: 2930 LRELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSST 2989

Query: 2785 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTP 2843
            P  T   T  TT  TTT T   T  P+ T      P   T+T T TPT T ++ T +++P
Sbjct: 2990 PGTTWILTEQTTAATTTATTGSTAIPSSTPGTAPPPKVLTSTAT-TPTATSSKATSSSSP 3048

Query: 2844 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTP 2902
             T TT    T T T +   + TPI + T  T     TGT    TTTP+ T +T+ P+ TP
Sbjct: 3049 RTATTLPVLTSTATKSTATSFTPIPSFTLGT-----TGTLPEQTTTPMATMSTIHPSSTP 3103

Query: 2903 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPIT 2960
              T T T      TTT   +   T + TP TT I T  TT  T T     T TP++TP T
Sbjct: 3104 ETTHTSTVLTTKATTTRATSSMSTPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGT 3163

Query: 2961 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3020
            T     P+ T T      T P  +T T + T    GT    T+  TT T ++   TP+ +
Sbjct: 3164 TWILTEPSTTAT-----VTVPTGSTATASSTRATAGTLKVLTSTATTPTVISSRATPSSS 3218

Query: 3021 Q-TPTTTPITTTTTVTPTPTPT--------GTQ----TPTTTPITTTTTVTPTPTPTGTQ 3067
              T T  P   +T  TPT T          GT     + TTTP  T +T TP+ TP    
Sbjct: 3219 PGTATALPALRSTATTPTATSVTAIPSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVH 3278

Query: 3068 TPTTTPITTTTT------VTPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP---- 3115
            T T    TTTTT       TP+ TP GT   T  P TTTT  T TP+ +P    TP    
Sbjct: 3279 TSTVLTTTTTTTRATGSVATPSSTP-GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWI 3337

Query: 3116 --TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTT 3170
              TTTP T  +TVTP+  P  T T T    TTTT  T    TP+ + TQT  T P  TTT
Sbjct: 3338 STTTTPTTRGSTVTPSSIPGTTHTATVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTTT 3396

Query: 3171 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3230
              T T T + T  P++TP T       TP P    T  TTP  T++TVTP+     T TP
Sbjct: 3397 ATTITATGS-TTNPSSTPGT-------TPIPPVLTTTATTPAATSSTVTPSSALGTTHTP 3448

Query: 3231 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3290
               P+  TT  T      G   P ++P T  T  T   +     T  T P +T T+ TP 
Sbjct: 3449 ---PVPNTTATT-----HGRSLPPSSPHTVRTAWTSATSGILGTTHITEP-STVTSHTPA 3499

Query: 3291 PTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT---- 3344
             T + TQ  TP  +    ++  T +P   GT TP  T  T+ TT T TP+ T T T    
Sbjct: 3500 ATTSTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTRGTSRTTATATPSKTRTSTLLPS 3559

Query: 3345 -PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT---TTTVTPTPTP 3385
             PT+ PITT  T                 P P P+G    T + I          P    
Sbjct: 3560 SPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLE 3619

Query: 3386 TGTQTPTTTPITTTTTVTPTPTPTGT---------------------------QTPTTTP 3418
               Q     P+     V       G                              P+T  
Sbjct: 3620 CRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPA 3679

Query: 3419 ITTTTTVTPTPTPTGTQTPTTTPITTT----TTVTPTPTPTGTQTPTTTPITTTTTVTP- 3473
             ++T T + TP  T   T  TT  TTT    +T TP+ TP GT    T P TT T   P 
Sbjct: 3680 TSSTATPSSTPGTTWILTKLTTTATTTESTGSTATPSSTP-GTTWILTEPSTTATVTVPT 3738

Query: 3474 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3531
              T T + TQ    TP  +TT  TPT T     +   TP ++  T T  P    T    T
Sbjct: 3739 GSTATASSTQATAGTPHVSTTATTPTVT-----SSKATPFSSPGTATALPALRST---AT 3790

Query: 3532 TPITTTTTVTPTPTPTGTQT---PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--- 3585
            TP  T+ T  P+ +   T T    TTTP  T +T TP+ TP    T T    T TTT   
Sbjct: 3791 TPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTTTATTTRAT 3850

Query: 3586 ---VTPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTP 3634
                TP+ TP GT   T  P TTTT  TVTP+ +P   +TP      TTTP T+ +TVTP
Sbjct: 3851 GSVATPSSTP-GTAHTTKVPTTTTTGFTVTPSSSPGTARTPPVWISTTTTPTTSGSTVTP 3909

Query: 3635 TPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTP--ITTTTTVTPTPTPTG-TQ 3688
            +  P  T TPT    TTTT  T    TP+ + TQT  T P  ITT TT+T T + T  + 
Sbjct: 3910 SSVPGTTHTPTVLTTTTTTVATGSMATPS-SSTQTSGTPPSLITTATTITATGSTTNPSS 3968

Query: 3689 TPTTTPI---TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT--GTQTPTTTPITT 3743
            TP TTPI    TTT  TP  T + T TP++   TT T   P  T T  G     ++P T 
Sbjct: 3969 TPGTTPIPPVLTTTATTPAAT-SSTVTPSSALGTTHTPPVPNTTATTHGRSLSPSSPHTV 4027

Query: 3744 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTG 3801
             T  T   + T   T  T P +T T+ TP  T   TQ  TP  +    ++  T +P   G
Sbjct: 4028 RTAWTSATSGTLGTTHITEP-STGTSHTPAATTGTTQHSTPALSSPHPSSRTTESPPSPG 4086

Query: 3802 TQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV---------------TP 3841
            T TP  T  T+ TT T TP+ T T T     PT+ PITT  T                 P
Sbjct: 4087 TTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYP 4146

Query: 3842 TPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT---- 3894
             P P+G    T + I          P       Q     P+     V       G     
Sbjct: 4147 MPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLGELGQVVECSLDFGLVCRN 4206

Query: 3895 -----------------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3931
                                     P+T   ++T   + TP  T   T  TT  TTT + 
Sbjct: 4207 REQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTAST 4266

Query: 3932 TPTPTPTGT----------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPI-------TTT 3974
              T TP+ T           +P TTP  T++  T + +P   +T TT P+       +T 
Sbjct: 4267 GSTATPSSTPGTAPPPKVLTSPATTPTATSSKATSSSSP---RTATTLPVLTSTATKSTA 4323

Query: 3975 TTVTPTPTPT-GT----QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 4029
            T+VTP P+ T GT       TTTP+ T +T+ P+ TP  T T T      TTT   + T 
Sbjct: 4324 TSVTPIPSSTLGTTGTLPEQTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTS 4383

Query: 4030 TGTQTPTTTPITT------TTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTP 4081
            T + TP TT I T      TTT    PT T + TP TT I T  TTT T T +   T TP
Sbjct: 4384 TPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATP 4443

Query: 4082 TTTPIT--------TTTTVT----PTPTPTGTQTPTTTPITTTTTVTPTPTPT------- 4122
            ++TP T        TT TVT     T T + TQ    TP  +TT  TPT T +       
Sbjct: 4444 SSTPGTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPSSS 4503

Query: 4123 -GTQT-------PTTTPITTTTTVTP-------------TPTPTGTQ---TPTTTPIT-- 4156
             GT T         TTP  T+ T  P             T TPT T    TP++TP T  
Sbjct: 4504 PGTATALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVH 4563

Query: 4157 TTTTVTPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG---TQTGPPTHTSTAPIAEL 4209
            T+T +T T T TG      TP++TP T  TT  PT T TG   T +  P    T P+   
Sbjct: 4564 TSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWIS 4623

Query: 4210 TTSNPPPESSTPQTSRSTSSP------------LTESTTLLST----LPPAIEMTSTAPP 4253
            TT+   P ++TP TS ST +P            LT +TT ++T     P +   TS  PP
Sbjct: 4624 TTTT--PTTTTPTTSGSTVTPSSIPGTTHTARVLTTTTTTVATGSMATPSSSTQTSGTPP 4681

Query: 4254 STPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTP 4313
            S  T  TT +   + + P ST  + P TP   +T  + +A +     +++    T  P  
Sbjct: 4682 SLTTTATTITATGSTTNPSSTPGTTPITPVLTSTATTPAATSSKATSSSSPRTATTLPVL 4741

Query: 4314 LSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYN 4373
             ST +    T   P PSS L       T+  P +     T   T   ++ S         
Sbjct: 4742 TSTATKSTATSFTPIPSSTLW-----TTWTVPAQTT---TPMSTMSTIHTS--------- 4784

Query: 4374 WSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGT 4407
                STP  T T +  T T +   +T S  TP +
Sbjct: 4785 ----STPETTHTSTVLTTTATMTRATNSTATPSS 4814



 Score = 1029 bits (2660), Expect = 0.0
 Identities = 1009/3123 (32%), Positives = 1296/3123 (41%), Gaps = 553/3123 (17%)

Query: 1698 TPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPT-TTPSPPTTTMTTLPPTTTSSPL 1756
            +P+P T+P   ++ +T P+    P+P  TT T  +    TPS  +T   T    ++S P+
Sbjct: 1438 SPAPGTSPQPSLSASTEPA---VPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPV 1494

Query: 1757 TTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPG 1816
            T TP  P               TT C P C WT W D   P   + GGD E    +   G
Sbjct: 1495 TVTPSAPG--------------TTTCQPRCQWTEWFDEDYPKSEQLGGDVESYDKIRAAG 1540

Query: 1817 W-----AANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEI 1871
                    +I C+A  +P+  + Q+GQ V CDV  GL+C+N +Q+  GV  M  C NY I
Sbjct: 1541 GHLCQQPKDIECQAESFPNWTLAQVGQKVHCDVHFGLVCRNWEQE--GVFKM--CYNYRI 1596

Query: 1872 NVQCCECVTQPTTMTTTTTENPTPPTTTPITTTT-TVTPTPTPTGTQTPTTTPITTTTTV 1930
             V CC   +        TT  PT    T  TTTT  +  TP PT +   T  P  +TT V
Sbjct: 1597 RVLCC---SDDHCRGRATTPPPTTELETATTTTTQALFSTPQPTSSPGLTRAPPASTTAV 1653

Query: 1931 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-----TGT 1985
             PT +   T    T+ + T TT  PT TP G+  PT   + T+T  T +  P      GT
Sbjct: 1654 -PTLSEGLTSPRYTSTLGTATTGGPT-TPAGSTEPTVPGVATSTLPTRSALPGTTGSLGT 1711

Query: 1986 QTPTTTP-ITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2043
              P+  P +  TT  T    PTGT  T +  P+TT+   T T   + +Q  T+TP T TT
Sbjct: 1712 WRPSQPPTLAPTTMATSRARPTGTASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETT 1771

Query: 2044 TVTPTPTPTGTQTPTTTPITTTT----TVTPTPTPTGTQTPTTTPITTT---TTVTPTPT 2096
                T T T   T    P    T       PT    G    T   I          P   
Sbjct: 1772 MSPLTNTTTSQGTTRCQPKCEWTEWFDVDFPTSGVAGGDMETFENIRAAGGKMCWAPKSI 1831

Query: 2097 PTGTQTPTTTPITTTTTVTPTPTPTG----------------------------TQTPTT 2128
                +      I     V      TG                            +  P+T
Sbjct: 1832 ECRAENYPEVSIDQVGQVLTCSLETGLTCKNEDQTGRFNMCFNYNVRVLCCDDYSHCPST 1891

Query: 2129 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2188
               ++T T + TP  T   T  TT  TTT +   T TPT T      P   TTT T TPT
Sbjct: 1892 PATSSTATPSSTPGTTWILTKPTTTATTTASTGSTATPTSTLRTAPPPKVLTTTAT-TPT 1950

Query: 2189 PTGTQ-TPTTTPITTT-------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ- 2239
             T ++ TP+++P T T       T  TPT T   T  P+++  TT T ++ T TPT T  
Sbjct: 1951 VTSSKATPSSSPGTATALPALRSTATTPTATSV-TPIPSSSLGTTWTRLSQTTTPTATMS 2009

Query: 2240 --TPTTTPIT--TTTTVTPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTT 2290
              TP++TP T  T+T +T T T TG      TP++TP T  TT  PT T TG T TP+++
Sbjct: 2010 TATPSSTPETAHTSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSS 2069

Query: 2291 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PT 2347
            P T         TP    + TTTP T  +TVTP+  P  T T T    TTTT  T    T
Sbjct: 2070 PGTAL-------TPPVWISTTTTPTTRGSTVTPSSIPGTTHTATVLTTTTTTVATGSMAT 2122

Query: 2348 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2407
            P+ + TQT  T P  TTT  T T T + T  P++TP T       TP P    T  TTP 
Sbjct: 2123 PS-SSTQTSGTPPSLTTTATTITATGS-TTNPSSTPGT-------TPIPPVLTTTATTPA 2173

Query: 2408 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2467
             T+ TVTP+     T TP   P T  TT   +  P+   T  T   + T+ +  T   T 
Sbjct: 2174 ATSNTVTPSSALGTTHTP-PVPNTMATTHGRSLPPSSPHTVRTAWTSATSGILGTTHITE 2232

Query: 2468 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2527
              T T+  +  TT  T   TP      +  P + TT   P+P   GT TP  T  T+ TT
Sbjct: 2233 PSTVTSHTLAATTGTTQHSTPA---LSSPHPSSRTTESPPSP---GTTTPGHTTATSRTT 2286

Query: 2528 VTPTPTPTGTQT-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTP 2567
             T TP+ T T T     PT+ PITT  T+                P P P+G    T + 
Sbjct: 2287 ATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSN 2346

Query: 2568 ITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT------------------ 2606
            I          P       Q     P+     V       G                   
Sbjct: 2347 IRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYE 2406

Query: 2607 ---------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT----TTVTPTPTPTGTQ 2653
                       P+T   ++T   + TP  T   T  TT  TTT    +T TP+ TP GT 
Sbjct: 2407 IRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTESTGSTATPSSTP-GTT 2465

Query: 2654 TPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT- 2709
               T P TT T   P   T T + TQ    TP  +TT  TPT T +   TP ++P T T 
Sbjct: 2466 WILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVT-SSKATPFSSPGTATA 2524

Query: 2710 ------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTV 2758
                  T  TPT T + T  P+++  TT T ++ T TPT T    TP++TP T  T+T +
Sbjct: 2525 LPALRSTATTPTAT-SFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVL 2583

Query: 2759 TPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGT 2813
            T T T TG      TP++TP T  TT   T T TG T TP+++P T  T       P   
Sbjct: 2584 TTTATTTGATGSVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTART------LPVWI 2637

Query: 2814 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTT 2870
             T TTTP T  +TVTP+  P  T TPT    TTTT  T    TP+ + TQT  T P  TT
Sbjct: 2638 ST-TTTPTTRGSTVTPSSIPGTTHTPTVLTTTTTTVATGSMATPS-SSTQTSGTPPSLTT 2695

Query: 2871 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2930
            T  T T T + T  P++TP T       TP P    T  TTP  T++TVTP+     T T
Sbjct: 2696 TATTITATGS-TTNPSSTPGT-------TPIPPVLTTTATTPAATSSTVTPSSALGTTHT 2747

Query: 2931 PTTTPITTTTTVTPTPTPTGTQTPTT--TPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2988
            P   P TT TT   + +P+   T  T  T  T+ T  T   T   T T  T   TT TT 
Sbjct: 2748 P-PVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEPSTGTSHTPAATTGTTQ 2806

Query: 2989 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT--- 3045
              TP  +        P + TT   P+P   GT TP  T  T+ TT T TP+ T T T   
Sbjct: 2807 HSTPALSSPH-----PSSRTTESPPSP---GTTTPGHTRATSRTTATATPSKTRTSTLLP 2858

Query: 3046 --PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT---TTTVTPTPT 3085
              PT+ PITT  T+                P P P+G    T + I          P   
Sbjct: 2859 SSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGL 2918

Query: 3086 PTGTQTPTTTPITTTTTVTPTPTPTGT---------------------------QTPTTT 3118
                Q     P+     V       G                              P+T 
Sbjct: 2919 ECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTP 2978

Query: 3119 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3178
              ++T T + TP  T   T  TT  TTT T   T  P+ T      P   T+T T TPT 
Sbjct: 2979 ATSSTATPSSTPGTTWILTEQTTAATTTATTGSTAIPSSTPGTAPPPKVLTSTAT-TPTA 3037

Query: 3179 TGTQ-TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPIT 3236
            T ++ T +++P T TT    T T T +   + TPI + T  T     TGT    TTTP+ 
Sbjct: 3038 TSSKATSSSSPRTATTLPVLTSTATKSTATSFTPIPSFTLGT-----TGTLPEQTTTPMA 3092

Query: 3237 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPT 3294
            T +T+ P+ TP  T T T      TTT   +   T + TP TT I T  TT  T T    
Sbjct: 3093 TMSTIHPSSTPETTHTSTVLTTKATTTRATSSMSTPSSTPGTTWILTELTTAATTTAATG 3152

Query: 3295 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3354
             T TP++TP TT     P+ T T      T P  +T T + T    GT    T+  TT T
Sbjct: 3153 PTATPSSTPGTTWILTEPSTTAT-----VTVPTGSTATASSTRATAGTLKVLTSTATTPT 3207

Query: 3355 TVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPT--------GTQ----TPTTTPITTTTT 3401
             ++   TP+ +  T T  P   +T  TPT T          GT     + TTTP  T +T
Sbjct: 3208 VISSRATPSSSPGTATALPALRSTATTPTATSVTAIPSSSLGTAWTRLSQTTTPTATMST 3267

Query: 3402 VTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQTPTTTPITTTT--TVTPTPT 3453
             TP+ TP    T T    TTTTT       TP+ TP GT   T  P TTTT  T TP+ +
Sbjct: 3268 ATPSSTPETVHTSTVLTTTTTTTRATGSVATPSSTP-GTAHTTKVPTTTTTGFTATPSSS 3326

Query: 3454 PTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQ 3504
            P    TP      TTTP T  +TVTP+  P  T T T    TTTT  T    TP+ + TQ
Sbjct: 3327 PGTALTPPVWISTTTTPTTRGSTVTPSSIPGTTHTATVLTTTTTTVATGSMATPS-SSTQ 3385

Query: 3505 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3564
            T  T P  TTT  T T T + T  P++TP T       TP P    T  TTP  T++TVT
Sbjct: 3386 TSGTPPSLTTTATTITATGS-TTNPSSTPGT-------TPIPPVLTTTATTPAATSSTVT 3437

Query: 3565 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3624
            P+     T TP   P+  TT  T      G   P ++P T  T  T   +     T  T 
Sbjct: 3438 PSSALGTTHTP---PVPNTTATT-----HGRSLPPSSPHTVRTAWTSATSGILGTTHITE 3489

Query: 3625 PITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3682
            P +T T+ TP  T + TQ  TP  +    ++  T +P   GT TP  T  T+ TT T TP
Sbjct: 3490 P-STVTSHTPAATTSTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTRGTSRTTATATP 3548

Query: 3683 TPTGTQT-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT-- 3720
            + T T T     PT+ PITT  T                 P P P+G    T + I    
Sbjct: 3549 SKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAG 3608

Query: 3721 -TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----------------------- 3756
                  P       Q     P+     V       G                        
Sbjct: 3609 GAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFC 3668

Query: 3757 ----QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT----TTVTPTPTPTGTQTPTTT 3808
                  P+T   ++T T + TP  T   T  TT  TTT    +T TP+ TP GT    T 
Sbjct: 3669 CNYGHCPSTPATSSTATPSSTPGTTWILTKLTTTATTTESTGSTATPSSTP-GTTWILTE 3727

Query: 3809 PITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3865
            P TT T   P   T T + TQ    TP  +TT  TPT T     +   TP ++  T T  
Sbjct: 3728 PSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVT-----SSKATPFSSPGTATAL 3782

Query: 3866 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQT---PTTTPITTTTTVTPTPTPTGTQTPTT 3922
            P    T    TTP  T+ T  P+ +   T T    TTTP  T +T TP+ TP    T T 
Sbjct: 3783 PALRST---ATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTV 3839

Query: 3923 TPITTTTT------VTPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP------TT 3968
               T TTT       TP+ TP GT   T  P TTTT  TVTP+ +P   +TP      TT
Sbjct: 3840 LTTTATTTRATGSVATPSSTP-GTAHTTKVPTTTTTGFTVTPSSSPGTARTPPVWISTTT 3898

Query: 3969 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTP--ITTTTTV 4023
            TP T+ +TVTP+  P  T TPT    TTTT  T    TP+ + TQT  T P  ITT TT+
Sbjct: 3899 TPTTSGSTVTPSSVPGTTHTPTVLTTTTTTVATGSMATPS-SSTQTSGTPPSLITTATTI 3957

Query: 4024 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4083
            T T +   T  P++TP T       TP P    T  TTP  T++TVTP+     T TP  
Sbjct: 3958 TATGS---TTNPSSTPGT-------TPIPPVLTTTATTPAATSSTVTPSSALGTTHTP-P 4006

Query: 4084 TPITTTTTVTPTPTPTGTQTPTT--TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 4141
             P TT TT   + +P+   T  T  T  T+ T  T   T   T T  T   TT TT   T
Sbjct: 4007 VPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEPSTGTSHTPAATTGTTQHST 4066

Query: 4142 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHT 4201
            P  +        P + TT   P+P   GT TP  T  T+ TT T TP+ T T T  P+  
Sbjct: 4067 PALSSPH-----PSSRTTESPPSP---GTTTPGHTTATSRTTATATPSKTRTSTLLPSSP 4118

Query: 4202 STAPIAELTTSNPPPES--------STPQTSRS-----TSSPLTESTTLLSTLPPAIEMT 4248
            ++API  + T+   P+         S P    S     T S +  +   +   P  +E  
Sbjct: 4119 TSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECR 4178

Query: 4249 STAPPSTPTAPT----------------------------------TTSGGHTLSPPPST 4274
            + A P  P                                        + GH  S P ++
Sbjct: 4179 AQAQPGVPLGELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATS 4238

Query: 4275 TT----SPPGTP---TRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRT----- 4322
            +T    S PGT    T  TTT +++A T ST   ++T    P P  L++P+   T     
Sbjct: 4239 STAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSK 4298

Query: 4323 -------------------------TGLRPYPSSVL----ICCVLNDTYYAPGEEVYNGT 4353
                                     T + P PSS L           T  A    ++  +
Sbjct: 4299 ATSSSSPRTATTLPVLTSTATKSTATSVTPIPSSTLGTTGTLPEQTTTPVATMSTIHPSS 4358

Query: 4354 YGDTCYFVNCSLSCTLEFYNWSCPSTPSPTP---------TPSKSTPTPSKPSSTPSKPT 4404
              +T +      +        S  STPS TP         T + +T   + P++TPS  T
Sbjct: 4359 TPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTAATTTAATGPTATPSS-T 4417

Query: 4405 PGT 4407
            PGT
Sbjct: 4418 PGT 4420



 Score =  173 bits (439), Expect = 3e-42
 Identities = 140/414 (33%), Positives = 190/414 (45%), Gaps = 72/414 (17%)

Query: 1209 KSCVCTNSSQV--VCRPEEGKILNQTQDGAFCYWEICGPN---GTVEKHFNICSITTRPS 1263
            +  +C NS Q   +C   E ++L        C +  CGP+   GT  +     S +T P+
Sbjct: 1406 RGLMCANSQQSPPLCHDYELRVL-------CCEYVPCGPSPAPGTSPQPS--LSASTEPA 1456

Query: 1264 TLT-TFTTITLPTT-----PTTFTTTTTTTTPTSSTVLSTTPKL-----C---CLWSDWI 1309
              T T TT T  TT         T   T+ T +SS  ++ TP       C   C W++W 
Sbjct: 1457 VPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSAPGTTTCQPRCQWTEWF 1516

Query: 1310 NEDHPSSGSDDGDRETFDGV-------CGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVG 1362
            +ED+P S    GD E++D +       C  P+DIEC++   P+ +L Q+GQKV CDV  G
Sbjct: 1517 DEDYPKSEQLGGDVESYDKIRAAGGHLCQQPKDIECQAESFPNWTLAQVGQKVHCDVHFG 1576

Query: 1363 FICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTP 1422
             +C+N +Q   G F +CY+Y+IRV CC   D C                  TT PPTT  
Sbjct: 1577 LVCRNWEQ--EGVFKMCYNYRIRVLCCSD-DHC--------------RGRATTPPPTTEL 1619

Query: 1423 SPPTTTTT-----TPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTP 1477
               TTTTT     TP PT++P      T  PP +TT  P +S   T P  T+     TT 
Sbjct: 1620 ETATTTTTQALFSTPQPTSSPG----LTRAPPASTTAVPTLSEGLTSPRYTSTLGTATTG 1675

Query: 1478 SPPT----TTPSPPTTTTTTPP-----PTTTPSPPTTTPITPP--ASTTTLPPTTTPSPP 1526
             P T    T P+ P   T+T P     P TT S  T  P  PP  A TT       P+  
Sbjct: 1676 GPTTPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTMATSRARPTGT 1735

Query: 1527 TTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSP 1580
             +T +  P TT+ +P  T+ ++   + T+ P T T   P T TTT   TT   P
Sbjct: 1736 ASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTTRCQP 1789



 Score =  156 bits (395), Expect = 4e-37
 Identities = 135/382 (35%), Positives = 176/382 (46%), Gaps = 34/382 (8%)

Query: 1396 ITTPS--PPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPP--TTTPSPPITTTTTPPPT 1451
            + TPS  P T   +  PT+TTT   T TPS    T  TPP   +TT +P  TT TT   T
Sbjct: 4581 VATPSSTPGTAHTTKVPTTTTT-GFTATPSSSPGTALTPPVWISTTTTPTTTTPTTSGST 4639

Query: 1452 TTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPP 1511
             TPS    TT T    TT +  TT  +    TPS  T T+ TPP  TT    T T IT  
Sbjct: 4640 VTPSSIPGTTHTARVLTTTT--TTVATGSMATPSSSTQTSGTPPSLTT----TATTITAT 4693

Query: 1512 ASTT---TLPPTTTPSPPTTTTTTPPPTT--------TPSPPTTTPITPPTSTTTLPPTT 1560
             STT   + P TT  +P  T+T T P  T        +P   TT P+   T+T +   + 
Sbjct: 4694 GSTTNPSSTPGTTPITPVLTSTATTPAATSSKATSSSSPRTATTLPVLTSTATKSTATSF 4753

Query: 1561 TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTT--TP 1618
            TP P  T  TT    T P+  TT   +  TI T++ P TT  S   TTT T    T  T 
Sbjct: 4754 TPIPSSTLWTT---WTVPAQTTTPMSTMSTIHTSSTPETTHTSTVLTTTATMTRATNSTA 4810

Query: 1619 SPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPT 1678
            +P +T   T   +  T   TTT +   T T +  P TT      T PS   T       T
Sbjct: 4811 TPSSTLGTTRILTELTTTATTTAATGSTATLSSTPGTT---WILTEPSTIATVMVPTGST 4867

Query: 1679 TTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPS 1738
             T SS + T  +P   T     PT T +S + +++T  +T TP+  P+++ T S +T  S
Sbjct: 4868 ATASSTLGTAHTPKVVTTMATMPTAT-ASTVPSSSTVGTTRTPAVLPSSLPTFSVSTVSS 4926

Query: 1739 PPTTTMTTLPPTTTSSPLTTTP 1760
               + +TTL PT   S   +TP
Sbjct: 4927 ---SVLTTLRPTGFPSSHFSTP 4945



 Score =  127 bits (320), Expect = 2e-28
 Identities = 120/459 (26%), Positives = 185/459 (40%), Gaps = 84/459 (18%)

Query: 856  CHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVT 915
            C   CS++G  HY TFDG  Y F G+C+YV +++    ++  G+ S+  +N  C  +   
Sbjct: 5074 CECICSMWGGSHYSTFDGTSYTFRGNCTYVLMREI---HARFGNLSLYLDNHYCTASATA 5130

Query: 916  ----CSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWD 971
                C +A+ I     ++ L     +V  ++EG  + +    V       S  G++V   
Sbjct: 5131 AAARCPRALSIHYKSMDIVLTVT--MVHGKEEGL-ILFDQIPVSSGF---SKNGVLVSVL 5184

Query: 972  KRTTVFIKL-----APSYKGTVC--------------GLCGNFDHRSNNDFTTRDHMVVS 1012
              TT+ + +     + ++ G V               G CG   +   +D   RD    +
Sbjct: 5185 GTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAA 5244

Query: 1013 SELDFGNSW------------------KEAPTCPDVST-NPEPCSLNPHRRSWAEKQCSI 1053
            S  D   +W                    +P  P  ST  P PC   P         C +
Sbjct: 5245 SCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQP--------LCDL 5296

Query: 1054 LKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWR- 1112
            + S VF+ CH+ V P PF+ AC+ D C     G  E  C ++ +YA+ C   G C  WR 
Sbjct: 5297 MLSQVFAECHNLVPPGPFFNACISDHCR----GRLEVPCQSLEAYAELCRARGVCSDWRG 5352

Query: 1113 -TPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDR 1171
             T  LC + C    PP +    Y+PCG     TC + N   S       EGC+  CP+D+
Sbjct: 5353 ATGGLCDLTC----PPTKV---YKPCGPIQPATCNSRN--QSPQLEGMAEGCF--CPEDQ 5401

Query: 1172 PIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSS-QVVCRP----EEG 1226
             ++   +  CV A  C C   D  +P          C+SCVC   S  V C+P     +G
Sbjct: 5402 ILFNAHMGICVQA--CPCVGPD-GFPKFPGERWVSNCQSCVCDEGSVSVQCKPLPCDAQG 5458

Query: 1227 KILNQTQDGAFCYWEICGPNGTVEKHFNICSITTRPSTL 1265
            +     + G          N    +   +C+ TT P +L
Sbjct: 5459 QPPPCNRPGFVTVTRPRAENPCCPETVCVCNTTTCPQSL 5497



 Score =  118 bits (295), Expect = 2e-25
 Identities = 151/617 (24%), Positives = 236/617 (38%), Gaps = 119/617 (19%)

Query: 4336 CVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSK 4395
            C  + T  APGE V++   G  C      LSC             S   +   + P    
Sbjct: 757  CYAHGTVLAPGEVVHDE--GAVCSCTGGKLSCL----------GASLQKSTGCAAPMVYL 804

Query: 4396 PSSTPSKPTPGTKP-PECPDFD--------------PPRQENETWWLC----DCFMATCK 4436
              S  S  TPG +    C   D              PP   ++    C    DC    C 
Sbjct: 805  DCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLVSDGSGGCIAEEDC---PCV 861

Query: 4437 YNNTV----EIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTF 4492
            +N       E ++V+C      TC N     R E     C H  C   C  +GD H++TF
Sbjct: 862  HNEATYKPGETIRVDCNTC---TCRNR----RWE-----CSHRLCLGTCVAYGDGHFITF 909

Query: 4493 DGLYYSYQGNCTYVLVEEI---SPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVL 4549
            DG  YS++G+C Y+L ++    + +   F +  +N  C      +C + + +  E+ E++
Sbjct: 910  DGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTG-TTCSKAIKLFVESYELI 968

Query: 4550 IKTVHMMPMQVQVQVNRQAVAL------PYKKYGLEVYQSGINYVVDIPELGVLVSYN-G 4602
            ++           +   +AVA       PYK     +   GI  V++    G+ VS++  
Sbjct: 969  LQ-----------EGTFKAVARGPGGDPPYK-----IRYMGIFLVIETH--GMAVSWDRK 1010

Query: 4603 LSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCP 4662
             S  +RL +  +     G CG   +   +D    S  +V +     + W ++    P CP
Sbjct: 1011 TSVFIRL-HQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLS----PSCP 1065

Query: 4663 HSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSC 4722
              +   K P           P +       C ++    FA C + V    YY+ACV D+C
Sbjct: 1066 -DALAPKDPCT-------ANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDAC 1117

Query: 4723 FM-PGSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVECPSHR-------EYQACG 4772
                G   E  C ++ AYA  C    +C+ WR  T   C + C  +         YQ CG
Sbjct: 1118 ACDSGGDCECFCTAVAAYAQACHDAGLCVSWR--TPDTCPLFCDFYNPHGGCEWHYQPCG 1175

Query: 4773 PAEEPTCKSSSSQ-QNNTVLVEGCF--CPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGE 4829
                 TC++ S     +   +EGC+  CP     +      CV  CGC   D    + G 
Sbjct: 1176 APCLKTCRNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVAQCGCYDKDGNYYDVGA 1235

Query: 4830 HFEF--DCKNCVCLEGGSGIIC----QPKRCSQKPVTHCVEDGTYLATEVNPADTCCNIT 4883
                  +C++C C    SGI C    +   C+ +  T+  +D  Y  T+   A   C I 
Sbjct: 1236 RVPTAENCQSCNCTP--SGIQCAHSLEACTCTYEDRTYSYQDVIYNTTDGLGA---CLIA 1290

Query: 4884 VCKCNTSLCKEKPSVCP 4900
            +C  N ++ + K   CP
Sbjct: 1291 ICGSNGTIIR-KAVACP 1306



 Score =  115 bits (288), Expect = 1e-24
 Identities = 124/519 (23%), Positives = 200/519 (38%), Gaps = 65/519 (12%)

Query: 4455 TCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPS 4514
            TCS GL           C    C   C+  G  H  T+D   Y   G+C+YVL ++ + S
Sbjct: 411  TCSGGLWQ---------CQDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADS 461

Query: 4515 VDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKT-----VHMMPMQVQVQVNRQAV 4569
              +F V  +   C   D  +C + + +  +  +  I+      V +  +  Q+ ++   +
Sbjct: 462  --SFTVLAELRKCGLTDNENCLKAVTLSLDGGDTAIRVQADGGVFLNSIYTQLPLSAANI 519

Query: 4570 ALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRL-PYHRFGNNTKGQCGTCTNT 4628
             L        V Q+G+   + +  + ++  +      VRL P H+      G CG     
Sbjct: 520  TLFTPSSFFIVVQTGLGLQLLVQLVPLMQVF------VRLDPAHQ--GQMCGLCGNFNQN 571

Query: 4629 TSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCT 4688
             +DD    SG + +   A A+ W     ++  C ++ ++ + P            H    
Sbjct: 572  QADDFTALSGVVEATGAAFANTW----KAQAACANARNSFEDPCSLSVENENYARH---- 623

Query: 4689 PSPLCQLIKD--SLFAQCHALVPPQHYYDACVFDSCFMPGS-SLECASLQAYAALCAQQN 4745
                C  + D  S F++CH+++ P+ ++  C+FD+C    S    CA+L +Y   CA + 
Sbjct: 624  ---WCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSEDCLCAALSSYVHACAAKG 680

Query: 4746 ICL-DWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQ----QNNTVLVEGCFCPEG 4800
            + L DWR+      +  CP  + Y     A +PTC+  S        + V V+GC CP G
Sbjct: 681  VQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCRGLSEADVTCSVSFVPVDGCTCPAG 740

Query: 4801 TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT 4860
            T     G  V  + C C     V    GE    +   C C  G    +      S +  T
Sbjct: 741  TFLNDAGACVPAQECPCYAHGTVLAP-GEVVHDEGAVCSCTGGKLSCL----GASLQKST 795

Query: 4861 HCVEDGTYLATEVNPADT-------CCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGR 4913
             C     YL    + A T        C+     C ++ C     VCP G         G 
Sbjct: 796  GCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHC-VSGCVCPPGLVSDGS---GG 851

Query: 4914 CCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDK 4952
            C      E    CVH  A Y+PG  +    C  C C ++
Sbjct: 852  CI----AEEDCPCVHNEATYKPGETI-RVDCNTCTCRNR 885



 Score =  114 bits (284), Expect = 3e-24
 Identities = 150/515 (29%), Positives = 192/515 (37%), Gaps = 87/515 (16%)

Query: 3955 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4014
            TP PT T  +T TTT   TT  +  TP PT +   T  P  +TT V PT +   T    T
Sbjct: 1612 TPPPT-TELETATTT---TTQALFSTPQPTSSPGLTRAPPASTTAV-PTLSEGLTSPRYT 1666

Query: 4015 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-----TGTQTPTTTP-ITTTTT 4068
            + + T TT  PT TP G+  PT   + T+T  T +  P      GT  P+  P +  TT 
Sbjct: 1667 STLGTATTGGPT-TPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTM 1725

Query: 4069 VTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4127
             T    PTGT  T +  P+TT+   T T   + +Q  T+TP T TT    T T T   T 
Sbjct: 1726 ATSRARPTGTASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTT 1785

Query: 4128 TTTPITTTTTVTPTPTPT----GTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPITT 4180
               P    T       PT    G    T   I          P       +      I  
Sbjct: 1786 RCQPKCEWTEWFDVDFPTSGVAGGDMETFENIRAAGGKMCWAPKSIECRAENYPEVSIDQ 1845

Query: 4181 TTTVTPTPTPTGTQTGPPTHT-------------------STAPIAELTTSNPPPESSTP 4221
               V      TG        T                   S  P    T+S   P SSTP
Sbjct: 1846 VGQVLTCSLETGLTCKNEDQTGRFNMCFNYNVRVLCCDDYSHCPSTPATSSTATP-SSTP 1904

Query: 4222 QTSRSTSSPLTESTTLLSTLPPAIEMTS--TAPP-----STPTAPTTTSGGHTLSPPPST 4274
             T+   + P T +TT  ST   A   ++  TAPP     +T T PT TS   T S  P T
Sbjct: 1905 GTTWILTKPTTTATTTASTGSTATPTSTLRTAPPPKVLTTTATTPTVTSSKATPSSSPGT 1964

Query: 4275 TTSPPGTPTRGTTTGSSSAPTPSTV----------------QTTTTSAWTPTPTPLSTPS 4318
             T+ P   +  TT      PT ++V                QTTT +A   T TP STP 
Sbjct: 1965 ATALPALRSTATT------PTATSVTPIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPE 2018

Query: 4319 IIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPS 4378
               T       S+VL       T  A G      +   T +      + T  F      +
Sbjct: 2019 TAHT-------STVLTATA--TTTGATGSVATPSSTPGTAHTTKVPTTTTTGF-----TA 2064

Query: 4379 TPSPTP----TPSKSTPTPSKPSSTPSKPTPGTKP 4409
            TPS +P    TP     T + P++  S  TP + P
Sbjct: 2065 TPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIP 2099



 Score =  112 bits (281), Expect = 7e-24
 Identities = 158/661 (23%), Positives = 247/661 (37%), Gaps = 115/661 (17%)

Query: 291  CPKTCPG-NLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCV--- 346
            CP + P  +   L S SP     + + +  + E   ++ C     TV   +GD+  V   
Sbjct: 4989 CPTSPPPVSSAPLSSPSPAPGCDNAIPLRQVNETWTLENC-----TVARCVGDNRVVLLD 5043

Query: 347  --PVSQCHCRLHGHLYTPGQEITNDCE---QCVCNAGRWVCKDLPCPGTCALEGGSHITT 401
              PV+   C ++ HL     + +  C+   +C C               C++ GGSH +T
Sbjct: 5044 PKPVANVTC-VNKHLPIKVSDPSQPCDFHYECEC--------------ICSMWGGSHYST 5088

Query: 402  FDGKTYTFHGDCYYVLAKGDH----NDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNV 457
            FDG +YTF G+C YVL +  H    N S  L        +T         + +  K  ++
Sbjct: 5089 FDGTSYTFRGNCTYVLMREIHARFGNLSLYLDNHYCTASATAAAARCPRALSIHYKSMDI 5148

Query: 458  VVF------KSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQ 511
            V+       K +G +L +++ V+        S F  S   ++VS+     ++V + P + 
Sbjct: 5149 VLTVTMVHGKEEGLILFDQIPVS--------SGF--SKNGVLVSVLGTTTMRVDI-PALG 5197

Query: 512  LFVTLD-QASQGQV---------QGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQS 561
            + VT + Q  Q ++         +G CG     + DD     G   A+    A TW    
Sbjct: 5198 VSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPD 5257

Query: 562  SCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETP------------FGRCHSAVDPAE 609
            S  D   W          +A+ A    S    T  P            F  CH+ V P  
Sbjct: 5258 SRKDGC-WAPTGTP---PTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGP 5313

Query: 610  YYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLY 669
            ++  C  D  +C+   +  C +L +YA  C A+GV    WR         +CP ++V+  
Sbjct: 5314 FFNACISD--HCRGRLEVPCQSLEAYAELCRARGVCS-DWRGATGGLCDLTCPPTKVYKP 5370

Query: 670  NLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCY-HRGLYLE 728
                   TC S +++    LEG A  +GC CP+   L      + +  C C    G    
Sbjct: 5371 CGPIQPATCNSRNQSPQ--LEGMA--EGCFCPEDQILFNAHMGICVQACPCVGPDGFPKF 5426

Query: 729  AGDVVVRQEERCVCRDG--RLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALS--C 784
             G+  V   + CVC +G   + C+ +    Q    P     C+    +  ++PRA +  C
Sbjct: 5427 PGERWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPP-----CNRPGFVTVTRPRAENPCC 5481

Query: 785  QTLAAGYYHTECVSGC-VCPDG---LMDDGRGGCVVEKECP---CVHNNDLYSSGAKI-- 835
                     T C     VCP G   +     G C     C    C +N   Y  GA    
Sbjct: 5482 PETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQLCSYNGTFYGVGATFPG 5541

Query: 836  KVDCNTCTCKRG-----RWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDY 890
             + C+ CTC  G        C +  C+ T    G         +Y    G C    VQ  
Sbjct: 5542 ALPCHMCTCLSGDTQDPTVQCQEDACNNTTCPQGF--------EYKRVAGQCCGECVQTA 5593

Query: 891  C 891
            C
Sbjct: 5594 C 5594



 Score =  107 bits (268), Expect = 2e-22
 Identities = 74/219 (33%), Positives = 100/219 (45%), Gaps = 33/219 (15%)

Query: 1760 PLPPSITPPTFS----PFSTTTPTTP----CV-PLCNWTGWLDSGKPNFHKPGGDTELIG 1810
            P  P+ TP TF+    P STT+P  P    CV  +C W+ W +  +P     GGD E   
Sbjct: 1306 PGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFE 1365

Query: 1811 DVCGPGWA-----ANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAF 1865
            ++   G+      A+I CRA   PD+P+ +LGQ V CD   GL+C N  Q P        
Sbjct: 1366 NLRQRGYQVCPVLADIECRAAQLPDMPLEELGQQVDCDRMRGLMCANSQQSP------PL 1419

Query: 1866 CLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 1925
            C +YE+ V CCE V             P  P+  P T+        T     TPT T  T
Sbjct: 1420 CHDYELRVLCCEYV-------------PCGPSPAPGTSPQPSLSASTEPAVPTPTQTTAT 1466

Query: 1926 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 1964
              TT+  TP+   T   T+   +++  VT TP+  GT T
Sbjct: 1467 EKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSAPGTTT 1505



 Score =  105 bits (263), Expect = 9e-22
 Identities = 103/385 (26%), Positives = 150/385 (38%), Gaps = 40/385 (10%)

Query: 36   VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGV---- 91
            +CS WG  HY TFDG  + F G C Y    +    +   +++L      A A A      
Sbjct: 5077 ICSMWGGSHYSTFDGTSYTFRGNCTYVLMREIHARFGNLSLYLDNHYCTASATAAAARCP 5136

Query: 92   ESILLTIKDDTIYLT--------RHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYS--RA 141
             ++ +  K   I LT          L + +   VS+     G+L+      T        
Sbjct: 5137 RALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLGTTTMRVDIPAL 5196

Query: 142  GLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKI-- 199
            G+++ +N +        + F N+T G CG     Q       DG   +  +  +M K   
Sbjct: 5197 GVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCK--DMAKTWL 5254

Query: 200  --NQPDVVCEDPE------EEVAPASCSEHRAECER-----LLTAEAFADCQDLVPLEPY 246
              +     C  P          AP S +     C       L+ ++ FA+C +LVP  P+
Sbjct: 5255 VPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLVPPGPF 5314

Query: 247  LRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTAT--LCPKTCPGNLVYLES 304
              AC  D CR  G     C ++  ++  C  A G   +WR AT  LC  TCP   VY   
Sbjct: 5315 FNACISDHCR--GRLEVPCQSLEAYAELC-RARGVCSDWRGATGGLCDLTCPPTKVYKPC 5371

Query: 305  GSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQ 364
            G     TC+    S    E   +GCFCPE  +  +     CV    C     G    PG+
Sbjct: 5372 GPIQPATCNSRNQSPQL-EGMAEGCFCPEDQILFNAHMGICVQACPC-VGPDGFPKFPGE 5429

Query: 365  EITNDCEQCVCNAG--RWVCKDLPC 387
               ++C+ CVC+ G     CK LPC
Sbjct: 5430 RWVSNCQSCVCDEGSVSVQCKPLPC 5454



 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 107/403 (26%), Positives = 156/403 (38%), Gaps = 53/403 (13%)

Query: 4481 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLI 4540
            C+ WGD HY TFDG  + + G C YV  E    + ++F V +              R L+
Sbjct: 77   CSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQL-------------RRGLV 123

Query: 4541 -VRHETQEVLIKTVHMM--PMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVL 4597
              R     V+IK   ++       V +N Q   LPY + GL V QSG +Y+     L + 
Sbjct: 124  GSRPVVTRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSG-DYIKVSIRLVLT 182

Query: 4598 VSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPS 4657
              +NG   ++     ++ N T G CG      + +        ++  +    Q L  D  
Sbjct: 183  FLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKL--DGP 240

Query: 4658 KPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDAC 4717
               CP          + +P G  T     C      + +    FA+CHALV    Y  AC
Sbjct: 241  TEQCP--------DPLPLPAGNCTDEEGICH-----RTLLGPAFAECHALVDSTAYLAAC 287

Query: 4718 VFDSCFMPGSSLECASLQAYAALCAQQ-NICLDWRNHTHGACLVECPSHREYQACGPAEE 4776
              D C  P  +  CA+   Y+  CA       +WR      C   CP + ++Q CG    
Sbjct: 288  AQDLCRCP--TCPCATFVEYSRQCAHAGGQPRNWR--CPELCPRTCPLNMQHQECGSPCT 343

Query: 4777 PTCKS-SSSQQNNTVLVEGCFCPEGTM-----NYAPGFDVCVKTCGCV--GPDNVPREFG 4828
             TC +   +Q      V+GCFCP G       +      + +  C C   G    P   G
Sbjct: 344  DTCSNPQRAQLCEDHCVDGCFCPPGRSCTVLDDITHSGCLPLGQCPCTHGGRTYSP---G 400

Query: 4829 EHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLAT 4871
              F   C +C C   G    CQ   C   P T  V+ G +++T
Sbjct: 401  TSFNTTCSSCTC--SGGLWQCQDLPC---PGTCSVQGGAHIST 438



 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 66/192 (34%), Positives = 83/192 (43%), Gaps = 21/192 (10%)

Query: 1516 TLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPIT--PPTSTTTLPPTTTPSPPPTTTTTPP 1573
            T PP TT     TTTTT    +TP P ++  +T  PP STT +P  +     P  T+T  
Sbjct: 1611 TTPPPTTELETATTTTTQALFSTPQPTSSPGLTRAPPASTTAVPTLSEGLTSPRYTSTLG 1670

Query: 1574 PTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPP-----PTTTPSPPTTTPITP 1628
              TT  P             TTP  +T P+ P   T+T P     P TT S  T  P  P
Sbjct: 1671 TATTGGP-------------TTPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQP 1717

Query: 1629 PTSTTTLPPTTTPSPPPT-TTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITT 1687
            PT   T   T+   P  T +T +  P TT   PT T+        T+ P T T  SP+T 
Sbjct: 1718 PTLAPTTMATSRARPTGTASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSPLTN 1777

Query: 1688 TPSPPTTTMTTP 1699
            T +   TT   P
Sbjct: 1778 TTTSQGTTRCQP 1789



 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 68/188 (36%), Positives = 85/188 (45%), Gaps = 22/188 (11%)

Query: 1492 TTPPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT 1551
            TTPPPTT     TTT  T  A  +T  PT++P      T  PP +TT  P  +  +T P 
Sbjct: 1611 TTPPPTTELETATTT--TTQALFSTPQPTSSPG----LTRAPPASTTAVPTLSEGLTSPR 1664

Query: 1552 STTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTT-------PPPTTTPSP 1604
             T+TL   TT  P     +T P  T P   T+T P+   +  TT       P    T +P
Sbjct: 1665 YTSTLGTATTGGPTTPAGSTEP--TVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAP 1722

Query: 1605 PTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTP--SPPPTTTTTPPPTTTPSPPTT 1662
             T  T+   PT T S  +  P+T     T+L PT T   S     T+TP   TT SP T 
Sbjct: 1723 TTMATSRARPTGTASTASKEPLT-----TSLAPTLTSELSTSQAETSTPRTETTMSPLTN 1777

Query: 1663 TTPSPPIT 1670
            TT S   T
Sbjct: 1778 TTTSQGTT 1785



 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 112/367 (30%), Positives = 146/367 (39%), Gaps = 66/367 (17%)

Query: 4070 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4129
            TP PT T  +T TTT   TT  +  TP PT +   T  P  +TT V PT +   T    T
Sbjct: 1612 TPPPT-TELETATTT---TTQALFSTPQPTSSPGLTRAPPASTTAV-PTLSEGLTSPRYT 1666

Query: 4130 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-----TGTQTPTTTP-ITTTTT 4183
            + + T TT  PT TP G+  PT   + T+T  T +  P      GT  P+  P +  TT 
Sbjct: 1667 STLGTATTGGPT-TPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTM 1725

Query: 4184 VTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRS-TSSPLTESTTLLSTLP 4242
             T    PTGT        STA    LTTS  P  +S   TS++ TS+P TE+T       
Sbjct: 1726 ATSRARPTGT-------ASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETTM------ 1772

Query: 4243 PAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTS--PPGTPTRGTTTGSSSAPTPSTVQ 4300
                        +P   TTTS G T   P    T       PT G   G     T   ++
Sbjct: 1773 ------------SPLTNTTTSQGTTRCQPKCEWTEWFDVDFPTSGVAGGDME--TFENIR 1818

Query: 4301 TT-TTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCY 4359
                   W P        +    +        VL C +  +T      E   G + + C+
Sbjct: 1819 AAGGKMCWAPKSIECRAENYPEVS--IDQVGQVLTCSL--ETGLTCKNEDQTGRF-NMCF 1873

Query: 4360 FVNCSLSCTLEFYNWSCPSTP--SPTPTPS----------KSTPTPSKPSSTPSKPTP-- 4405
              N  + C  ++ +  CPSTP  S T TPS          K T T +  +ST S  TP  
Sbjct: 1874 NYNVRVLCCDDYSH--CPSTPATSSTATPSSTPGTTWILTKPTTTATTTASTGSTATPTS 1931

Query: 4406 --GTKPP 4410
               T PP
Sbjct: 1932 TLRTAPP 1938



 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 31/76 (40%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 1578 PSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPT--TTPSPPTTTPITPPTSTTTL 1635
            PSP   T+P P    +T P   T    PT TT T   T   TPS  +T  +T  T +++ 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPT----PTQTTATEKTTLWVTPSIRSTAALTSQTGSSSG 1492

Query: 1636 PPTTTPSPPPTTTTTP 1651
            P T TPS P TTT  P
Sbjct: 1493 PVTVTPSAPGTTTCQP 1508



 Score = 42.4 bits (98), Expect = 0.012
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 1595 TPPPTTTPSPPTTTTTTP----PPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTT 1650
            +P P T+P P  + +T P    P  TT +  TT  +TP   +T    + T S      ++
Sbjct: 1438 SPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGS------SS 1491

Query: 1651 PPPTTTPSPPTTTTPSP 1667
             P T TPS P TTT  P
Sbjct: 1492 GPVTVTPSAPGTTTCQP 1508



 Score = 40.8 bits (94), Expect = 0.035
 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 1637 PTTTPSPPPTTTTTP----PPTTTPSPPTTTTPSPPITTTTTPPPTTTPSS-PITTTPSP 1691
            P T+P P  + +T P    P  TT +  TT   +P I +T      T  SS P+T TPS 
Sbjct: 1441 PGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSA 1500

Query: 1692 PTTTMTTP 1699
            P TT   P
Sbjct: 1501 PGTTTCQP 1508



 Score = 39.7 bits (91), Expect = 0.079
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 1571 TPPPTTTPSPP--TTTTPSPPTITTTTPPPTTT----PSPPTTTTTTPPPTTTPSPPTTT 1624
            +P P T+P P    +T P+ PT T TT    TT    PS  +T   T    ++  P T T
Sbjct: 1438 SPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVT 1497

Query: 1625 PITPPTST 1632
            P  P T+T
Sbjct: 1498 PSAPGTTT 1505



 Score = 39.7 bits (91), Expect = 0.079
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 1519 PTTTPSPPTTTTTTP----PPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPP 1574
            P T+P P  + +T P    P  TT +  TT  +TP   +T    + T S      ++ P 
Sbjct: 1441 PGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGS------SSGPV 1494

Query: 1575 TTTPSPPTTTTPSP 1588
            T TPS P TTT  P
Sbjct: 1495 TVTPSAPGTTTCQP 1508



 Score = 39.7 bits (91), Expect = 0.079
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 1558 PTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTT 1617
            P T+P P  + +T P     P+P  TT     T+  T    +T      T +++ P T T
Sbjct: 1441 PGTSPQPSLSASTEP---AVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVT 1497

Query: 1618 PSPPTTTPITP 1628
            PS P TT   P
Sbjct: 1498 PSAPGTTTCQP 1508



 Score = 39.3 bits (90), Expect = 0.10
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 1539 PSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTIT-TTTPP 1597
            PSP   T   P  S +T P   TP+    TT T   T   +P   +T +  + T +++ P
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQ---TTATEKTTLWVTPSIRSTAALTSQTGSSSGP 1493

Query: 1598 PTTTPSPPTTTTTTP 1612
             T TPS P TTT  P
Sbjct: 1494 VTVTPSAPGTTTCQP 1508



 Score = 38.9 bits (89), Expect = 0.13
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1641 PSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPS 1700
            PSP P T+  P  + +  P   T    P  TT T   T   +  I +T +  + T ++  
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPT----PTQTTATEKTTLWVTPSIRSTAALTSQTGSSSG 1492

Query: 1701 PTT-TPSSPITTTTTP 1715
            P T TPS+P TTT  P
Sbjct: 1493 PVTVTPSAPGTTTCQP 1508



 Score = 38.5 bits (88), Expect = 0.18
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 1618 PSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPS-PPITTTTTPP 1676
            PSP   T   P  S +T P   TP+    TT T   T   +P   +T +    T +++ P
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQ---TTATEKTTLWVTPSIRSTAALTSQTGSSSGP 1493

Query: 1677 PTTTPSSPITTTPSP 1691
             T TPS+P TTT  P
Sbjct: 1494 VTVTPSAPGTTTCQP 1508



 Score = 37.4 bits (85), Expect = 0.39
 Identities = 28/74 (37%), Positives = 33/74 (44%), Gaps = 4/74 (5%)

Query: 1604 PPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPT--TTPSPPPTTTTTPPPTTTPSPPT 1661
            P     T+P P+ + S     P TP  +T T   T   TPS   T   T   T + S P 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVP-TPTQTTATEKTTLWVTPSIRSTAALT-SQTGSSSGPV 1494

Query: 1662 TTTPSPPITTTTTP 1675
            T TPS P TTT  P
Sbjct: 1495 TVTPSAPGTTTCQP 1508



 Score = 37.4 bits (85), Expect = 0.39
 Identities = 23/72 (31%), Positives = 32/72 (44%)

Query: 4127 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4186
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4187 TPTPTGTQTGPP 4198
            TP+  GT T  P
Sbjct: 1497 TPSAPGTTTCQP 1508



 Score = 36.6 bits (83), Expect = 0.67
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 4142 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTGPPTH 4200
            P+P    +P  +   +T    PTPT T     TT  +T +   T   T  TG+ +GP T 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4201 TSTAP 4205
            T +AP
Sbjct: 1497 TPSAP 1501



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 1965 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2024
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2025 TPTPTGTQT 2033
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 1988 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2047
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2048 TPTPTGTQT 2056
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2011 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2070
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2071 TPTPTGTQT 2079
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2034 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2093
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2094 TPTPTGTQT 2102
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2057 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2116
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2117 TPTPTGTQT 2125
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2080 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2139
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2140 TPTPTGTQT 2148
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2103 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2162
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2163 TPTPTGTQT 2171
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2126 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2185
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2186 TPTPTGTQT 2194
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2149 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2208
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2209 TPTPTGTQT 2217
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2172 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2231
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2232 TPTPTGTQT 2240
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2195 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2254
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2255 TPTPTGTQT 2263
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2218 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2277
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2278 TPTPTGTQT 2286
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2241 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2300
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2301 TPTPTGTQT 2309
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2264 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2323
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2324 TPTPTGTQT 2332
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2287 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2346
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2347 TPTPTGTQT 2355
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2310 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2369
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2370 TPTPTGTQT 2378
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2333 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2392
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2393 TPTPTGTQT 2401
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2356 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2415
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2416 TPTPTGTQT 2424
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2379 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2438
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2439 TPTPTGTQT 2447
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2402 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2461
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2462 TPTPTGTQT 2470
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2425 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2484
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2485 TPTPTGTQT 2493
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2448 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2507
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2508 TPTPTGTQT 2516
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2471 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2530
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2531 TPTPTGTQT 2539
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2494 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2553
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2554 TPTPTGTQT 2562
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2517 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2576
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2577 TPTPTGTQT 2585
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2540 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2599
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2600 TPTPTGTQT 2608
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2563 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2622
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2623 TPTPTGTQT 2631
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2586 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2645
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2646 TPTPTGTQT 2654
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2609 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2668
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2669 TPTPTGTQT 2677
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2632 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2691
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2692 TPTPTGTQT 2700
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2655 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2714
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2715 TPTPTGTQT 2723
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2678 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2737
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2738 TPTPTGTQT 2746
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2701 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2760
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2761 TPTPTGTQT 2769
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2724 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2783
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2784 TPTPTGTQT 2792
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2747 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2806
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2807 TPTPTGTQT 2815
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2770 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2829
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2830 TPTPTGTQT 2838
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2793 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2852
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2853 TPTPTGTQT 2861
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2816 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2875
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2876 TPTPTGTQT 2884
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2839 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2898
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2899 TPTPTGTQT 2907
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2862 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2921
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2922 TPTPTGTQT 2930
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2885 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2944
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2945 TPTPTGTQT 2953
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2908 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2967
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2968 TPTPTGTQT 2976
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2931 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2990
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 2991 TPTPTGTQT 2999
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2954 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3013
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3014 TPTPTGTQT 3022
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2977 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3036
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3037 TPTPTGTQT 3045
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3000 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3059
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3060 TPTPTGTQT 3068
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3023 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3082
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3083 TPTPTGTQT 3091
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3046 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3105
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3106 TPTPTGTQT 3114
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3069 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3128
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3129 TPTPTGTQT 3137
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3092 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3151
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3152 TPTPTGTQT 3160
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3115 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3174
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3175 TPTPTGTQT 3183
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3138 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3197
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3198 TPTPTGTQT 3206
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3161 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3220
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3221 TPTPTGTQT 3229
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3184 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3243
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3244 TPTPTGTQT 3252
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3207 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3266
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3267 TPTPTGTQT 3275
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3230 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3289
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3290 TPTPTGTQT 3298
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3253 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3312
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3313 TPTPTGTQT 3321
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3276 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3335
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3336 TPTPTGTQT 3344
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3299 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3358
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3359 TPTPTGTQT 3367
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3322 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3381
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3382 TPTPTGTQT 3390
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3345 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3404
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3405 TPTPTGTQT 3413
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3368 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3427
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3428 TPTPTGTQT 3436
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3391 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3450
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3451 TPTPTGTQT 3459
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3414 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3473
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3474 TPTPTGTQT 3482
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3437 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3496
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3497 TPTPTGTQT 3505
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3460 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3519
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3520 TPTPTGTQT 3528
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3483 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3542
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3543 TPTPTGTQT 3551
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3506 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3565
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3566 TPTPTGTQT 3574
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3529 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3588
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3589 TPTPTGTQT 3597
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3552 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3611
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3612 TPTPTGTQT 3620
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3575 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3634
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3635 TPTPTGTQT 3643
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3598 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3657
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3658 TPTPTGTQT 3666
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3621 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3680
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3681 TPTPTGTQT 3689
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3644 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3703
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3704 TPTPTGTQT 3712
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3667 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3726
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3727 TPTPTGTQT 3735
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3690 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3749
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3750 TPTPTGTQT 3758
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3713 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3772
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3773 TPTPTGTQT 3781
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3736 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3795
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3796 TPTPTGTQT 3804
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3759 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3818
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3819 TPTPTGTQT 3827
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3782 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3841
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3842 TPTPTGTQT 3850
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3805 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3864
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3865 TPTPTGTQT 3873
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3828 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3887
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3888 TPTPTGTQT 3896
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3851 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3910
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3911 TPTPTGTQT 3919
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3874 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3933
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3934 TPTPTGTQT 3942
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3897 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3956
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3957 TPTPTGTQT 3965
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3920 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3979
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 3980 TPTPTGTQT 3988
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3943 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4002
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4003 TPTPTGTQT 4011
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3966 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4025
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4026 TPTPTGTQT 4034
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3989 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4048
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4049 TPTPTGTQT 4057
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4012 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4071
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4072 TPTPTGTQT 4080
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4035 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4094
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4095 TPTPTGTQT 4103
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4058 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4117
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4118 TPTPTGTQT 4126
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4081 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4140
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4141 TPTPTGTQT 4149
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4104 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4163
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 1496

Query: 4164 TPTPTGTQT 4172
            TP+  GT T
Sbjct: 1497 TPSAPGTTT 1505



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 27/74 (36%), Positives = 32/74 (43%), Gaps = 4/74 (5%)

Query: 1525 PPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPT--TTPSPPPTTTTTPPPTTTPSPPT 1582
            P     T+P P+ + S     P TP  +T T   T   TPS   T   T   T + S P 
Sbjct: 1437 PSPAPGTSPQPSLSASTEPAVP-TPTQTTATEKTTLWVTPSIRSTAALT-SQTGSSSGPV 1494

Query: 1583 TTTPSPPTITTTTP 1596
            T TPS P  TT  P
Sbjct: 1495 TVTPSAPGTTTCQP 1508



 Score = 35.4 bits (80), Expect = 1.5
 Identities = 26/100 (26%), Positives = 37/100 (37%), Gaps = 16/100 (16%)

Query: 4877 DTCCNITVCKCNTSLCKEKPSVCPLGFE--VKSKMVPGRCCPFYWCESKGVCVHGNAEYQ 4934
            DTC N    +     C +    CP G    V   +    C P   C     C HG   Y 
Sbjct: 344  DTCSNPQRAQLCEDHCVDG-CFCPPGRSCTVLDDITHSGCLPLGQCP----CTHGGRTYS 398

Query: 4935 PGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCS 4974
            PG+  +++ C  C C+          +  C  +PC  +CS
Sbjct: 399  PGTS-FNTTCSSCTCSG--------GLWQCQDLPCPGTCS 429



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2001 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2060
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2061 PITTTTTVTPTPTPTGTQTP 2080
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2024 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2083
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2084 PITTTTTVTPTPTPTGTQTP 2103
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2047 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2106
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2107 PITTTTTVTPTPTPTGTQTP 2126
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2070 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2129
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2130 PITTTTTVTPTPTPTGTQTP 2149
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2093 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2152
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2153 PITTTTTVTPTPTPTGTQTP 2172
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2116 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2175
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2176 PITTTTTVTPTPTPTGTQTP 2195
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2139 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2198
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2199 PITTTTTVTPTPTPTGTQTP 2218
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2162 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2221
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2222 PITTTTTVTPTPTPTGTQTP 2241
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2185 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2244
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2245 PITTTTTVTPTPTPTGTQTP 2264
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2208 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2267
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2268 PITTTTTVTPTPTPTGTQTP 2287
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2231 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2290
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2291 PITTTTTVTPTPTPTGTQTP 2310
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2254 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2313
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2314 PITTTTTVTPTPTPTGTQTP 2333
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2277 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2336
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2337 PITTTTTVTPTPTPTGTQTP 2356
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2300 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2359
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2360 PITTTTTVTPTPTPTGTQTP 2379
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2323 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2382
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2383 PITTTTTVTPTPTPTGTQTP 2402
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2346 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2405
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2406 PITTTTTVTPTPTPTGTQTP 2425
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2369 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2428
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2429 PITTTTTVTPTPTPTGTQTP 2448
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2392 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2451
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2452 PITTTTTVTPTPTPTGTQTP 2471
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2415 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2474
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2475 PITTTTTVTPTPTPTGTQTP 2494
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2438 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2497
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2498 PITTTTTVTPTPTPTGTQTP 2517
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2461 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2520
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2521 PITTTTTVTPTPTPTGTQTP 2540
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2484 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2543
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2544 PITTTTTVTPTPTPTGTQTP 2563
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2507 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2566
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2567 PITTTTTVTPTPTPTGTQTP 2586
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2530 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2589
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2590 PITTTTTVTPTPTPTGTQTP 2609
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2553 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2612
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2613 PITTTTTVTPTPTPTGTQTP 2632
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2576 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2635
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2636 PITTTTTVTPTPTPTGTQTP 2655
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2599 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2658
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2659 PITTTTTVTPTPTPTGTQTP 2678
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2622 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2681
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2682 PITTTTTVTPTPTPTGTQTP 2701
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2645 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2704
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2705 PITTTTTVTPTPTPTGTQTP 2724
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2668 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2727
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2728 PITTTTTVTPTPTPTGTQTP 2747
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2691 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2750
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2751 PITTTTTVTPTPTPTGTQTP 2770
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2714 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2773
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2774 PITTTTTVTPTPTPTGTQTP 2793
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2737 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2796
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2797 PITTTTTVTPTPTPTGTQTP 2816
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2760 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2819
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2820 PITTTTTVTPTPTPTGTQTP 2839
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2783 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2842
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2843 PITTTTTVTPTPTPTGTQTP 2862
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2806 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2865
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2866 PITTTTTVTPTPTPTGTQTP 2885
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2829 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2888
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2889 PITTTTTVTPTPTPTGTQTP 2908
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2852 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2911
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2912 PITTTTTVTPTPTPTGTQTP 2931
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2875 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2934
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2935 PITTTTTVTPTPTPTGTQTP 2954
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2898 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2957
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2958 PITTTTTVTPTPTPTGTQTP 2977
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2921 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2980
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 2981 PITTTTTVTPTPTPTGTQTP 3000
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2944 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3003
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3004 PITTTTTVTPTPTPTGTQTP 3023
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2967 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3026
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3027 PITTTTTVTPTPTPTGTQTP 3046
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2990 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3049
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3050 PITTTTTVTPTPTPTGTQTP 3069
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3013 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3072
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3073 PITTTTTVTPTPTPTGTQTP 3092
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3036 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3095
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3096 PITTTTTVTPTPTPTGTQTP 3115
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3059 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3118
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3119 PITTTTTVTPTPTPTGTQTP 3138
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3082 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3141
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3142 PITTTTTVTPTPTPTGTQTP 3161
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3105 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3164
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3165 PITTTTTVTPTPTPTGTQTP 3184
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3128 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3187
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3188 PITTTTTVTPTPTPTGTQTP 3207
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3151 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3210
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3211 PITTTTTVTPTPTPTGTQTP 3230
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3174 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3233
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3234 PITTTTTVTPTPTPTGTQTP 3253
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3197 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3256
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3257 PITTTTTVTPTPTPTGTQTP 3276
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3220 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3279
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3280 PITTTTTVTPTPTPTGTQTP 3299
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3243 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3302
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3303 PITTTTTVTPTPTPTGTQTP 3322
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3266 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3325
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3326 PITTTTTVTPTPTPTGTQTP 3345
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3289 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3348
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3349 PITTTTTVTPTPTPTGTQTP 3368
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3312 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3371
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3372 PITTTTTVTPTPTPTGTQTP 3391
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3335 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3394
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3395 PITTTTTVTPTPTPTGTQTP 3414
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3358 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3417
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3418 PITTTTTVTPTPTPTGTQTP 3437
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3381 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3440
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3441 PITTTTTVTPTPTPTGTQTP 3460
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3404 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3463
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3464 PITTTTTVTPTPTPTGTQTP 3483
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3427 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3486
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3487 PITTTTTVTPTPTPTGTQTP 3506
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3450 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3509
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3510 PITTTTTVTPTPTPTGTQTP 3529
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3473 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3532
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3533 PITTTTTVTPTPTPTGTQTP 3552
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3496 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3555
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3556 PITTTTTVTPTPTPTGTQTP 3575
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3519 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3578
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3579 PITTTTTVTPTPTPTGTQTP 3598
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3542 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3601
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3602 PITTTTTVTPTPTPTGTQTP 3621
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3565 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3624
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3625 PITTTTTVTPTPTPTGTQTP 3644
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3588 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3647
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3648 PITTTTTVTPTPTPTGTQTP 3667
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3611 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3670
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3671 PITTTTTVTPTPTPTGTQTP 3690
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3634 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3693
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3694 PITTTTTVTPTPTPTGTQTP 3713
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3657 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3716
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3717 PITTTTTVTPTPTPTGTQTP 3736
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3680 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3739
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3740 PITTTTTVTPTPTPTGTQTP 3759
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3703 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3762
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3763 PITTTTTVTPTPTPTGTQTP 3782
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3726 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3785
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3786 PITTTTTVTPTPTPTGTQTP 3805
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3749 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3808
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3809 PITTTTTVTPTPTPTGTQTP 3828
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3772 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3831
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3832 PITTTTTVTPTPTPTGTQTP 3851
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3795 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3854
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3855 PITTTTTVTPTPTPTGTQTP 3874
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3818 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3877
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3878 PITTTTTVTPTPTPTGTQTP 3897
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3841 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3900
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3901 PITTTTTVTPTPTPTGTQTP 3920
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3864 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3923
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3924 PITTTTTVTPTPTPTGTQTP 3943
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3887 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3946
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3947 PITTTTTVTPTPTPTGTQTP 3966
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3910 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3969
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3970 PITTTTTVTPTPTPTGTQTP 3989
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3933 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3992
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 3993 PITTTTTVTPTPTPTGTQTP 4012
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3956 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4015
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 4016 PITTTTTVTPTPTPTGTQTP 4035
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3979 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4038
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 4039 PITTTTTVTPTPTPTGTQTP 4058
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4002 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4061
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 4062 PITTTTTVTPTPTPTGTQTP 4081
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4025 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4084
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 4085 PITTTTTVTPTPTPTGTQTP 4104
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4048 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4107
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 4108 PITTTTTVTPTPTPTGTQTP 4127
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4071 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4130
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 4131 PITTTTTVTPTPTPTGTQTP 4150
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4094 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4153
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 1437 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 1488

Query: 4154 PITTTTTVTPTPTPTGTQTP 4173
              +   TVTP+   T T  P
Sbjct: 1489 SSSGPVTVTPSAPGTTTCQP 1508



 Score = 33.5 bits (75), Expect = 5.6
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 7/71 (9%)

Query: 4336 CVLNDTYYAPGEEVYNGTYG-DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTP------SK 4388
            C   D  Y+  + +YN T G   C    C  + T+     +CP TP+ TP          
Sbjct: 1264 CTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPH 1323

Query: 4389 STPTPSKPSST 4399
            ST +P+ P ST
Sbjct: 1324 STTSPALPVST 1334


>gi|161019170 mucin 5AC [Homo sapiens]
          Length = 6207

 Score = 1643 bits (4254), Expect = 0.0
 Identities = 1322/3958 (33%), Positives = 1758/3958 (44%), Gaps = 537/3958 (13%)

Query: 1570 TTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPP 1629
            TTPPPTT     TTTT        +TP PT++P      T  PP +TT  P  +  +T P
Sbjct: 2301 TTPPPTTELETATTTTTQA---LFSTPQPTSSPG----LTRAPPASTTAVPTLSEGLTSP 2353

Query: 1630 TSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITT----TTTPPPTTTPSSPI 1685
              T+TL   TT  P     TTP  +T P+ P   T + P  +    TT    T  PS P 
Sbjct: 2354 RYTSTLGTATTGGP-----TTPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPP 2408

Query: 1686 TTTPSPPTTTMTTPSPTTTPSS--PITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTT 1743
            T  P+   T+   P+ T + +S  P+TT+  P+ T+  S      T+ + T+TP   TT 
Sbjct: 2409 TLAPTTMATSRARPTGTASTASKEPLTTSLAPTLTSELS------TSQAETSTPRTETTM 2462

Query: 1744 MTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPG 1803
                      SPLT T              +T+  TT C P C WT W D   P     G
Sbjct: 2463 ----------SPLTNT--------------TTSQGTTRCQPKCEWTEWFDVDFPTSGVAG 2498

Query: 1804 GDTELIGDVCGPG----WAA-NISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPG 1858
            GD E   ++   G    WA  +I CRA  YP+V I Q+GQ + C +  GL CKNEDQ   
Sbjct: 2499 GDMETFENIRAAGGKMCWAPKSIECRAENYPEVSIDQVGQVLTCSLETGLTCKNEDQT-- 2556

Query: 1859 GVIPMAFCLNYEINVQCCE----CVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPT 1914
            G   M  C NY + V CC+    C + P T +T T      P++TP TT     PT T T
Sbjct: 2557 GRFNM--CFNYNVRVLCCDDYSHCPSTPATSSTAT------PSSTPGTTWILTKPTTTAT 2608

Query: 1915 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 1974
             T +  +T  T T+T+   P P    T  TTP  T++  TP+ +P    T T  P   +T
Sbjct: 2609 TTASTGSTA-TPTSTLRTAPPPKVLTTTATTPTVTSSKATPSSSPG---TATALPALRST 2664

Query: 1975 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPT 2029
              TPT T   T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T T
Sbjct: 2665 ATTPTATSV-TPIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTATATTT 2723

Query: 2030 GTQ----TPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2084
            G      TP++TP T  TT  PT T TG T TP+++P T  T       P    + TTTP
Sbjct: 2724 GATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALT-------PPVWISTTTTP 2776

Query: 2085 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2144
             T  +TVTP+  P GT T T T +TTTTT   T +     + T T  TT T   P    T
Sbjct: 2777 TTRGSTVTPSSIP-GT-THTATVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTMAT 2834

Query: 2145 --GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT-TVTPTPTPTGTQTPTTTPIT 2201
              G   P ++P T  T  T   +     T  T P T T+ T+  T   T   TP  +   
Sbjct: 2835 THGRSLPPSSPHTVRTAWTSATSGILGTTHITEPSTVTSHTLAATTGTTQHSTPALSSPH 2894

Query: 2202 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVT--- 2253
             ++  T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T+    
Sbjct: 2895 PSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEP 2954

Query: 2254 ------------PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTV 2298
                        P P P+G    T + I          P       Q     P+     V
Sbjct: 2955 QCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQV 3014

Query: 2299 TP--------------------------------------TPTPTGTQTPTTTPITT--- 2317
                                                    TP  + T  P++TP TT   
Sbjct: 3015 VECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTPGTTWIL 3074

Query: 2318 ---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2374
               TTT T T +   T TP++TP TT     P+ T T T  PT +  T ++T     TP 
Sbjct: 3075 TELTTTATTTESTGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTATASSTQATAGTPH 3133

Query: 2375 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2434
               T  TTP  T++  TP  +P    T T  P   +T  TPT T + T  P+++  TT T
Sbjct: 3134 -VSTTATTPTVTSSKATPFSSPG---TATALPALRSTATTPTAT-SFTAIPSSSLGTTWT 3188

Query: 2435 TVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPTGTQ----TPTTTPITTTTTVTPT 2485
             ++ T TPT T    TP++TP T  T+T +T T T TG      TP++TP T  TT   T
Sbjct: 3189 RLSQTTTPTATMSTATPSSTPETVHTSTVLTTTATTTGATGSVATPSSTPGTAHTTKVLT 3248

Query: 2486 PTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2544
             T TG T TP+++P T  T       P    T TTTP T  +TVTP+  P  T TPT   
Sbjct: 3249 TTTTGFTATPSSSPGTARTL------PVWIST-TTTPTTRGSTVTPSSIPGTTHTPTVLT 3301

Query: 2545 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2604
             TTTT  T +     + T T+    T      T T  G     ++P T  T  T   + T
Sbjct: 3302 TTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGT 3361

Query: 2605 GTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2662
               T  T P +T T+ TP  T   TQ  TP  +    ++  T +P   GT TP  T  T+
Sbjct: 3362 LGTTHITEP-STGTSHTPAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTRATS 3420

Query: 2663 TTTVTPTPTPTGTQT-----PTTTPITTTTTVT---------------PTPTPTGTQTPT 2702
             TT T TP+ T T T     PT+ PITT  T+                P P P+G    T
Sbjct: 3421 RTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDT 3480

Query: 2703 TTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGT--------------- 2744
             + I          P       Q     P+     V       G                
Sbjct: 3481 YSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCF 3540

Query: 2745 ------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2792
                          P+T   ++T T + TP  T   T  TT  TTT T   T  P+ T  
Sbjct: 3541 NYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQTTAATTTATTGSTAIPSSTPG 3600

Query: 2793 PTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2851
                P   T+T T TPT T ++ T +++P T TT    T T T +   + TPI + T  T
Sbjct: 3601 TAPPPKVLTSTAT-TPTATSSKATSSSSPRTATTLPVLTSTATKSTATSFTPIPSFTLGT 3659

Query: 2852 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2911
                P      TTTP+ T +T+ P+ TP  T T T      TTT   +   T + TP TT
Sbjct: 3660 TGTLPE----QTTTPMATMSTIHPSSTPETTHTSTVLTTKATTTRATSSMSTPSSTPGTT 3715

Query: 2912 PITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2969
             I T  TT  T T     T TP++TP TT     P+ T T      T P  +T T + T 
Sbjct: 3716 WILTELTTAATTTAATGPTATPSSTPGTTWILTEPSTTAT-----VTVPTGSTATASSTR 3770

Query: 2970 TPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3028
               GT    T+  TT T ++   TP+ +  T T  P   +T  TPT T   T  P+++  
Sbjct: 3771 ATAGTLKVLTSTATTPTVISSRATPSSSPGTATALPALRSTATTPTATSV-TAIPSSSLG 3829

Query: 3029 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3088
            T  T ++ T TPT T + T TP +T  TV    T T   T TTT   T +  TP+ TP G
Sbjct: 3830 TAWTRLSQTTTPTATMS-TATPSSTPETVH---TSTVLTTTTTTTRATGSVATPSSTP-G 3884

Query: 3089 TQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTT 3140
            T   T  P TTTT  T TP+ +P    TP      TTTP T  +TVTP+  P GT T T 
Sbjct: 3885 TAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSIP-GT-THTA 3942

Query: 3141 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT--GTQTPTTTPITTTTTVTPT 3198
            T +TTTTT   T +     + T T  TT T   P  T T  G   P ++P T  T  T  
Sbjct: 3943 TVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATTHGRSLPPSSPHTVRTAWTSA 4002

Query: 3199 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTT 3256
             +     T  T P +T T+ TP  T + TQ  TP  +    ++  T +P   GT TP  T
Sbjct: 4003 TSGILGTTHITEP-STVTSHTPAATTSTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHT 4061

Query: 3257 PITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVT---------------PTPTPTGT 3296
              T+ TT T TP+ T T T     PT+ PITT  T                 P P P+G 
Sbjct: 4062 RGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGG 4121

Query: 3297 QTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3353
               T + I          P       Q     P+     V       G        +   
Sbjct: 4122 DFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKF 4181

Query: 3354 TTV---------------TPTPTPTGTQTPTTTPITT------TTTVTPTPTPTGTQTPT 3392
                                TP  + T TP++TP TT      TTT T T +   T TP+
Sbjct: 4182 KMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTKLTTTATTTESTGSTATPS 4241

Query: 3393 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3452
            +TP TT     P+ T T T  PT +  T ++T     TP    T  TTP  T++  TP  
Sbjct: 4242 STPGTTWILTEPSTTATVT-VPTGSTATASSTQATAGTPH-VSTTATTPTVTSSKATPFS 4299

Query: 3453 TP-TGTQTPT-----TTPITTTTTVTPTPTPTGTQT---PTTTPITTTTTVTPTPTPTGT 3503
            +P T T  P      TTP  T+ T  P+ +   T T    TTTP  T +T TP+ TP   
Sbjct: 4300 SPGTATALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETA 4359

Query: 3504 QTPTTTPITTTTT------VTPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP--- 3552
             T T    T TTT       TP+ TP GT   T  P TTTT  TVTP+ +P   +TP   
Sbjct: 4360 HTSTVLTTTATTTRATGSVATPSSTP-GTAHTTKVPTTTTTGFTVTPSSSPGTARTPPVW 4418

Query: 3553 ---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3609
               TTTP T+ +TVTP+  P  T TPT    TTTT  T +     + T T+    T    
Sbjct: 4419 ISTTTTPTTSGSTVTPSSVPGTTHTPTVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVP 4478

Query: 3610 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TP 3667
              T T  G     ++P T  T  T   + T   T  T P +T T+ TP  T   TQ  TP
Sbjct: 4479 NTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEP-STGTSHTPAATTGTTQHSTP 4537

Query: 3668 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTT 3722
              +    ++  T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  
Sbjct: 4538 ALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVV 4597

Query: 3723 TVT---------------PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPI 3764
            T                 P P P+G    T + I          P       Q     P+
Sbjct: 4598 TTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPL 4657

Query: 3765 TTTTTVTPTPTPTGTQTPTTTPITTTTTV---------------TPTPTPTGTQTPTTTP 3809
                 V       G        +                       TP  + T  P++TP
Sbjct: 4658 GELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTAMPSSTP 4717

Query: 3810 ITT------TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3863
             TT      TTT T T +   T TP++TP T        P P    +P TTP  T++  T
Sbjct: 4718 GTTWILTELTTTATTTASTGSTATPSSTPGTA-------PPPKVLTSPATTPTATSSKAT 4770

Query: 3864 PTPTPTGTQTPTTTPI-------TTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTPT 3911
             + +P   +T TT P+       +T T+VTP P+ T   T      TTTP+ T +T+ P+
Sbjct: 4771 SSSSP---RTATTLPVLTSTATKSTATSVTPIPSSTLGTTGTLPEQTTTPVATMSTIHPS 4827

Query: 3912 PTPTGTQTPT--TTPITTTTTVTPTPTPTGTQ------TPTTTPITTTTTVTPTPTPTGT 3963
             TP  T T T  TT  TTT   + T TP+ T       T  TT  TTT    PT TP+ T
Sbjct: 4828 STPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTAATTTAATGPTATPSST 4887

Query: 3964 QTPT--TTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4020
               T   T +TTT T T +   TG T TP++TP TT     P+ T T T  PT +  T +
Sbjct: 4888 PGTTWILTELTTTATTTAS---TGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTATAS 4943

Query: 4021 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTP-----TTTPITTTTTVTPTPT 4074
            +T     TP    T  TTP  T++  TP+ +P T T  P      TTP  T+ T  P+ +
Sbjct: 4944 STQATAGTP-HVSTTATTPTVTSSKATPSSSPGTATALPALRSTATTPTATSFTAIPSSS 5002

Query: 4075 PTGTQT---PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQ 4125
               T T    TTTP  T +T TP+ TP    T T    T TTT       TP+ TP GT 
Sbjct: 5003 LGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTATATTTGATGSVATPSSTP-GTA 5061

Query: 4126 TPTTTPITTTT--TVTPTPTP-TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 4182
              T  P TTTT  T TP+ +P T    PTTTP++T +T+  + TP  T T T      TT
Sbjct: 5062 HTTKVPTTTTTGFTATPSSSPGTALTPPTTTPMSTMSTIHTSSTPETTHTST----VLTT 5117

Query: 4183 TVTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLP 4242
            T T T     T T   T  +T  + ELTT+     ++T  T  + +   T  TT + T P
Sbjct: 5118 TATMTRATNSTATPSSTLGTTRILTELTTT----ATTTAATGSTATLSSTPGTTWILTEP 5173

Query: 4243 PAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTT 4302
              I        ST TA +T    HT     +  T P  T        +S+ P+ STV TT
Sbjct: 5174 STIATVMVPTGSTATASSTLGTAHTPKVVTTMATMPTAT--------ASTVPSSSTVGTT 5225

Query: 4303 TTSAWTPTPTP---LSTPSIIRTTGLRP--YPS---SVLICCVLNDTYYAPGEEVYNGTY 4354
             T A  P+  P   +ST S    T LRP  +PS   S    C     +++PGE +YN T 
Sbjct: 5226 RTPAVLPSSLPTFSVSTVSSSVLTTLRPTGFPSSHFSTPCFCRAFGQFFSPGEVIYNKTD 5285

Query: 4355 GDTCYF-VNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECP 4413
               C+F   C+  C ++ +  +CP++P P  +   S+P+P+               P C 
Sbjct: 5286 RAGCHFYAVCNQHCDIDRFQGACPTSPPPVSSAPLSSPSPA---------------PGCD 5330

Query: 4414 DFDPPRQENETWWLCDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDP-DGCC 4472
            +  P RQ NETW L +C +A C  +N   +V ++ +P    TC N   P++V DP   C 
Sbjct: 5331 NAIPLRQVNETWTLENCTVARCVGDN--RVVLLDPKPVANVTCVNKHLPIKVSDPSQPCD 5388

Query: 4473 WHWECDCYCTG-------------WGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFG 4519
            +H+EC+C C G             WG  HY TFDG  Y+++GNCTYVL+ EI     N  
Sbjct: 5389 FHYECECECVGGRGITPGAGICSMWGGSHYSTFDGTSYTFRGNCTYVLMREIHARFGNLS 5448

Query: 4520 VYIDNYHCDPNDKVS-----CPRTLIVRHETQEVLIKTVHMMPMQVQ--VQVNRQAVALP 4572
            +Y+DN++C  +   +     CPR L + +++ ++++ TV M+  + +  +  ++  V+  
Sbjct: 5449 LYLDNHYCTASATAAAAAARCPRALSIHYKSMDIVL-TVTMVHGKEEGLILFDQIPVSSG 5507

Query: 4573 YKKYGLEVYQSGINYV-VDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSD 4631
            + K G+ V   G   + VDIP LGV V++NG  F  RLPY  F NNT+GQCGTCTN   D
Sbjct: 5508 FSKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRD 5567

Query: 4632 DCILPSGEIVSNCEAAADQWLVNDPSKPHC--PHSSSTTKRPAVTVPGGGKTTPHKDCTP 4689
            DC+   G   ++C+  A  WLV D  K  C  P  +  T  PA  V      TP   C P
Sbjct: 5568 DCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTP---CPP 5624

Query: 4690 SPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAALCAQQNICLD 4749
             PLC L+   +FA+CH LVPP  +++AC+ D C      + C SL+AYA LC  + +C D
Sbjct: 5625 QPLCDLMLSQVFAECHNLVPPGPFFNACISDHC-RGRLEVPCQSLEAYAELCRARGVCSD 5683

Query: 4750 WRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFD 4809
            WR  T G C + CP  + Y+ CGP +  TC S +       + EGCFCPE  + +     
Sbjct: 5684 WRGATGGLCDLTCPPTKVYKPCGPIQPATCNSRNQSPQLEGMAEGCFCPEDQILFNAHMG 5743

Query: 4810 VCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRC-SQKPVTHCVEDGTY 4868
            +CV+ C CVGPD  P+  GE +  +C++CVC EG   + C+P  C +Q     C   G  
Sbjct: 5744 ICVQACPCVGPDGFPKFPGERWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPPCNRPGFV 5803

Query: 4869 LATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVH 4928
              T     + CC  TVC CNT+ C +   VCP G E       G CCP + C  + +C +
Sbjct: 5804 TVTRPRAENPCCPETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQ-LCSY 5862

Query: 4929 GNAEYQPGSPVYSS-KCQDCVCTDKVDNNTLLNVIACTHVPC-NTSCSPGFELMEAPGEC 4986
                Y  G+    +  C  C C   +  +T    + C    C NT+C  GFE     G+C
Sbjct: 5863 NGTFYGVGATFPGALPCHMCTC---LSGDTQDPTVQCQEDACNNTTCPQGFEYKRVAGQC 5919

Query: 4987 CKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDA 5046
            C +C QT C+   PD Q V L    + +   +NCT + C       + +    +CP  D 
Sbjct: 5920 CGECVQTACL--TPDGQPVQLNE-TWVNSHVDNCTVYLCEAEGGVHLLTPQPASCP--DV 5974

Query: 5047 SICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSGSCGTFV 5106
            S C  GS+     GCC +C   +     C     TT + + GC   V +  C GSC    
Sbjct: 5975 SSC-RGSL--RKTGCCYSCEEDS-----CQVRINTTILWHQGCETEVNITFCEGSCPGAS 6026

Query: 5107 MYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTG 5164
             YSA+AQA+ H C+CC+E +  +  V L CPNG ++ HTYTH     C     GL  G
Sbjct: 6027 KYSAEAQAMQHQCTCCQERRVHEETVPLHCPNGSAILHTYTHAVQVLCGLLAWGLQAG 6084



 Score = 1417 bits (3669), Expect = 0.0
 Identities = 700/1504 (46%), Positives = 901/1504 (59%), Gaps = 96/1504 (6%)

Query: 32   HGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGV 91
            H   VCSTWG+FHYKTFDGDVFRFPGLC+Y F+  CR +Y++F V L+RG     +   V
Sbjct: 728  HNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQLRRG--LVGSRPVV 785

Query: 92   ESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNRED 151
              +++  +   +  +    ++NG     P+   GLL+E+S  Y KV  R  LT +WN ED
Sbjct: 786  TRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSGDYIKVSIRLVLTFLWNGED 845

Query: 152  ALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEE 211
            + +LELD K+ N TCGLCGD+NGL +++EF +     +PL+FGN+QK++ P   C DP  
Sbjct: 846  SALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGPTEQCPDPLP 905

Query: 212  EVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCRCPGGDTCVCSTVAEF 271
              A  +C++    C R L   AFA+C  LV    YL AC QD CRCP   TC C+T  E+
Sbjct: 906  LPA-GNCTDEEGICHRTLLGPAFAECHALVDSTAYLAACAQDLCRCP---TCPCATFVEY 961

Query: 272  SRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFC 331
            SRQC+HAGG+P NWR   LCP+TCP N+ + E GSPC DTCS+ + + LCE+H +DGCFC
Sbjct: 962  SRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCVDGCFC 1021

Query: 332  PEG---TVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLPCP 388
            P G   TV DDI  SGC+P+ QC C   G  Y+PG      C  C C+ G W C+DLPCP
Sbjct: 1022 PPGRSCTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQDLPCP 1081

Query: 389  GTCALEGGSHITTFDGKTYTFHGDCYYVLAKGDHNDSYALLGELAPCGSTDKQTCLKTVV 448
            GTC+++GG+HI+T+D K Y  HGDC YVL+K   + S+ +L EL  CG TD + CLK V 
Sbjct: 1082 GTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLTDNENCLKAVT 1141

Query: 449  LLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAP 508
            L  D     +  ++DG V LN +   LP   A+ ++F PSS+ I+V   +G++L VQL P
Sbjct: 1142 LSLDGGDTAIRVQADGGVFLNSIYTQLPLSAANITLFTPSSFFIVVQTGLGLQLLVQLVP 1201

Query: 509  VMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLD 568
            +MQ+FV LD A QGQ+ GLCGNFN  + DDF   SG+VEATGA FANTWKAQ++C +  +
Sbjct: 1202 LMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANARN 1261

Query: 569  WLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDCL 628
              +DPCSL++E+ NYA HWCS L    + F RCHS ++P  ++  C +DTCNC+ +EDCL
Sbjct: 1262 SFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSEDCL 1321

Query: 629  CAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEADSHC 688
            CAALSSY  AC AKGV L  WR+ VC K + +CP SQ + Y +  CQ TCR LSEAD  C
Sbjct: 1322 CAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCRGLSEADVTC 1381

Query: 689  LEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRLH 748
               F PVDGC CP  TFL++ G CVP  +C CY  G  L  G+VV  +   C C  G+L 
Sbjct: 1382 SVSFVPVDGCTCPAGTFLNDAGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGKLS 1441

Query: 749  CRQIRL-IGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLM 807
            C    L     C AP +++DCSN +A         SC TL  G + T CVSGCVCP GL+
Sbjct: 1442 CLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLV 1501

Query: 808  DDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYGSGH 867
             DG GGC+ E++CPCVHN   Y  G  I+VDCNTCTC+  RW C+  +C GTC  YG GH
Sbjct: 1502 SDGSGGCIAEEDCPCVHNEATYKPGETIRVDCNTCTCRNRRWECSHRLCLGTCVAYGDGH 1561

Query: 868  YITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMG-R 926
            +ITFDG  Y F+G C Y+  QDYCG N++ G+F I+TEN+PCGTTG TCSKAIK+F+  R
Sbjct: 1562 FITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVEVR 1621

Query: 927  T---------------------------------ELKLEDKHRVVIQRDEGHHVAYTTRE 953
            T                                 EL L++     + R  G    Y  R 
Sbjct: 1622 TAPAVSTPDPAANEPAPREASVGFRQRLPPLQSYELILQEGTFKAVARGPGGDPPYKIRY 1681

Query: 954  VGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSS 1013
            +G +LV+E+  G+ V WD++T+VFI+L   YKG VCGLCGNFD  + NDF TR   VV  
Sbjct: 1682 MGIFLVIETH-GMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDNAINDFATRSRSVVGD 1740

Query: 1014 ELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYE 1073
             L+FGNSWK +P+CPD     +PC+ NP R+SWA+KQCSIL    F+ C S+VD   +YE
Sbjct: 1741 ALEFGNSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYE 1800

Query: 1074 ACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWH 1133
            ACV+D+C+CD+GGDCECFC+AVA+YAQ C   G CV WRTPD CP+FCD+YNP   CEWH
Sbjct: 1801 ACVNDACACDSGGDCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGCEWH 1860

Query: 1134 YEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVED 1193
            Y+PCG    +TCR  +G H  + +  LEGCYP+CP  +P + ED  KCV   +CGCY +D
Sbjct: 1861 YQPCGAPCLKTCRNPSG-HCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVA--QCGCYDKD 1917

Query: 1194 -THYPPGASVPTEETCKSCVCTNS--------SQVVCRPE------EGKILNQTQDGAFC 1238
              +Y  GA VPT E C+SC CT S            C  E      +  I N T     C
Sbjct: 1918 GNYYDVGARVPTAENCQSCNCTPSGIQCAHSLEACTCTYEDRTYSYQDVIYNTTDGLGAC 1977

Query: 1239 YWEICGPNGTVEKHFNICSITTRPSTLTTFTTITLPTTPTTFTTTTT--TTTPTSSTVLS 1296
               ICG NGT+ +    C  T               TTP TFTT     +TT  +  V +
Sbjct: 1978 LIAICGSNGTIIRKAVACPGTP-------------ATTPFTFTTAWVPHSTTSPALPVST 2024

Query: 1297 TTPKLCCLWSDWINEDHPSSGSDDGDRETFDG-------VCGAPEDIECRSVKDPHLSLE 1349
               +  C WS W N   P  G   GD ETF+        VC    DIECR+ + P + LE
Sbjct: 2025 VCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLADIECRAAQLPDMPLE 2084

Query: 1350 QLGQKVQCDVSVGFICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTTPSPP 1409
            +LGQ+V CD   G +C N  Q  + P  LC+DY++RV CC   +     PSP   T   P
Sbjct: 2085 ELGQQVDCDRMRGLMCANSQQ--SPP--LCHDYELRVLCC---EYVPCGPSPAPGTSPQP 2137

Query: 1410 PTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPI-TTTTTPPPTTTPSPPISTTTTPPPTT 1468
              S +T P   T   PT TT T   T   +P I +T      T + S P++ T + P TT
Sbjct: 2138 SLSASTEPAVPT---PTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSAPGTT 2194

Query: 1469 TPSP 1472
            T  P
Sbjct: 2195 TCQP 2198



 Score = 1172 bits (3032), Expect = 0.0
 Identities = 1010/2990 (33%), Positives = 1310/2990 (43%), Gaps = 407/2990 (13%)

Query: 1198 PGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICS 1257
            PG +  T  T  +   T  S    RP +   L  T            P GT         
Sbjct: 2379 PGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTMAT----SRARPTGTASTASKEPL 2434

Query: 1258 ITTRPSTLTTFTTITLPTTPTTFTTTTT---TTTPTSSTVLSTTPKLCCLWSDWINEDHP 1314
             T+   TLT+  + +   T T  T TT    T T TS       PK  C W++W + D P
Sbjct: 2435 TTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTTRCQPK--CEWTEWFDVDFP 2492

Query: 1315 SSGSDDGDRETFDGV-------CGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKN 1367
            +SG   GD ETF+ +       C AP+ IECR+   P +S++Q+GQ + C +  G  CKN
Sbjct: 2493 TSGVAGGDMETFENIRAAGGKMCWAPKSIECRAENYPEVSIDQVGQVLTCSLETGLTCKN 2552

Query: 1368 EDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTT-TPSPPPTSTTTLPPTTTPSPPT 1426
            EDQ G   F +C++Y +RV CC     C +TP+  +T TPS  P +T  L      + PT
Sbjct: 2553 EDQTGR--FNMCFNYNVRVLCCDDYSHCPSTPATSSTATPSSTPGTTWIL------TKPT 2604

Query: 1427 TTTTTPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSP 1486
            TT TT   T + + P +T  T PP     P + TTT   PT T S  T + SP T T  P
Sbjct: 2605 TTATTTASTGSTATPTSTLRTAPP-----PKVLTTTATTPTVTSSKATPSSSPGTATALP 2659

Query: 1487 PTTTTTTPPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTP 1546
               +T T     TP+  + TPI   +  TT    +  + PT T +T  P++TP    T+ 
Sbjct: 2660 ALRSTAT-----TPTATSVTPIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETAHTST 2714

Query: 1547 ITPPTSTTT------LPPTTTPSPPPTT----TTTPPPTTTPSPPTTTTPSPPTITTTTP 1596
            +   T+TTT        P++TP    TT    TTT   T TPS    T  +PP   +TT 
Sbjct: 2715 VLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTT 2774

Query: 1597 PPTT-----TPS--PPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTT 1649
             PTT     TPS  P TT T T   TTT +  T +  TP +ST T   T TP  P T  T
Sbjct: 2775 TPTTRGSTVTPSSIPGTTHTATVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTMAT 2834

Query: 1650 TPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTT-TMTTPSPTTTPSSP 1708
            T   +  PS P T      + T  T   +    +   T PS  T+ T+   + TT  S+P
Sbjct: 2835 THGRSLPPSSPHT------VRTAWTSATSGILGTTHITEPSTVTSHTLAATTGTTQHSTP 2888

Query: 1709 ITTTTTPSSTTTPSPPPTTMTTPSP-TTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITP 1767
              ++  PSS TT SPP       SP TTTP   T T  T    T S   T+T LP S   
Sbjct: 2889 ALSSPHPSSRTTESPP-------SPGTTTPGHTTATSRTTATATPSKTRTSTLLPSS--- 2938

Query: 1768 PTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAA-----NIS 1822
            PT +P  TT  T  C P C W+ WLD   P     GGD +   ++   G A       + 
Sbjct: 2939 PTSAPI-TTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLE 2997

Query: 1823 CRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQP 1882
            CRA   P VP+ +LGQ V C +  GL+C+N +Q    V     C NYEI V CC     P
Sbjct: 2998 CRAQAQPGVPLRELGQVVECSLDFGLVCRNREQ----VGKFKMCFNYEIRVFCCNYGHCP 3053

Query: 1883 TTMTTTTTENP--TPPTTTPIT-TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 1939
            +T  T++T  P  TP TT  +T  TTT T T +   T TP++TP TT     P+ T T T
Sbjct: 3054 STPATSSTAMPSSTPGTTWILTELTTTATTTESTGSTATPSSTPGTTWILTEPSTTATVT 3113

Query: 1940 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 1999
              PT +  T ++T     TP    T  TTP  T++  TP  +P    T T  P   +T  
Sbjct: 3114 -VPTGSTATASSTQATAGTP-HVSTTATTPTVTSSKATPFSSP---GTATALPALRSTAT 3168

Query: 2000 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPTG- 2053
            TPT T + T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T TG 
Sbjct: 3169 TPTAT-SFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTATTTGA 3227

Query: 2054 ---TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2109
                 TP++TP T  TT   T T TG T TP+++P T  T       P    T TTTP T
Sbjct: 3228 TGSVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTART------LPVWIST-TTTPTT 3280

Query: 2110 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2169
              +TVTP+  P  T TPT    TTTT  T +     + T T+    T      T T  G 
Sbjct: 3281 RGSTVTPSSIPGTTHTPTVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATTHGR 3340

Query: 2170 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTT 2227
                ++P T  T  T   + T   T  T P +T T+ TP  T   TQ  TP  +    ++
Sbjct: 3341 SLSPSSPHTVRTAWTSATSGTLGTTHITEP-STGTSHTPAATTGTTQHSTPALSSPHPSS 3399

Query: 2228 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV------- 2275
              T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T+       
Sbjct: 3400 RTTESPPSPGTTTPGHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCA 3459

Query: 2276 --------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2324
                     P P P+G    T + I          P       Q     P+     V   
Sbjct: 3460 WSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVEC 3519

Query: 2325 PTPTGT---------------------------QTPTTTPITTTTTVTPTPTPTGTQTPT 2357
                G                              P+T   ++T T + TP  T   T  
Sbjct: 3520 SLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQ 3579

Query: 2358 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPT 2416
            TT  TTT T   T  P+ T      P   T+T T TPT T ++ T +++P T TT    T
Sbjct: 3580 TTAATTTATTGSTAIPSSTPGTAPPPKVLTSTAT-TPTATSSKATSSSSPRTATTLPVLT 3638

Query: 2417 PTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2475
             T T +   + TPI + T  T     TGT    TTTP+ T +T+ P+ TP  T T T   
Sbjct: 3639 STATKSTATSFTPIPSFTLGT-----TGTLPEQTTTPMATMSTIHPSSTPETTHTSTVLT 3693

Query: 2476 ITTTTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2533
               TTT   +   T + TP TT I T  TT  T T     T TP++TP TT     P+ T
Sbjct: 3694 TKATTTRATSSMSTPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTEPSTT 3753

Query: 2534 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPIT 2592
             T      T P  +T T + T    GT    T+  TT T ++   TP+ +  T T  P  
Sbjct: 3754 AT-----VTVPTGSTATASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTATALPAL 3808

Query: 2593 TTTTVTPTPTPT--------GTQ----TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2640
             +T  TPT T          GT     + TTTP  T +T TP+ TP    T T    TTT
Sbjct: 3809 RSTATTPTATSVTAIPSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTTT 3868

Query: 2641 TT------VTPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPITTT 2686
            TT       TP+ TP GT   T  P TTTT  T TP+ +P    TP      TTTP T  
Sbjct: 3869 TTRATGSVATPSSTP-GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRG 3927

Query: 2687 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT--GT 2744
            +TVTP+  P GT T T T +TTTTT   T +     + T T  TT T   P  T T  G 
Sbjct: 3928 STVTPSSIP-GT-THTATVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATTHGR 3985

Query: 2745 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTT 2802
              P ++P T  T  T   +     T  T P +T T+ TP  T + TQ  TP  +    ++
Sbjct: 3986 SLPPSSPHTVRTAWTSATSGILGTTHITEP-STVTSHTPAATTSTTQHSTPALSSPHPSS 4044

Query: 2803 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV------- 2850
              T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T        
Sbjct: 4045 RTTESPPSPGTTTPGHTRGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCA 4104

Query: 2851 --------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2899
                     P P P+G    T + I          P       Q     P+     V   
Sbjct: 4105 WSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVEC 4164

Query: 2900 PTPTGT---------------------------QTPTTTPITTTTTVTPTPTPTGTQTPT 2932
                G                              P+T   ++T T + TP  T   T  
Sbjct: 4165 SLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTKL 4224

Query: 2933 TTPITTT----TTVTPTPTPTGTQTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTT 2985
            TT  TTT    +T TP+ TP GT    T P TT T   P   T T + TQ    TP  +T
Sbjct: 4225 TTTATTTESTGSTATPSSTP-GTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVST 4283

Query: 2986 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3045
            T  TPT T     +   TP ++  T T  P    T    TTP  T+ T  P+ +   T T
Sbjct: 4284 TATTPTVT-----SSKATPFSSPGTATALPALRST---ATTPTATSFTAIPSSSLGTTWT 4335

Query: 3046 ---PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQTPTTTP 3096
                TTTP  T +T TP+ TP    T T    T TTT       TP+ TP GT   T  P
Sbjct: 4336 RLSQTTTPTATMSTATPSSTPETAHTSTVLTTTATTTRATGSVATPSSTP-GTAHTTKVP 4394

Query: 3097 ITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3148
             TTTT  TVTP+ +P   +TP      TTTP T+ +TVTP+  P  T TPT    TTTT 
Sbjct: 4395 TTTTTGFTVTPSSSPGTARTPPVWISTTTTPTTSGSTVTPSSVPGTTHTPTVLTTTTTTV 4454

Query: 3149 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3208
             T +     + T T+    T      T T  G     ++P T  T  T   + T   T  
Sbjct: 4455 ATGSMATPSSSTQTSGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHI 4514

Query: 3209 TTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3266
            T P +T T+ TP  T   TQ  TP  +    ++  T +P   GT TP  T  T+ TT T 
Sbjct: 4515 TEP-STGTSHTPAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATA 4573

Query: 3267 TPTPTGTQT-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT 3306
            TP+ T T T     PT+ PITT  T                 P P P+G    T + I  
Sbjct: 4574 TPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRA 4633

Query: 3307 ---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI------------- 3350
                    P       Q     P+     V       G        +             
Sbjct: 4634 AGGAVCEQPLGLECRAQAQPGVPLGELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRV 4693

Query: 3351 --TTTTTVTPTPTPTGTQTPTTTPITT------TTTVTPTPTPTGTQTPTTTPITTTTTV 3402
                      TP  + T  P++TP TT      TTT T T +   T TP++TP T     
Sbjct: 4694 FCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGT----- 4748

Query: 3403 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI-------TTTTTVTPTPTPT 3455
               P P    +P TTP  T++  T + +P   +T TT P+       +T T+VTP P+ T
Sbjct: 4749 --APPPKVLTSPATTPTATSSKATSSSSP---RTATTLPVLTSTATKSTATSVTPIPSST 4803

Query: 3456 -GT----QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3510
             GT       TTTP+ T +T+ P+ TP  T T T      TTT   + T T + TP TT 
Sbjct: 4804 LGTTGTLPEQTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTW 4863

Query: 3511 ITT------TTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTT 3562
            I T      TTT    PT T + TP TT I T  TTT T T +   T TP++TP TT   
Sbjct: 4864 ILTELTTAATTTAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTTWIL 4923

Query: 3563 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3622
              P+ T T T  PT +  T ++T     TP    T  TTP  T++  TP+ +P    T T
Sbjct: 4924 TEPSTTATVT-VPTGSTATASSTQATAGTP-HVSTTATTPTVTSSKATPSSSP---GTAT 4978

Query: 3623 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTT 3677
              P   +T  TPT T + T  P+++  TT T ++ T TPT T    TP++TP T  T+T 
Sbjct: 4979 ALPALRSTATTPTAT-SFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTV 5037

Query: 3678 VTPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTG 3732
            +T T T TG      TP++TP T  TT  PT T TG T TP+++P    T +TP      
Sbjct: 5038 LTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSP---GTALTP------ 5088

Query: 3733 TQTPTTTPITTTTTV----TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3788
               PTTTP++T +T+    TP  T T T   TT  +T  T  T TP+ T   T   T +T
Sbjct: 5089 ---PTTTPMSTMSTIHTSSTPETTHTSTVLTTTATMTRATNSTATPSSTLGTTRILTELT 5145

Query: 3789 TTTTVTPTPTPTGT--QTPTTTPI-TTTTTVTPTPTPTGTQTPTTTPITT--TTTVTPTP 3843
            TT T T     T T   TP TT I T  +T+     PTG+    ++ + T  T  V  T 
Sbjct: 5146 TTATTTAATGSTATLSSTPGTTWILTEPSTIATVMVPTGSTATASSTLGTAHTPKVVTTM 5205

Query: 3844 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3893
                T T +T P ++T   T TP    +  PT +  T +++V  T  PTG
Sbjct: 5206 ATMPTATASTVPSSSTVGTTRTPAVLPSSLPTFSVSTVSSSVLTTLRPTG 5255



 Score = 1016 bits (2626), Expect = 0.0
 Identities = 995/3108 (32%), Positives = 1276/3108 (41%), Gaps = 504/3108 (16%)

Query: 1698 TPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPT-TTPSPPTTTMTTLPPTTTSSPL 1756
            +P+P T+P   ++ +T P+    P+P  TT T  +    TPS  +T   T    ++S P+
Sbjct: 2128 SPAPGTSPQPSLSASTEPA---VPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPV 2184

Query: 1757 TTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPG 1816
            T TP  P               TT C P C WT W D   P   + GGD E    +   G
Sbjct: 2185 TVTPSAPG--------------TTTCQPRCQWTEWFDEDYPKSEQLGGDVESYDKIRAAG 2230

Query: 1817 W-----AANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEI 1871
                    +I C+A  +P+  + Q+GQ V CDV  GL+C+N +Q+  GV  M  C NY I
Sbjct: 2231 GHLCQQPKDIECQAESFPNWTLAQVGQKVHCDVHFGLVCRNWEQE--GVFKM--CYNYRI 2286

Query: 1872 NVQCCECVTQPTTMTTTTTENPTPPTTTPITTTT-TVTPTPTPTGTQTPTTTPITTTTTV 1930
             V CC   +        TT  PT    T  TTTT  +  TP PT +   T  P  +TT V
Sbjct: 2287 RVLCC---SDDHCRGRATTPPPTTELETATTTTTQALFSTPQPTSSPGLTRAPPASTTAV 2343

Query: 1931 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-----TGT 1985
             PT +   T    T+ + T TT  PT TP G+  PT   + T+T  T +  P      GT
Sbjct: 2344 -PTLSEGLTSPRYTSTLGTATTGGPT-TPAGSTEPTVPGVATSTLPTRSALPGTTGSLGT 2401

Query: 1986 QTPTTTP-ITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2043
              P+  P +  TT  T    PTGT  T +  P+TT+   T T   + +Q  T+TP T TT
Sbjct: 2402 WRPSQPPTLAPTTMATSRARPTGTASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETT 2461

Query: 2044 TVTPTPTPTGTQTPTTTPITTTT----TVTPTPTPTGTQTPTTTPITTT---TTVTPTPT 2096
                T T T   T    P    T       PT    G    T   I          P   
Sbjct: 2462 MSPLTNTTTSQGTTRCQPKCEWTEWFDVDFPTSGVAGGDMETFENIRAAGGKMCWAPKSI 2521

Query: 2097 PTGTQTPTTTPITTTTTVTPTPTPTG----------------------------TQTPTT 2128
                +      I     V      TG                            +  P+T
Sbjct: 2522 ECRAENYPEVSIDQVGQVLTCSLETGLTCKNEDQTGRFNMCFNYNVRVLCCDDYSHCPST 2581

Query: 2129 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2188
               ++T T + TP  T   T  TT  TTT +   T TPT T      P   TTT T TPT
Sbjct: 2582 PATSSTATPSSTPGTTWILTKPTTTATTTASTGSTATPTSTLRTAPPPKVLTTTAT-TPT 2640

Query: 2189 PTGTQ-TPTTTPITTT-------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ- 2239
             T ++ TP+++P T T       T  TPT T   T  P+++  TT T ++ T TPT T  
Sbjct: 2641 VTSSKATPSSSPGTATALPALRSTATTPTATSV-TPIPSSSLGTTWTRLSQTTTPTATMS 2699

Query: 2240 --TPTTTPIT--TTTTVTPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTT 2290
              TP++TP T  T+T +T T T TG      TP++TP T  TT  PT T TG T TP+++
Sbjct: 2700 TATPSSTPETAHTSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSS 2759

Query: 2291 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2350
            P T         TP    + TTTP T  +TVTP+  P GT T T T +TTTTT   T + 
Sbjct: 2760 PGTAL-------TPPVWISTTTTPTTRGSTVTPSSIP-GT-THTATVLTTTTTTVATGSM 2810

Query: 2351 TGTQTPTTTPITTTTTVTPTPTPT--GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2408
                + T T  TT T   P    T  G   P ++P T  T  T   +     T  T P T
Sbjct: 2811 ATPSSSTQTSGTTHTPPVPNTMATTHGRSLPPSSPHTVRTAWTSATSGILGTTHITEPST 2870

Query: 2409 TTT-TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2467
             T+ T+  T   T   TP  +    ++  T +P   GT TP  T  T+ TT T TP+ T 
Sbjct: 2871 VTSHTLAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTR 2930

Query: 2468 TQT-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT---TTT 2504
            T T     PT+ PITT  T+                P P P+G    T + I        
Sbjct: 2931 TSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVC 2990

Query: 2505 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI---------------TTTT 2549
              P       Q     P+     V       G        +                   
Sbjct: 2991 EQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYG 3050

Query: 2550 TVTPTPTPTGTQTPTTTPITT------TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2603
                TP  + T  P++TP TT      TTT T T +   T TP++TP TT     P+ T 
Sbjct: 3051 HCPSTPATSSTAMPSSTPGTTWILTELTTTATTTESTGSTATPSSTPGTTWILTEPSTTA 3110

Query: 2604 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2663
            T T  PT +  T ++T     TP    T  TTP  T++  TP  +P    T T  P   +
Sbjct: 3111 TVT-VPTGSTATASSTQATAGTP-HVSTTATTPTVTSSKATPFSSP---GTATALPALRS 3165

Query: 2664 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTP 2718
            T  TPT T + T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T 
Sbjct: 3166 TATTPTAT-SFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTATT 3224

Query: 2719 TG----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2773
            TG      TP++TP T  TT   T T TG T TP+++P T  T       P    T TTT
Sbjct: 3225 TGATGSVATPSSTPGTAHTTKVLTTTTTGFTATPSSSPGTART------LPVWIST-TTT 3277

Query: 2774 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2833
            P T  +TVTP+  P  T TPT    TTTT  T +     + T T+    T      T T 
Sbjct: 3278 PTTRGSTVTPSSIPGTTHTPTVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATT 3337

Query: 2834 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPIT 2891
             G     ++P T  T  T   + T   T  T P +T T+ TP  T   TQ  TP  +   
Sbjct: 3338 HGRSLSPSSPHTVRTAWTSATSGTLGTTHITEP-STGTSHTPAATTGTTQHSTPALSSPH 3396

Query: 2892 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV---- 2942
             ++  T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T+    
Sbjct: 3397 PSSRTTESPPSPGTTTPGHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEP 3456

Query: 2943 -----------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTV 2988
                        P P P+G    T + I          P       Q     P+     V
Sbjct: 3457 QCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQV 3516

Query: 2989 TPTPTPTGT---------------------------QTPTTTPITTTTTVTPTPTPTGTQ 3021
                   G                              P+T   ++T T + TP  T   
Sbjct: 3517 VECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWIL 3576

Query: 3022 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTV 3080
            T  TT  TTT T   T  P+ T      P   T+T T TPT T ++ T +++P T TT  
Sbjct: 3577 TEQTTAATTTATTGSTAIPSSTPGTAPPPKVLTSTAT-TPTATSSKATSSSSPRTATTLP 3635

Query: 3081 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPT 3139
              T T T +   + TPI + T  T     TGT    TTTP+ T +T+ P+ TP  T T T
Sbjct: 3636 VLTSTATKSTATSFTPIPSFTLGT-----TGTLPEQTTTPMATMSTIHPSSTPETTHTST 3690

Query: 3140 TTPITTTTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3197
                  TTT   +   T + TP TT I T  TT  T T     T TP++TP TT     P
Sbjct: 3691 VLTTKATTTRATSSMSTPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTEP 3750

Query: 3198 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTT 3256
            + T T      T P  +T T + T    GT    T+  TT T ++   TP+ +  T T  
Sbjct: 3751 STTAT-----VTVPTGSTATASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTATAL 3805

Query: 3257 PITTTTTVTPTPTPT--------GTQ----TPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3304
            P   +T  TPT T          GT     + TTTP  T +T TP+ TP    T T    
Sbjct: 3806 PALRSTATTPTATSVTAIPSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTT 3865

Query: 3305 TTTTT------VTPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPI 3350
            TTTTT       TP+ TP GT   T  P TTTT  T TP+ +P    TP      TTTP 
Sbjct: 3866 TTTTTRATGSVATPSSTP-GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPT 3924

Query: 3351 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT- 3409
            T  +TVTP+  P GT T T T +TTTTT   T +     + T T  TT T   P  T T 
Sbjct: 3925 TRGSTVTPSSIP-GT-THTATVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATT 3982

Query: 3410 -GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPIT 3466
             G   P ++P T  T  T   +     T  T P +T T+ TP  T + TQ  TP  +   
Sbjct: 3983 HGRSLPPSSPHTVRTAWTSATSGILGTTHITEP-STVTSHTPAATTSTTQHSTPALSSPH 4041

Query: 3467 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV---- 3517
             ++  T +P   GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T     
Sbjct: 4042 PSSRTTESPPSPGTTTPGHTRGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEP 4101

Query: 3518 -----------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTV 3563
                        P P P+G    T + I          P       Q     P+     V
Sbjct: 4102 QCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQV 4161

Query: 3564 TPTPTPTGT---------------------------QTPTTTPITTTTTVTPTPTPTGTQ 3596
                   G                              P+T   ++T T + TP  T   
Sbjct: 4162 VECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWIL 4221

Query: 3597 TPTTTPITTT----TTVTPTPTPTGTQTPTTTPITTTTTVTP---TPTPTGTQTPTTTPI 3649
            T  TT  TTT    +T TP+ TP GT    T P TT T   P   T T + TQ    TP 
Sbjct: 4222 TKLTTTATTTESTGSTATPSSTP-GTTWILTEPSTTATVTVPTGSTATASSTQATAGTPH 4280

Query: 3650 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3709
             +TT  TPT T     +   TP ++  T T  P    T    TTP  T+ T  P+ +   
Sbjct: 4281 VSTTATTPTVT-----SSKATPFSSPGTATALPALRST---ATTPTATSFTAIPSSSLGT 4332

Query: 3710 TQT---PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQTPT 3760
            T T    TTTP  T +T TP+ TP    T T    T TTT       TP+ TP GT   T
Sbjct: 4333 TWTRLSQTTTPTATMSTATPSSTPETAHTSTVLTTTATTTRATGSVATPSSTP-GTAHTT 4391

Query: 3761 TTPITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITT 3812
              P TTTT  TVTP+ +P   +TP      TTTP T+ +TVTP+  P  T TPT    TT
Sbjct: 4392 KVPTTTTTGFTVTPSSSPGTARTPPVWISTTTTPTTSGSTVTPSSVPGTTHTPTVLTTTT 4451

Query: 3813 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3872
            TT  T +     + T T+    T      T T  G     ++P T  T  T   + T   
Sbjct: 4452 TTVATGSMATPSSSTQTSGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGT 4511

Query: 3873 TPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3930
            T  T P +T T+ TP  T   TQ  TP  +    ++  T +P   GT TP  T  T+ TT
Sbjct: 4512 THITEP-STGTSHTPAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTT 4570

Query: 3931 VTPTPTPTGTQT-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTP 3970
             T TP+ T T T     PT+ PITT  T                 P P P+G    T + 
Sbjct: 4571 ATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSN 4630

Query: 3971 ITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG------------------- 4008
            I          P       Q     P+     V       G                   
Sbjct: 4631 IRAAGGAVCEQPLGLECRAQAQPGVPLGELGQVVECSLDFGLVCRNREQVGKFKMCFNYE 4690

Query: 4009 -----------TQTPTT--------TPITT------TTTVTPTPTPTGTQTPTTTPITT- 4042
                         TP T        TP TT      TTT T T +   T TP++TP T  
Sbjct: 4691 IRVFCCNYGHCPSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTAP 4750

Query: 4043 --TTTVTPTPTPTGT----------QTPTTTPI-------TTTTTVTPTPTPT-GT---- 4078
                  +P  TPT T          +T TT P+       +T T+VTP P+ T GT    
Sbjct: 4751 PPKVLTSPATTPTATSSKATSSSSPRTATTLPVLTSTATKSTATSVTPIPSSTLGTTGTL 4810

Query: 4079 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT---- 4134
               TTTP+ T +T+ P+ TP  T T T      TTT   + T T + TP TT I T    
Sbjct: 4811 PEQTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTT 4870

Query: 4135 --TTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 4190
              TTT    PT T + TP TT I T  TTT T T +   T TP++TP   TT +   P+ 
Sbjct: 4871 AATTTAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATPSSTP--GTTWILTEPST 4928

Query: 4191 TGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTL-LSTLPPAIEMTS 4249
            T T T P   T+TA   +  T+  P  S+T  T   TSS  T S++   +T  PA+  T+
Sbjct: 4929 TATVTVPTGSTATASSTQ-ATAGTPHVSTTATTPTVTSSKATPSSSPGTATALPALRSTA 4987

Query: 4250 TAPPSTP-TAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQT------- 4301
            T P +T  TA  ++S G T +    TTT    T T  T T SS   TP TV T       
Sbjct: 4988 TTPTATSFTAIPSSSLGTTWTRLSQTTTP---TATMSTATPSS---TPETVHTSTVLTAT 5041

Query: 4302 -TTTSAWTPTPTPLSTPSIIR--------TTGLRPYPSSVLICCVLNDTYYAPGEEVYNG 4352
             TTT A     TP STP            TTG    PSS            +PG  +   
Sbjct: 5042 ATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSS------------SPGTALTPP 5089

Query: 4353 TYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPT-PSKSTPTPSKPSST 4399
            T            S T E  + S   T + T T  + ST TPS    T
Sbjct: 5090 TTTPMSTMSTIHTSSTPETTHTSTVLTTTATMTRATNSTATPSSTLGT 5137



 Score = 1007 bits (2604), Expect = 0.0
 Identities = 982/3098 (31%), Positives = 1270/3098 (40%), Gaps = 508/3098 (16%)

Query: 1478 SPPTTTPSPPTTTTTTPPPTTTPSPPTTTPIT--PPASTTTLPPTT--TPSPPTTTTTTP 1533
            +PP TT     TTTTT    +TP P ++  +T  PPASTT +P  +    SP  T+T   
Sbjct: 2302 TPPPTTELETATTTTTQALFSTPQPTSSPGLTRAPPASTTAVPTLSEGLTSPRYTSTLGT 2361

Query: 1534 PPTTTPSPP--TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTI 1591
              T  P+ P  +T P  P  +T+TLP   T S  P TT +        PPT    +P T+
Sbjct: 2362 ATTGGPTTPAGSTEPTVPGVATSTLP---TRSALPGTTGSLGTWRPSQPPTL---APTTM 2415

Query: 1592 TTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTP 1651
             T+   PT T S    T +  P TT+ +P  T+ ++   + T+ P T T   P T TTT 
Sbjct: 2416 ATSRARPTGTAS----TASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTS 2471

Query: 1652 PPTTTPSP------------PTTTTPSPPITT-----TTTPPPTTTPSSPITTTPSPPTT 1694
              TT   P            PT+      + T              P S      + P  
Sbjct: 2472 QGTTRCQPKCEWTEWFDVDFPTSGVAGGDMETFENIRAAGGKMCWAPKSIECRAENYPEV 2531

Query: 1695 TMTTPSPTTTPSSPITTTTTPSSTT---------------------TPSPPPTTMT---- 1729
            ++       T S     T      T                      PS P T+ T    
Sbjct: 2532 SIDQVGQVLTCSLETGLTCKNEDQTGRFNMCFNYNVRVLCCDDYSHCPSTPATSSTATPS 2591

Query: 1730 -TPSPTTTPSPPTTTMTTLPPT----TTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVP 1784
             TP  T   + PTTT TT   T    T +S L T P P  +T    +P  T++  TP   
Sbjct: 2592 STPGTTWILTKPTTTATTTASTGSTATPTSTLRTAPPPKVLTTTATTPTVTSSKATPS-- 2649

Query: 1785 LCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISC-RATMYPDVPIGQLGQTVVCD 1843
                             PG  T L      P   +  +   AT    +P   LG T    
Sbjct: 2650 ---------------SSPGTATAL------PALRSTATTPTATSVTPIPSSSLGTTW--- 2685

Query: 1844 VSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPIT- 1902
                                          +  +  T   TM+T T      P++TP T 
Sbjct: 2686 -----------------------------TRLSQTTTPTATMSTAT------PSSTPETA 2710

Query: 1903 -TTTTVTPTPTPTG----TQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPT 1956
             T+T +T T T TG      TP++TP T  TT  PT T TG T TP+++P T        
Sbjct: 2711 HTSTVLTATATTTGATGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTAL------ 2764

Query: 1957 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2016
             TP    + TTTP T  +TVTP+  P GT T T T +TTTTT   T +     + T T  
Sbjct: 2765 -TPPVWISTTTTPTTRGSTVTPSSIP-GT-THTATVLTTTTTTVATGSMATPSSSTQTSG 2821

Query: 2017 TTTTTVTPTPTPT--GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT-TVTPTPT 2073
            TT T   P    T  G   P ++P T  T  T   +     T  T P T T+ T+  T  
Sbjct: 2822 TTHTPPVPNTMATTHGRSLPPSSPHTVRTAWTSATSGILGTTHITEPSTVTSHTLAATTG 2881

Query: 2074 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTT 2128
             T   TP  +    ++  T +P   GT TP  T  T+ TT T TP+ T T T     PT+
Sbjct: 2882 TTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRTSTLLPSSPTS 2941

Query: 2129 TPITTTTTV---------------TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQ 2170
             PITT  T+                P P P+G    T + I          P       Q
Sbjct: 2942 APITTVVTMGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQ 3001

Query: 2171 TPTTTPITTTTTVTPTPTPTGTQTPTTTPI---------------TTTTTVTPTPTPTGT 2215
                 P+     V       G        +                       TP  + T
Sbjct: 3002 AQPGVPLRELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSST 3061

Query: 2216 QTPTTTPITT------TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2269
              P++TP TT      TTT T T +   T TP++TP TT     P+ T T T  PT +  
Sbjct: 3062 AMPSSTPGTTWILTELTTTATTTESTGSTATPSSTPGTTWILTEPSTTATVT-VPTGSTA 3120

Query: 2270 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2329
            T ++T     TP    T  TTP  T++  TP  +P    T T  P   +T  TPT T + 
Sbjct: 3121 TASSTQATAGTP-HVSTTATTPTVTSSKATPFSSP---GTATALPALRSTATTPTAT-SF 3175

Query: 2330 TQTPTTTPITTTTTVTPTPTPTGTQ---TPTTTPIT--TTTTVTPTPTPTG----TQTPT 2380
            T  P+++  TT T ++ T TPT T    TP++TP T  T+T +T T T TG      TP+
Sbjct: 3176 TAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTATTTGATGSVATPS 3235

Query: 2381 TTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2439
            +TP T  TT   T T TG T TP+++P T  T       P    T TTTP T  +TVTP+
Sbjct: 3236 STPGTAHTTKVLTTTTTGFTATPSSSPGTART------LPVWIST-TTTPTTRGSTVTPS 3288

Query: 2440 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2499
              P  T TPT    TTTT  T +     + T T+    T      T T  G     ++P 
Sbjct: 3289 SIPGTTHTPTVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATTHGRSLSPSSPH 3348

Query: 2500 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTP 2557
            T  T  T   + T   T  T P +T T+ TP  T   TQ  TP  +    ++  T +P  
Sbjct: 3349 TVRTAWTSATSGTLGTTHITEP-STGTSHTPAATTGTTQHSTPALSSPHPSSRTTESPPS 3407

Query: 2558 TGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV--------------- 2597
             GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T+               
Sbjct: 3408 PGTTTPGHTRATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTMGCEPQCAWSEWLDYS 3467

Query: 2598 TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-- 2652
             P P P+G    T + I          P       Q     P+     V       G   
Sbjct: 3468 YPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVC 3527

Query: 2653 -------------------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2687
                                       P+T   ++T T + TP  T   T  TT  TTT 
Sbjct: 3528 RNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTEQTTAATTTA 3587

Query: 2688 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPTGTQT 2746
            T   T  P+ T      P   T+T T TPT T ++ T +++P T TT    T T T +  
Sbjct: 3588 TTGSTAIPSSTPGTAPPPKVLTSTAT-TPTATSSKATSSSSPRTATTLPVLTSTATKSTA 3646

Query: 2747 PTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2805
             + TPI + T  T     TGT    TTTP+ T +T+ P+ TP  T T T      TTT  
Sbjct: 3647 TSFTPIPSFTLGT-----TGTLPEQTTTPMATMSTIHPSSTPETTHTSTVLTTKATTTRA 3701

Query: 2806 PTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 2863
             +   T + TP TT I T  TT  T T     T TP++TP TT     P+ T T      
Sbjct: 3702 TSSMSTPSSTPGTTWILTELTTAATTTAATGPTATPSSTPGTTWILTEPSTTAT-----V 3756

Query: 2864 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPT 2922
            T P  +T T + T    GT    T+  TT T ++   TP+ +  T T  P   +T  TPT
Sbjct: 3757 TVPTGSTATASSTRATAGTLKVLTSTATTPTVISSRATPSSSPGTATALPALRSTATTPT 3816

Query: 2923 PTPT--------GTQ----TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------ 2964
             T          GT     + TTTP  T +T TP+ TP    T T    TTTTT      
Sbjct: 3817 ATSVTAIPSSSLGTAWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTTTTTTTRATGSV 3876

Query: 2965 VTPTPTPTGTQTPTTTPITTTT--TVTPTPTPTGTQTP------TTTPITTTTTVTPTPT 3016
             TP+ TP GT   T  P TTTT  T TP+ +P    TP      TTTP T  +TVTP+  
Sbjct: 3877 ATPSSTP-GTAHTTKVPTTTTTGFTATPSSSPGTALTPPVWISTTTTPTTRGSTVTPSSI 3935

Query: 3017 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT--GTQTPTTTPI 3074
            P GT T T T +TTTTT   T +     + T T  TT T   P  T T  G   P ++P 
Sbjct: 3936 P-GT-THTATVLTTTTTTVATGSMATPSSSTQTSGTTHTPPVPNTTATTHGRSLPPSSPH 3993

Query: 3075 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTP 3132
            T  T  T   +     T  T P +T T+ TP  T + TQ  TP  +    ++  T +P  
Sbjct: 3994 TVRTAWTSATSGILGTTHITEP-STVTSHTPAATTSTTQHSTPALSSPHPSSRTTESPPS 4052

Query: 3133 TGTQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTV--------------- 3172
             GT TP  T  T+ TT T TP+ T T T     PT+ PITT  T                
Sbjct: 4053 PGTTTPGHTRGTSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYS 4112

Query: 3173 TPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-- 3227
             P P P+G    T + I          P       Q     P+     V       G   
Sbjct: 4113 YPMPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVC 4172

Query: 3228 -------------------------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT- 3261
                                       P+T   ++T T + TP  T   T  TT  TTT 
Sbjct: 4173 RNREQVGKFKMCFNYEIRVFCCNYGHCPSTPATSSTATPSSTPGTTWILTKLTTTATTTE 4232

Query: 3262 ---TTVTPTPTPTGTQTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPT 3315
               +T TP+ TP GT    T P TT T   P   T T + TQ    TP  +TT  TPT T
Sbjct: 4233 STGSTATPSSTP-GTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPTVT 4291

Query: 3316 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT---PTTTP 3372
                 +   TP ++  T T  P    T    TTP  T+ T  P+ +   T T    TTTP
Sbjct: 4292 -----SSKATPFSSPGTATALPALRST---ATTPTATSFTAIPSSSLGTTWTRLSQTTTP 4343

Query: 3373 ITTTTTVTPTPTPTGTQTPTTTPITTTTT------VTPTPTPTGTQTPTTTPITTTT--T 3424
              T +T TP+ TP    T T    T TTT       TP+ TP GT   T  P TTTT  T
Sbjct: 4344 TATMSTATPSSTPETAHTSTVLTTTATTTRATGSVATPSSTP-GTAHTTKVPTTTTTGFT 4402

Query: 3425 VTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3478
            VTP+ +P   +TP      TTTP T+ +TVTP+  P  T TPT    TTTT  T +    
Sbjct: 4403 VTPSSSPGTARTPPVWISTTTTPTTSGSTVTPSSVPGTTHTPTVLTTTTTTVATGSMATP 4462

Query: 3479 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3538
             + T T+    T      T T  G     ++P T  T  T   + T   T  T P +T T
Sbjct: 4463 SSSTQTSGTTHTPPVPNTTATTHGRSLSPSSPHTVRTAWTSATSGTLGTTHITEP-STGT 4521

Query: 3539 TVTPTPTPTGTQ--TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3596
            + TP  T   TQ  TP  +    ++  T +P   GT TP  T  T+ TT T TP+ T T 
Sbjct: 4522 SHTPAATTGTTQHSTPALSSPHPSSRTTESPPSPGTTTPGHTTATSRTTATATPSKTRTS 4581

Query: 3597 T-----PTTTPITTTTTV---------------TPTPTPTGTQTPTTTPITT---TTTVT 3633
            T     PT+ PITT  T                 P P P+G    T + I          
Sbjct: 4582 TLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYPMPGPSGGDFDTYSNIRAAGGAVCEQ 4641

Query: 3634 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI---------------TTTTTV 3678
            P       Q     P+     V       G        +                     
Sbjct: 4642 PLGLECRAQAQPGVPLGELGQVVECSLDFGLVCRNREQVGKFKMCFNYEIRVFCCNYGHC 4701

Query: 3679 TPTPTPTGTQTPTTTPITT------TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3732
              TP  + T  P++TP TT      TTT T T +   T TP++TP T        P P  
Sbjct: 4702 PSTPATSSTAMPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGT-------APPPKV 4754

Query: 3733 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI-------TTTTTVTPTPTPT-GT----Q 3780
              +P TTP  T++  T + +P   +T TT P+       +T T+VTP P+ T GT     
Sbjct: 4755 LTSPATTPTATSSKATSSSSP---RTATTLPVLTSTATKSTATSVTPIPSSTLGTTGTLP 4811

Query: 3781 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----- 3835
              TTTP+ T +T+ P+ TP  T T T      TTT   + T T + TP TT I T     
Sbjct: 4812 EQTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTA 4871

Query: 3836 -TTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3892
             TTT    PT T + TP TT I T  TTT T T +   T TP++TP TT     P+ T T
Sbjct: 4872 ATTTAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTTWILTEPSTTAT 4931

Query: 3893 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTP-----TTT 3946
             T  PT +  T ++T     TP    T  TTP  T++  TP+ +P T T  P      TT
Sbjct: 4932 VT-VPTGSTATASSTQATAGTP-HVSTTATTPTVTSSKATPSSSPGTATALPALRSTATT 4989

Query: 3947 PITTTTTVTPTPTPTGTQT---PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT---- 3999
            P  T+ T  P+ +   T T    TTTP  T +T TP+ TP    T T    T TTT    
Sbjct: 4990 PTATSFTAIPSSSLGTTWTRLSQTTTPTATMSTATPSSTPETVHTSTVLTATATTTGATG 5049

Query: 4000 --VTPTPTPTGTQTPTTTPITTTT--TVTPTPTP-TGTQTPTTTPITTTTTV----TPTP 4050
               TP+ TP GT   T  P TTTT  T TP+ +P T    PTTTP++T +T+    TP  
Sbjct: 5050 SVATPSSTP-GTAHTTKVPTTTTTGFTATPSSSPGTALTPPTTTPMSTMSTIHTSSTPET 5108

Query: 4051 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT--QTPTTTP 4108
            T T T   TT  +T  T  T TP+ T   T   T +TTT T T     T T   TP TT 
Sbjct: 5109 THTSTVLTTTATMTRATNSTATPSSTLGTTRILTELTTTATTTAATGSTATLSSTPGTTW 5168

Query: 4109 I-TTTTTVTPTPTPTGTQTPTTTPITT--TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 4165
            I T  +T+     PTG+    ++ + T  T  V  T     T T +T P ++T   T TP
Sbjct: 5169 ILTEPSTIATVMVPTGSTATASSTLGTAHTPKVVTTMATMPTATASTVPSSSTVGTTRTP 5228

Query: 4166 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHTST 4203
                +  PT +  T +++V  T  PTG    P +H ST
Sbjct: 5229 AVLPSSLPTFSVSTVSSSVLTTLRPTGF---PSSHFST 5263



 Score =  598 bits (1541), Expect = e-170
 Identities = 279/558 (50%), Positives = 374/558 (67%), Gaps = 7/558 (1%)

Query: 28  RTRNHGHN--VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQA 85
           R  N  HN  VCSTWG+FHYKTFDGDVFRFPGLC+Y F+  C  +Y++F + L+R   Q 
Sbjct: 70  RASNPAHNGRVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRRS--QE 127

Query: 86  EAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTL 145
            A   +  +L+ +    I LT+   ++NG  V  P    G+LI++S +YTKV +R GL L
Sbjct: 128 SAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVL 187

Query: 146 MWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVV 205
           MWN +D+L+LELDTK+ N TCGLCGD+NG+   SE LS     +P+EFGN+QK++ P   
Sbjct: 188 MWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTEQ 247

Query: 206 CEDPEEEVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCRCPGGD--TC 263
           C+DP  E  P +CS     CE LL  + F+ C  LV +  YL AC+QD C C   D  +C
Sbjct: 248 CQDPVPE-PPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSC 306

Query: 264 VCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEE 323
           VC T+AE+SRQC+HAGG P +WR    CP+ CP N+ Y E  SPC DTCS+ E S  CE+
Sbjct: 307 VCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEHSRACED 366

Query: 324 HRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCK 383
           H + GCFCPEGTV DDIG +GCVPVS+C C  +G  Y PG   + DC  C C+ GRW C+
Sbjct: 367 HCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQ 426

Query: 384 DLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGDHNDSYALLGELAPCGSTDKQTC 443
           ++PCPGTC++ GG+H +TFDGK YT HGDC YVL K   + ++ +L EL  CG TD +TC
Sbjct: 427 EVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSAFTVLAELRRCGLTDSETC 486

Query: 444 LKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQ 503
           LK+V L  D  + VVV K+ G V LN++   LP   A+ ++FRPS++ I+   ++G++L 
Sbjct: 487 LKSVTLSLDGAQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQTSLGLQLN 546

Query: 504 VQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSC 563
           +QL P MQLF+ L    +GQ  GLCGNFN ++ DDF+T SG+VEAT A F NT+K Q++C
Sbjct: 547 LQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAAC 606

Query: 564 HDKLDWLDDPCSLNIESA 581
            +  +  +DPCSL++E+A
Sbjct: 607 PNIRNSFEDPCSLSVENA 624



 Score =  278 bits (711), Expect = 1e-73
 Identities = 242/771 (31%), Positives = 344/771 (44%), Gaps = 115/771 (14%)

Query: 1259 TTRPSTLTTFTTITLPTTPT-TFTTTTTTTTPTSS---TVLSTTPKLCCLWSDWINEDHP 1314
            TT P   T  +  T   TP+ T T+T   ++PTS+   TV++T  +  C WS+W++  +P
Sbjct: 4557 TTTPGHTTATSRTTATATPSKTRTSTLLPSSPTSAPITTVVTTGCEPQCAWSEWLDYSYP 4616

Query: 1315 SSGSDDGDRETFDG-------VCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKN 1367
              G   GD +T+         VC  P  +ECR+   P + L +LGQ V+C +  G +C+N
Sbjct: 4617 MPGPSGGDFDTYSNIRAAGGAVCEQPLGLECRAQAQPGVPLGELGQVVECSLDFGLVCRN 4676

Query: 1368 EDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTT-PSPPPTSTTTLPPTTTPSPPT 1426
             +Q G   F +C++Y+IRV CC     C +TP+  +T  PS  P +T  L   TT     
Sbjct: 4677 REQVGK--FKMCFNYEIRVFCC-NYGHCPSTPATSSTAMPSSTPGTTWILTELTT----- 4728

Query: 1427 TTTTTPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPP--TTTP 1484
            T TTT    +T +P  T  T PPP    SP  + T T    T+ S P T  + P  T+T 
Sbjct: 4729 TATTTASTGSTATPSSTPGTAPPPKVLTSPATTPTATSSKATSSSSPRTATTLPVLTSTA 4788

Query: 1485 SPPTTTTTTPPPTTTPSPPTTTP---ITPPASTTTLPPTTTPSPPTTTT--TTPPPTTTP 1539
            +  T T+ TP P++T     T P    TP A+ +T+ P++TP    T+T  TT   TT  
Sbjct: 4789 TKSTATSVTPIPSSTLGTTGTLPEQTTTPVATMSTIHPSSTPETTHTSTVLTTKATTTRA 4848

Query: 1540 SPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPT 1599
            +  T+TP + P +T  L   TT +   TTT    PT TPS    TT     +TTT    T
Sbjct: 4849 TSSTSTPSSTPGTTWILTELTTAA---TTTAATGPTATPSSTPGTTWILTELTTTA---T 4902

Query: 1600 TTPSPPTTTTTTPPPTTT---PSPPTTTPITPPTSTTTLPPTT--TPSPPPTTTTTPPPT 1654
            TT S  +T T +  P TT     P TT  +T PT +T    +T  T   P  +TT   PT
Sbjct: 4903 TTASTGSTATPSSTPGTTWILTEPSTTATVTVPTGSTATASSTQATAGTPHVSTTATTPT 4962

Query: 1655 TTPSP------PTTTTPSPPITTTTTPPPTTT----PSSPITTT------PSPPTTTMTT 1698
             T S       P T T  P + +T T P  T+    PSS + TT       + PT TM+T
Sbjct: 4963 VTSSKATPSSSPGTATALPALRSTATTPTATSFTAIPSSSLGTTWTRLSQTTTPTATMST 5022

Query: 1699 PSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTT 1758
             +P++TP +  T+T   ++ TT      T  T S  T  S P T  TT  PTTT++  T 
Sbjct: 5023 ATPSSTPETVHTSTVLTATATT------TGATGSVATPSSTPGTAHTTKVPTTTTTGFTA 5076

Query: 1759 TPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWA 1818
            TP   S +P T    + T PTT   P+   +    S  P       +T     V      
Sbjct: 5077 TP---SSSPGT----ALTPPTT--TPMSTMSTIHTSSTP-------ETTHTSTVLTTTAT 5120

Query: 1819 ANISCRATMYPDVPIG------QLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEIN 1872
               +  +T  P   +G      +L  T     + G         PG              
Sbjct: 5121 MTRATNSTATPSSTLGTTRILTELTTTATTTAATGSTA-TLSSTPGTTW----------- 5168

Query: 1873 VQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 1932
                  +T+P+T+ T            P  +T T + T    GT     TP   TT  T 
Sbjct: 5169 -----ILTEPSTIATVMV---------PTGSTATASST---LGT---AHTPKVVTTMAT- 5207

Query: 1933 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 1983
             PT T +  P+++ + TT T    P+   T + +T   +  TT+ PT  P+
Sbjct: 5208 MPTATASTVPSSSTVGTTRTPAVLPSSLPTFSVSTVSSSVLTTLRPTGFPS 5258



 Score =  173 bits (439), Expect = 3e-42
 Identities = 140/414 (33%), Positives = 190/414 (45%), Gaps = 72/414 (17%)

Query: 1209 KSCVCTNSSQV--VCRPEEGKILNQTQDGAFCYWEICGPN---GTVEKHFNICSITTRPS 1263
            +  +C NS Q   +C   E ++L        C +  CGP+   GT  +     S +T P+
Sbjct: 2096 RGLMCANSQQSPPLCHDYELRVL-------CCEYVPCGPSPAPGTSPQPS--LSASTEPA 2146

Query: 1264 TLT-TFTTITLPTT-----PTTFTTTTTTTTPTSSTVLSTTPKL-----C---CLWSDWI 1309
              T T TT T  TT         T   T+ T +SS  ++ TP       C   C W++W 
Sbjct: 2147 VPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSAPGTTTCQPRCQWTEWF 2206

Query: 1310 NEDHPSSGSDDGDRETFDGV-------CGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVG 1362
            +ED+P S    GD E++D +       C  P+DIEC++   P+ +L Q+GQKV CDV  G
Sbjct: 2207 DEDYPKSEQLGGDVESYDKIRAAGGHLCQQPKDIECQAESFPNWTLAQVGQKVHCDVHFG 2266

Query: 1363 FICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTP 1422
             +C+N +Q   G F +CY+Y+IRV CC   D C                  TT PPTT  
Sbjct: 2267 LVCRNWEQ--EGVFKMCYNYRIRVLCCSD-DHC--------------RGRATTPPPTTEL 2309

Query: 1423 SPPTTTTT-----TPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTP 1477
               TTTTT     TP PT++P      T  PP +TT  P +S   T P  T+     TT 
Sbjct: 2310 ETATTTTTQALFSTPQPTSSPG----LTRAPPASTTAVPTLSEGLTSPRYTSTLGTATTG 2365

Query: 1478 SPPT----TTPSPPTTTTTTPP-----PTTTPSPPTTTPITPP--ASTTTLPPTTTPSPP 1526
             P T    T P+ P   T+T P     P TT S  T  P  PP  A TT       P+  
Sbjct: 2366 GPTTPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAPTTMATSRARPTGT 2425

Query: 1527 TTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSP 1580
             +T +  P TT+ +P  T+ ++   + T+ P T T   P T TTT   TT   P
Sbjct: 2426 ASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSPLTNTTTSQGTTRCQP 2479



 Score =  165 bits (418), Expect = 1e-39
 Identities = 154/446 (34%), Positives = 197/446 (44%), Gaps = 65/446 (14%)

Query: 1402 PTTTPSPPPTSTT-TLPPTTTPSPPTTTTTTPPPTTT-----PSPPITTTTTPPPTTTPS 1455
            P++TP    TST  T   TTT +  +T+T +  P TT      +   TTT    PT TPS
Sbjct: 4826 PSSTPETTHTSTVLTTKATTTRATSSTSTPSSTPGTTWILTELTTAATTTAATGPTATPS 4885

Query: 1456 PPISTT------TTPPPTTTPSPPTTTPSP-PTTT---PSPPTTTTTTPPP--TTTPSPP 1503
                TT      TT   TT  +  T TPS  P TT     P TT T T P   T T S  
Sbjct: 4886 STPGTTWILTELTTTATTTASTGSTATPSSTPGTTWILTEPSTTATVTVPTGSTATASST 4945

Query: 1504 TTTPITPPASTTTLPPTTTPSP------PTTTTTTPPPTTTPSPPTTTPITP------PT 1551
              T  TP  STT   PT T S       P T T  P   +T + PT T  T        T
Sbjct: 4946 QATAGTPHVSTTATTPTVTSSKATPSSSPGTATALPALRSTATTPTATSFTAIPSSSLGT 5005

Query: 1552 STTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTT--TPPPTTTPSPPTTTT 1609
            + T L  TTTP+    T +T  P++TP    T+T    T TTT  T    T  S P T  
Sbjct: 5006 TWTRLSQTTTPT---ATMSTATPSSTPETVHTSTVLTATATTTGATGSVATPSSTPGTAH 5062

Query: 1610 TTPPPTTTPSPPTTTP-------ITPPTST--TTLPPTTTPSPPPTTTT----TPPPTTT 1656
            TT  PTTT +  T TP       +TPPT+T  +T+    T S P TT T    T   T T
Sbjct: 5063 TTKVPTTTTTGFTATPSSSPGTALTPPTTTPMSTMSTIHTSSTPETTHTSTVLTTTATMT 5122

Query: 1657 PSPPTTTTPSPPITTT------TTPPPTTTPSSPITTTPSPPTTT--MTTPSPTTTPSSP 1708
             +  +T TPS  + TT      TT   TT  +    T  S P TT  +T PS   T   P
Sbjct: 5123 RATNSTATPSSTLGTTRILTELTTTATTTAATGSTATLSSTPGTTWILTEPSTIATVMVP 5182

Query: 1709 ITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPP 1768
              +T T SST   +  P  +TT +     + PT T +T+P ++T     T    P++ P 
Sbjct: 5183 TGSTATASSTLGTAHTPKVVTTMA-----TMPTATASTVPSSSTVGTTRT----PAVLPS 5233

Query: 1769 TFSPFSTTTPTTPCVPLCNWTGWLDS 1794
            +   FS +T ++  +     TG+  S
Sbjct: 5234 SLPTFSVSTVSSSVLTTLRPTGFPSS 5259



 Score =  159 bits (401), Expect = 9e-38
 Identities = 91/265 (34%), Positives = 136/265 (51%), Gaps = 32/265 (12%)

Query: 796  CVSGCVCPDG--LMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQ 853
            CV+GC CP+G  L D G+ GCV   +C CV+N   Y+ GA    DC  CTC  GRW C +
Sbjct: 368  CVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQE 427

Query: 854  AVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCG-TT 912
              C GTCS+ G  H+ TFDGK Y   G CSYV  +  C  +    +F+++ E   CG T 
Sbjct: 428  VPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKP-CDSS----AFTVLAELRRCGLTD 482

Query: 913  GVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGH---HVAYTTREVGQ-----------YL 958
              TC K++        L L+    VV+ +  G    +  YT   +             ++
Sbjct: 483  SETCLKSV-------TLSLDGAQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFI 535

Query: 959  VVESSTGIIVIWDKRTT--VFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELD 1016
            + ++S G+ +      T  +F++LAP  +G  CGLCGNF+    +DF T   +V ++   
Sbjct: 536  IAQTSLGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAA 595

Query: 1017 FGNSWKEAPTCPDVSTN-PEPCSLN 1040
            F N++K    CP++  +  +PCSL+
Sbjct: 596  FFNTFKTQAACPNIRNSFEDPCSLS 620



 Score =  159 bits (401), Expect = 9e-38
 Identities = 134/414 (32%), Positives = 184/414 (44%), Gaps = 51/414 (12%)

Query: 1397 TTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTT-TTPPPTTTP------SPPITTTTTPP 1449
            T  + PT TPS  P +T  L   TT +  T +T +T  P++TP      + P TT T   
Sbjct: 4875 TAATGPTATPSSTPGTTWILTELTTTATTTASTGSTATPSSTPGTTWILTEPSTTATVTV 4934

Query: 1450 PT-----------TTPSPPISTT-TTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPT 1497
            PT           T  +P +STT TTP  T++ + P+++P   T  P+  +T TT    +
Sbjct: 4935 PTGSTATASSTQATAGTPHVSTTATTPTVTSSKATPSSSPGTATALPALRSTATTPTATS 4994

Query: 1498 TTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTT-- 1555
             T  P ++   T     T L  TTT   PT T +T  P++TP    T+ +   T+TTT  
Sbjct: 4995 FTAIPSSSLGTT----WTRLSQTTT---PTATMSTATPSSTPETVHTSTVLTATATTTGA 5047

Query: 1556 LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPT 1615
                 TPS  P T  T    TT +   T TPS    T  TPP TT    P +T +T   +
Sbjct: 5048 TGSVATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALTPPTTT----PMSTMSTIHTS 5103

Query: 1616 TTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTP 1675
            +TP    T+ +   T+T T    +T +P  T  TT   T   +  TTT  +    T ++ 
Sbjct: 5104 STPETTHTSTVLTTTATMTRATNSTATPSSTLGTTRILTELTTTATTTAATGSTATLSST 5163

Query: 1676 PPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPS--PPPTTMTTPSP 1733
            P TT     I T PS   T M     T T SS + T  TP   TT +  P  T  T PS 
Sbjct: 5164 PGTTW----ILTEPSTIATVMVPTGSTATASSTLGTAHTPKVVTTMATMPTATASTVPSS 5219

Query: 1734 TT-----TPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPC 1782
            +T     TP+   +++ T   +T SS + TT  P       FS        TPC
Sbjct: 5220 STVGTTRTPAVLPSSLPTFSVSTVSSSVLTTLRPTGFPSSHFS--------TPC 5265



 Score =  135 bits (341), Expect = 8e-31
 Identities = 122/432 (28%), Positives = 180/432 (41%), Gaps = 60/432 (13%)

Query: 860  CSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKA 919
            CS +GS HY TFDG  + F G C+YV   ++CG  ++   F+I               ++
Sbjct: 81   CSTWGSFHYKTFDGDVFRFPGLCNYV-FSEHCG--AAYEDFNIQLRR---------SQES 128

Query: 920  IKIFMGRTELKLEDKHRVVIQRDEG------HHVAYTTREVG-------QYLVVESSTGI 966
                + R  +K++    VVIQ  +G      H V     + G        Y  VE+  G+
Sbjct: 129  AAPTLSRVLMKVDG---VVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGL 185

Query: 967  IVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWK-EAP 1025
            +++W+   ++ ++L   Y    CGLCG+F+           H    + ++FGN  K + P
Sbjct: 186  VLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVS-ELLSHNTKLTPMEFGNLQKMDDP 244

Query: 1026 TCPDVSTNPEPCSLNPHRRSWAEKQCS-ILKSSVFSICHSKVDPKPFYEACVHDSCSCDT 1084
            T       PEP    P   S     C  +L   +FS C + VD   + EAC  D C C+ 
Sbjct: 245  TEQCQDPVPEP----PRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCED 300

Query: 1085 GGDCECFCSAVASYAQECTKEGAC-VFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFE 1143
                 C C  +A Y+++CT  G     WR PD CP  C      HEC     PC     +
Sbjct: 301  TDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECR---SPCA----D 353

Query: 1144 TCRTINGIHSNISVSY-LEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASV 1202
            TC   N  HS     + + GC+  CP+   + +     CV   KC C      Y PGA+ 
Sbjct: 354  TCS--NQEHSRACEDHCVAGCF--CPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATY 409

Query: 1203 PTEETCKSCVCTN---SSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSIT 1259
             T+  C +C C+    S Q V  P    +L       F      G   TV  H +   + 
Sbjct: 410  STD--CTNCTCSGGRWSCQEVPCPGTCSVLGGAHFSTF-----DGKQYTV--HGDCSYVL 460

Query: 1260 TRPSTLTTFTTI 1271
            T+P   + FT +
Sbjct: 461  TKPCDSSAFTVL 472



 Score =  131 bits (330), Expect = 2e-29
 Identities = 152/608 (25%), Positives = 238/608 (39%), Gaps = 101/608 (16%)

Query: 718  CSCYHRGLYLEAGDVVVRQEERCVCRDGRL---HCRQIRLIGQSCTAPK-IHMDCSNLTA 773
            C C   G +   G+V+  + +R  C    +   HC   R  G   T+P  +     +  +
Sbjct: 5265 CFCRAFGQFFSPGEVIYNKTDRAGCHFYAVCNQHCDIDRFQGACPTSPPPVSSAPLSSPS 5324

Query: 774  LATSKPRALSCQTLAAGYYHTEC-VSGCVCPDG--LMDDGRGGCV--VEKECPCVHNNDL 828
             A     A+  + +   +    C V+ CV  +   L+D      V  V K  P   ++  
Sbjct: 5325 PAPGCDNAIPLRQVNETWTLENCTVARCVGDNRVVLLDPKPVANVTCVNKHLPIKVSDP- 5383

Query: 829  YSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQ 888
             S       +C  C C  GR +   A   G CS++G  HY TFDG  Y F G+C+YV ++
Sbjct: 5384 -SQPCDFHYECE-CECVGGRGITPGA---GICSMWGGSHYSTFDGTSYTFRGNCTYVLMR 5438

Query: 889  DYCGQNSSLGSFSIITENVPCGTTGVT------CSKAIKIFMGRTELKLEDKHRVVIQRD 942
            +    ++  G+ S+  +N  C  +         C +A+ I     ++ L     +V  ++
Sbjct: 5439 EI---HARFGNLSLYLDNHYCTASATAAAAAARCPRALSIHYKSMDIVLTVT--MVHGKE 5493

Query: 943  EGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKL-----APSYKGTVC-------- 989
            EG  + +    V       S  G++V     TT+ + +     + ++ G V         
Sbjct: 5494 EGL-ILFDQIPVSSGF---SKNGVLVSVLGTTTMRVDIPALGVSVTFNGQVFQARLPYSL 5549

Query: 990  ------GLCGNFDHRSNNDFTTRDHMVVSSELDFGNSW------------------KEAP 1025
                  G CG   +   +D   RD    +S  D   +W                    +P
Sbjct: 5550 FHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTWLVPDSRKDGCWAPTGTPPTASP 5609

Query: 1026 TCPDVST-NPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDT 1084
              P  ST  P PC   P         C ++ S VF+ CH+ V P PF+ AC+ D C    
Sbjct: 5610 AAPVSSTPTPTPCPPQP--------LCDLMLSQVFAECHNLVPPGPFFNACISDHCR--- 5658

Query: 1085 GGDCECFCSAVASYAQECTKEGACVFWR--TPDLCPIFCDYYNPPHECEWHYEPCGNRSF 1142
             G  E  C ++ +YA+ C   G C  WR  T  LC + C    PP +    Y+PCG    
Sbjct: 5659 -GRLEVPCQSLEAYAELCRARGVCSDWRGATGGLCDLTC----PPTKV---YKPCGPIQP 5710

Query: 1143 ETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASV 1202
             TC + N   S       EGC+  CP+D+ ++   +  CV A  C C   D  +P     
Sbjct: 5711 ATCNSRN--QSPQLEGMAEGCF--CPEDQILFNAHMGICVQA--CPCVGPD-GFPKFPGE 5763

Query: 1203 PTEETCKSCVCTNSS-QVVCRP----EEGKILNQTQDGAFCYWEICGPNGTVEKHFNICS 1257
                 C+SCVC   S  V C+P     +G+     + G          N    +   +C+
Sbjct: 5764 RWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPPCNRPGFVTVTRPRAENPCCPETVCVCN 5823

Query: 1258 ITTRPSTL 1265
             TT P +L
Sbjct: 5824 TTTCPQSL 5831



 Score =  124 bits (310), Expect = 3e-27
 Identities = 122/471 (25%), Positives = 189/471 (40%), Gaps = 66/471 (14%)

Query: 391 CALEGGSHITTFDGKTYTFHGDCYYVLAK---GDHNDSYALLGELAPCGSTDKQTCLKTV 447
           C+  G  H  TFDG  + F G C YV ++     + D    L          +++   T+
Sbjct: 81  CSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRR-------SQESAAPTL 133

Query: 448 VLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLA 507
             +  K   VV+  + GSVL+N   V LP   +   + + SSY          +++ +L 
Sbjct: 134 SRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSY---------TKVEARLG 184

Query: 508 PVMQ------LFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQS 561
            V+       L + LD     +  GLCG+FNG+     +  S   + T   F N  K   
Sbjct: 185 LVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVS-ELLSHNTKLTPMEFGNLQKMD- 242

Query: 562 SCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNC 621
              D  +   DP      + +     C  L   +  F  C + VD   Y + C+ D C C
Sbjct: 243 ---DPTEQCQDPVPEPPRNCSTGFGICEELLHGQL-FSGCVALVDVGSYLEACRQDLCFC 298

Query: 622 QNNE--DCLCAALSSYARACTAKGVMLWGWR-EHVCNKDVGSCPNSQVFLYNLTTCQQTC 678
           ++ +   C+C  L+ Y+R CT  G +   WR    C +    CPN+  +    + C  TC
Sbjct: 299 EDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQ---KCPNNMQYHECRSPCADTC 355

Query: 679 RSLSEA---DSHCLEGFAPVDGCGCPDHTFLDEKGR--CVPLAKCSCYHRGLYLEAGDVV 733
            +   +   + HC      V GC CP+ T LD+ G+  CVP++KC+C + G     G   
Sbjct: 356 SNQEHSRACEDHC------VAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATY 409

Query: 734 VRQEERCVCRDGRLHCRQIRLIGQSCTA-------------PKIHMDCSN-LTALATSKP 779
                 C C  GR  C+++   G +C+                +H DCS  LT    S  
Sbjct: 410 STDCTNCTCSGGRWSCQEVPCPG-TCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSA 468

Query: 780 RALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYS 830
             +  +    G   +E    C+    L  DG    VV K    V  N +Y+
Sbjct: 469 FTVLAELRRCGLTDSET---CLKSVTLSLDGAQTVVVIKASGEVFLNQIYT 516



 Score =  121 bits (303), Expect = 2e-26
 Identities = 162/665 (24%), Positives = 252/665 (37%), Gaps = 108/665 (16%)

Query: 291  CPKTCPG-NLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCV--- 346
            CP + P  +   L S SP     + + +  + E   ++ C     TV   +GD+  V   
Sbjct: 5308 CPTSPPPVSSAPLSSPSPAPGCDNAIPLRQVNETWTLENC-----TVARCVGDNRVVLLD 5362

Query: 347  --PVSQCHCRLHGHLYTPGQEITNDCE-----QCVCNAGRWVCKDLPCPGTCALEGGSHI 399
              PV+   C ++ HL     + +  C+     +C C  GR +    P  G C++ GGSH 
Sbjct: 5363 PKPVANVTC-VNKHLPIKVSDPSQPCDFHYECECECVGGRGIT---PGAGICSMWGGSHY 5418

Query: 400  TTFDGKTYTFHGDCYYVLAKGDH----NDSYALLGELAPCGSTDKQTCLKTVVLLADKKK 455
            +TFDG +YTF G+C YVL +  H    N S  L        +T      +    L+   K
Sbjct: 5419 STFDGTSYTFRGNCTYVLMREIHARFGNLSLYLDNHYCTASATAAAAAARCPRALSIHYK 5478

Query: 456  NVVVF--------KSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLA 507
            ++ +         K +G +L +++ V+        S F  S   ++VS+     ++V + 
Sbjct: 5479 SMDIVLTVTMVHGKEEGLILFDQIPVS--------SGF--SKNGVLVSVLGTTTMRVDI- 5527

Query: 508  PVMQLFVTLD-QASQGQV---------QGLCGNFNGLEGDDFKTASGLVEATGAGFANTW 557
            P + + VT + Q  Q ++         +G CG     + DD     G   A+    A TW
Sbjct: 5528 PALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAASCKDMAKTW 5587

Query: 558  KAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETP------------FGRCHSAV 605
                S  D   W          +A+ A    S    T  P            F  CH+ V
Sbjct: 5588 LVPDSRKDGC-WAPTGTP---PTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFAECHNLV 5643

Query: 606  DPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQ 665
             P  ++  C  D  +C+   +  C +L +YA  C A+GV    WR         +CP ++
Sbjct: 5644 PPGPFFNACISD--HCRGRLEVPCQSLEAYAELCRARGVCS-DWRGATGGLCDLTCPPTK 5700

Query: 666  VFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCY-HRG 724
            V+         TC S +++    LEG A  +GC CP+   L      + +  C C    G
Sbjct: 5701 VYKPCGPIQPATCNSRNQSPQ--LEGMA--EGCFCPEDQILFNAHMGICVQACPCVGPDG 5756

Query: 725  LYLEAGDVVVRQEERCVCRDG--RLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRAL 782
                 G+  V   + CVC +G   + C+ +    Q    P     C+    +  ++PRA 
Sbjct: 5757 FPKFPGERWVSNCQSCVCDEGSVSVQCKPLPCDAQGQPPP-----CNRPGFVTVTRPRAE 5811

Query: 783  S--CQTLAAGYYHTECVSGC-VCPDG---LMDDGRGGCVVEKECP---CVHNNDLYSSGA 833
            +  C         T C     VCP G   +     G C     C    C +N   Y  GA
Sbjct: 5812 NPCCPETVCVCNTTTCPQSLPVCPPGQESICTQEEGDCCPTFRCRPQLCSYNGTFYGVGA 5871

Query: 834  KI--KVDCNTCTCKRG-----RWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVA 886
                 + C+ CTC  G        C +  C+ T    G         +Y    G C    
Sbjct: 5872 TFPGALPCHMCTCLSGDTQDPTVQCQEDACNNTTCPQGF--------EYKRVAGQCCGEC 5923

Query: 887  VQDYC 891
            VQ  C
Sbjct: 5924 VQTAC 5928



 Score =  115 bits (288), Expect = 1e-24
 Identities = 124/519 (23%), Positives = 200/519 (38%), Gaps = 65/519 (12%)

Query: 4455 TCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPS 4514
            TCS GL           C    C   C+  G  H  T+D   Y   G+C+YVL ++ + S
Sbjct: 1067 TCSGGLWQ---------CQDLPCPGTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADS 1117

Query: 4515 VDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKT-----VHMMPMQVQVQVNRQAV 4569
              +F V  +   C   D  +C + + +  +  +  I+      V +  +  Q+ ++   +
Sbjct: 1118 --SFTVLAELRKCGLTDNENCLKAVTLSLDGGDTAIRVQADGGVFLNSIYTQLPLSAANI 1175

Query: 4570 ALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRL-PYHRFGNNTKGQCGTCTNT 4628
             L        V Q+G+   + +  + ++  +      VRL P H+      G CG     
Sbjct: 1176 TLFTPSSFFIVVQTGLGLQLLVQLVPLMQVF------VRLDPAHQ--GQMCGLCGNFNQN 1227

Query: 4629 TSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCT 4688
             +DD    SG + +   A A+ W     ++  C ++ ++ + P            H    
Sbjct: 1228 QADDFTALSGVVEATGAAFANTW----KAQAACANARNSFEDPCSLSVENENYARH---- 1279

Query: 4689 PSPLCQLIKD--SLFAQCHALVPPQHYYDACVFDSCFMPGS-SLECASLQAYAALCAQQN 4745
                C  + D  S F++CH+++ P+ ++  C+FD+C    S    CA+L +Y   CA + 
Sbjct: 1280 ---WCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSEDCLCAALSSYVHACAAKG 1336

Query: 4746 ICL-DWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQ----QNNTVLVEGCFCPEG 4800
            + L DWR+      +  CP  + Y     A +PTC+  S        + V V+GC CP G
Sbjct: 1337 VQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCRGLSEADVTCSVSFVPVDGCTCPAG 1396

Query: 4801 TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT 4860
            T     G  V  + C C     V    GE    +   C C  G    +      S +  T
Sbjct: 1397 TFLNDAGACVPAQECPCYAHGTVLAP-GEVVHDEGAVCSCTGGKLSCL----GASLQKST 1451

Query: 4861 HCVEDGTYLATEVNPADT-------CCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGR 4913
             C     YL    + A T        C+     C ++ C     VCP G         G 
Sbjct: 1452 GCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHC-VSGCVCPPGLVSDGS---GG 1507

Query: 4914 CCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDK 4952
            C      E    CVH  A Y+PG  +    C  C C ++
Sbjct: 1508 CI----AEEDCPCVHNEATYKPGETI-RVDCNTCTCRNR 1541



 Score =  109 bits (273), Expect = 6e-23
 Identities = 147/633 (23%), Positives = 234/633 (36%), Gaps = 117/633 (18%)

Query: 4336 CVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSK 4395
            C  + T  APGE V++   G  C      LSC             S   +   + P    
Sbjct: 1413 CYAHGTVLAPGEVVHDE--GAVCSCTGGKLSCL----------GASLQKSTGCAAPMVYL 1460

Query: 4396 PSSTPSKPTPGTKP-PECPDFD--------------PPRQENETWWLC----DCFMATCK 4436
              S  S  TPG +    C   D              PP   ++    C    DC    C 
Sbjct: 1461 DCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLVSDGSGGCIAEEDC---PCV 1517

Query: 4437 YNNTV----EIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTF 4492
            +N       E ++V+C      TC N     R E     C H  C   C  +GD H++TF
Sbjct: 1518 HNEATYKPGETIRVDCNTC---TCRNR----RWE-----CSHRLCLGTCVAYGDGHFITF 1565

Query: 4493 DGLYYSYQGNCTYVLVEEI---SPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEV- 4548
            DG  YS++G+C Y+L ++    + +   F +  +N  C      +C + + +  E +   
Sbjct: 1566 DGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTG-TTCSKAIKLFVEVRTAP 1624

Query: 4549 LIKTVHMM---PMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPE-----------L 4594
             + T       P   +  V  +    P + Y L + +     V   P            +
Sbjct: 1625 AVSTPDPAANEPAPREASVGFRQRLPPLQSYELILQEGTFKAVARGPGGDPPYKIRYMGI 1684

Query: 4595 GVLVSYNGLSFS--------VRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEA 4646
             +++  +G++ S        +RL +  +     G CG   +   +D    S  +V +   
Sbjct: 1685 FLVIETHGMAVSWDRKTSVFIRL-HQDYKGRVCGLCGNFDDNAINDFATRSRSVVGDALE 1743

Query: 4647 AADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHA 4706
              + W ++    P CP + +  K P           P +       C ++    FA C +
Sbjct: 1744 FGNSWKLS----PSCPDALAP-KDPCTA-------NPFRKSWAQKQCSILHGPTFAACRS 1791

Query: 4707 LVPPQHYYDACVFDSCFM-PGSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVECP 4763
             V    YY+ACV D+C    G   E  C ++ AYA  C    +C+ WR  T   C + C 
Sbjct: 1792 QVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAGLCVSWR--TPDTCPLFCD 1849

Query: 4764 SHR-------EYQACGPAEEPTCKSSSSQ-QNNTVLVEGCF--CPEGTMNYAPGFDVCVK 4813
             +         YQ CG     TC++ S     +   +EGC+  CP     +      CV 
Sbjct: 1850 FYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGCYPKCPPSQPFFNEDQMKCVA 1909

Query: 4814 TCGCVGPDNVPREFGEHFEF--DCKNCVCLEGGSGIIC----QPKRCSQKPVTHCVEDGT 4867
             CGC   D    + G       +C++C C    SGI C    +   C+ +  T+  +D  
Sbjct: 1910 QCGCYDKDGNYYDVGARVPTAENCQSCNCTP--SGIQCAHSLEACTCTYEDRTYSYQDVI 1967

Query: 4868 YLATEVNPADTCCNITVCKCNTSLCKEKPSVCP 4900
            Y  T+   A   C I +C  N ++ + K   CP
Sbjct: 1968 YNTTDGLGA---CLIAICGSNGTIIR-KAVACP 1996



 Score =  108 bits (271), Expect = 1e-22
 Identities = 110/402 (27%), Positives = 165/402 (41%), Gaps = 49/402 (12%)

Query: 4481 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLI 4540
            C+ WG  HY TFDG  + + G C YV  E    + ++F + +       + + + P    
Sbjct: 81   CSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRR-----SQESAAPTLSR 135

Query: 4541 VRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSY 4600
            V  +   V+I+       +  V VN   V LP+ + G+ + QS  +Y      LG+++ +
Sbjct: 136  VLMKVDGVVIQLT-----KGSVLVNGHPVLLPFSQSGVLIQQSS-SYTKVEARLGLVLMW 189

Query: 4601 NGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPH 4660
            N     +     ++ N T G CG          +L     ++  E    Q + +DP    
Sbjct: 190  NHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKM-DDP---- 244

Query: 4661 CPHSSSTTKRPAVTVPGGGKTTPHKDC-TPSPLCQ-LIKDSLFAQCHALVPPQHYYDACV 4718
                   T++    VP      P ++C T   +C+ L+   LF+ C ALV    Y +AC 
Sbjct: 245  -------TEQCQDPVP-----EPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACR 292

Query: 4719 FDSCFMPGSSL---ECASLQAYAALCAQQN-ICLDWRNHTHGACLVECPSHREYQACGPA 4774
             D CF   + L    C +L  Y+  C     +  DWR      C  +CP++ +Y  C   
Sbjct: 293  QDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDF--CPQKCPNNMQYHECRSP 350

Query: 4775 EEPTCKSSS-SQQNNTVLVEGCFCPEGTMNYAPGFDVC--VKTCGCV--GPDNVPREFGE 4829
               TC +   S+      V GCFCPEGT+    G   C  V  C CV  G    P   G 
Sbjct: 351  CADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAP---GA 407

Query: 4830 HFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLAT 4871
             +  DC NC C   G    CQ   C   P T  V  G + +T
Sbjct: 408  TYSTDCTNCTC--SGGRWSCQEVPC---PGTCSVLGGAHFST 444



 Score =  108 bits (269), Expect = 2e-22
 Identities = 106/396 (26%), Positives = 153/396 (38%), Gaps = 42/396 (10%)

Query: 27   GRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAE 86
            GR    G  +CS WG  HY TFDG  + F G C Y    +    +   +++L      A 
Sbjct: 5400 GRGITPGAGICSMWGGSHYSTFDGTSYTFRGNCTYVLMREIHARFGNLSLYLDNHYCTAS 5459

Query: 87   APAGV------ESILLTIKDDTIYLT--------RHLAVLNGAVVSTPHYSPGLLIEKSD 132
            A A         ++ +  K   I LT          L + +   VS+     G+L+    
Sbjct: 5460 ATAAAAAARCPRALSIHYKSMDIVLTVTMVHGKEEGLILFDQIPVSSGFSKNGVLVSVLG 5519

Query: 133  AYTKVYS--RAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSP 190
              T        G+++ +N +        + F N+T G CG     Q       DG   + 
Sbjct: 5520 TTTMRVDIPALGVSVTFNGQVFQARLPYSLFHNNTEGQCGTCTNNQRDDCLQRDGTTAAS 5579

Query: 191  LEFGNMQKI----NQPDVVCEDPE------EEVAPASCSEHRAECER-----LLTAEAFA 235
             +  +M K     +     C  P          AP S +     C       L+ ++ FA
Sbjct: 5580 CK--DMAKTWLVPDSRKDGCWAPTGTPPTASPAAPVSSTPTPTPCPPQPLCDLMLSQVFA 5637

Query: 236  DCQDLVPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTAT--LCPK 293
            +C +LVP  P+  AC  D CR  G     C ++  ++  C  A G   +WR AT  LC  
Sbjct: 5638 ECHNLVPPGPFFNACISDHCR--GRLEVPCQSLEAYAELC-RARGVCSDWRGATGGLCDL 5694

Query: 294  TCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHC 353
            TCP   VY   G     TC+    S   E    +GCFCPE  +  +     CV    C  
Sbjct: 5695 TCPPTKVYKPCGPIQPATCNSRNQSPQLEG-MAEGCFCPEDQILFNAHMGICVQACPC-V 5752

Query: 354  RLHGHLYTPGQEITNDCEQCVCNAG--RWVCKDLPC 387
               G    PG+   ++C+ CVC+ G     CK LPC
Sbjct: 5753 GPDGFPKFPGERWVSNCQSCVCDEGSVSVQCKPLPC 5788



 Score =  107 bits (268), Expect = 2e-22
 Identities = 74/219 (33%), Positives = 100/219 (45%), Gaps = 33/219 (15%)

Query: 1760 PLPPSITPPTFS----PFSTTTPTTP----CV-PLCNWTGWLDSGKPNFHKPGGDTELIG 1810
            P  P+ TP TF+    P STT+P  P    CV  +C W+ W +  +P     GGD E   
Sbjct: 1996 PGTPATTPFTFTTAWVPHSTTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFE 2055

Query: 1811 DVCGPGWA-----ANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAF 1865
            ++   G+      A+I CRA   PD+P+ +LGQ V CD   GL+C N  Q P        
Sbjct: 2056 NLRQRGYQVCPVLADIECRAAQLPDMPLEELGQQVDCDRMRGLMCANSQQSP------PL 2109

Query: 1866 CLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 1925
            C +YE+ V CCE V             P  P+  P T+        T     TPT T  T
Sbjct: 2110 CHDYELRVLCCEYV-------------PCGPSPAPGTSPQPSLSASTEPAVPTPTQTTAT 2156

Query: 1926 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 1964
              TT+  TP+   T   T+   +++  VT TP+  GT T
Sbjct: 2157 EKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSAPGTTT 2195



 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 107/403 (26%), Positives = 156/403 (38%), Gaps = 53/403 (13%)

Query: 4481 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLI 4540
            C+ WGD HY TFDG  + + G C YV  E    + ++F V +              R L+
Sbjct: 733  CSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQL-------------RRGLV 779

Query: 4541 -VRHETQEVLIKTVHMM--PMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVL 4597
              R     V+IK   ++       V +N Q   LPY + GL V QSG +Y+     L + 
Sbjct: 780  GSRPVVTRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSG-DYIKVSIRLVLT 838

Query: 4598 VSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPS 4657
              +NG   ++     ++ N T G CG      + +        ++  +    Q L  D  
Sbjct: 839  FLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKL--DGP 896

Query: 4658 KPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDAC 4717
               CP          + +P G  T     C      + +    FA+CHALV    Y  AC
Sbjct: 897  TEQCP--------DPLPLPAGNCTDEEGICH-----RTLLGPAFAECHALVDSTAYLAAC 943

Query: 4718 VFDSCFMPGSSLECASLQAYAALCAQQ-NICLDWRNHTHGACLVECPSHREYQACGPAEE 4776
              D C  P  +  CA+   Y+  CA       +WR      C   CP + ++Q CG    
Sbjct: 944  AQDLCRCP--TCPCATFVEYSRQCAHAGGQPRNWR--CPELCPRTCPLNMQHQECGSPCT 999

Query: 4777 PTCKS-SSSQQNNTVLVEGCFCPEGTM-----NYAPGFDVCVKTCGCV--GPDNVPREFG 4828
             TC +   +Q      V+GCFCP G       +      + +  C C   G    P   G
Sbjct: 1000 DTCSNPQRAQLCEDHCVDGCFCPPGRSCTVLDDITHSGCLPLGQCPCTHGGRTYSP---G 1056

Query: 4829 EHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLAT 4871
              F   C +C C   G    CQ   C   P T  V+ G +++T
Sbjct: 1057 TSFNTTCSSCTC--SGGLWQCQDLPC---PGTCSVQGGAHIST 1094



 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 66/192 (34%), Positives = 83/192 (43%), Gaps = 21/192 (10%)

Query: 1516 TLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPIT--PPTSTTTLPPTTTPSPPPTTTTTPP 1573
            T PP TT     TTTTT    +TP P ++  +T  PP STT +P  +     P  T+T  
Sbjct: 2301 TTPPPTTELETATTTTTQALFSTPQPTSSPGLTRAPPASTTAVPTLSEGLTSPRYTSTLG 2360

Query: 1574 PTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPP-----PTTTPSPPTTTPITP 1628
              TT  P             TTP  +T P+ P   T+T P     P TT S  T  P  P
Sbjct: 2361 TATTGGP-------------TTPAGSTEPTVPGVATSTLPTRSALPGTTGSLGTWRPSQP 2407

Query: 1629 PTSTTTLPPTTTPSPPPT-TTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITT 1687
            PT   T   T+   P  T +T +  P TT   PT T+        T+ P T T  SP+T 
Sbjct: 2408 PTLAPTTMATSRARPTGTASTASKEPLTTSLAPTLTSELSTSQAETSTPRTETTMSPLTN 2467

Query: 1688 TPSPPTTTMTTP 1699
            T +   TT   P
Sbjct: 2468 TTTSQGTTRCQP 2479



 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 68/188 (36%), Positives = 85/188 (45%), Gaps = 22/188 (11%)

Query: 1492 TTPPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT 1551
            TTPPPTT     TTT  T  A  +T  PT++P      T  PP +TT  P  +  +T P 
Sbjct: 2301 TTPPPTTELETATTT--TTQALFSTPQPTSSPG----LTRAPPASTTAVPTLSEGLTSPR 2354

Query: 1552 STTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTT-------PPPTTTPSP 1604
             T+TL   TT  P     +T P  T P   T+T P+   +  TT       P    T +P
Sbjct: 2355 YTSTLGTATTGGPTTPAGSTEP--TVPGVATSTLPTRSALPGTTGSLGTWRPSQPPTLAP 2412

Query: 1605 PTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTP--SPPPTTTTTPPPTTTPSPPTT 1662
             T  T+   PT T S  +  P+T     T+L PT T   S     T+TP   TT SP T 
Sbjct: 2413 TTMATSRARPTGTASTASKEPLT-----TSLAPTLTSELSTSQAETSTPRTETTMSPLTN 2467

Query: 1663 TTPSPPIT 1670
            TT S   T
Sbjct: 2468 TTTSQGTT 2475



 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 84/242 (34%), Positives = 101/242 (41%), Gaps = 40/242 (16%)

Query: 1396 ITTPS--PPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITT--TTTPPPT 1451
            + TPS  P T   +  PT+TTT    T  S P T  T  PPTTTP   ++T  T++ P T
Sbjct: 5051 VATPSSTPGTAHTTKVPTTTTTGFTATPSSSPGTALT--PPTTTPMSTMSTIHTSSTPET 5108

Query: 1452 TTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPP 1511
            T  S  ++TT T    T  +  T TPS    T    T  TTT          TTT  T  
Sbjct: 5109 THTSTVLTTTAT---MTRATNSTATPSSTLGTTRILTELTTT---------ATTTAAT-- 5154

Query: 1512 ASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTT 1571
             ST TL  T    P TT   T P T        T + P  ST T   T   +  P   TT
Sbjct: 5155 GSTATLSST----PGTTWILTEPST------IATVMVPTGSTATASSTLGTAHTPKVVTT 5204

Query: 1572 PPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPT--------TTTTTPPPTTTPSPPTT 1623
                T P+   +T PS  T+ TT  P     S PT        +  TT  PT  PS   +
Sbjct: 5205 --MATMPTATASTVPSSSTVGTTRTPAVLPSSLPTFSVSTVSSSVLTTLRPTGFPSSHFS 5262

Query: 1624 TP 1625
            TP
Sbjct: 5263 TP 5264



 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 48/204 (23%), Positives = 91/204 (44%), Gaps = 16/204 (7%)

Query: 4472 CWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPND 4531
            C    C   C+  G  H+ TFDG  Y+  G+C+YVL +    S   F V  +   C   D
Sbjct: 425  CQEVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSA--FTVLAELRRCGLTD 482

Query: 4532 KVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDI 4591
              +C +++ +  +  +    TV ++    +V +N+    LP     + +++    +++  
Sbjct: 483  SETCLKSVTLSLDGAQ----TVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQ 538

Query: 4592 PELGVLVSYNGLSFSVRLPYHRFGNNTKGQ-CGTCTNTTS---DDCILPSGEIVSNCEAA 4647
              LG+ ++   L  +++L + +     +GQ CG C N  S   DD    SG +    EA 
Sbjct: 539  TSLGLQLNLQ-LVPTMQL-FMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVV----EAT 592

Query: 4648 ADQWLVNDPSKPHCPHSSSTTKRP 4671
            A  +     ++  CP+  ++ + P
Sbjct: 593  AAAFFNTFKTQAACPNIRNSFEDP 616



 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 31/76 (40%), Positives = 38/76 (50%), Gaps = 6/76 (7%)

Query: 1578 PSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPT--TTPSPPTTTPITPPTSTTTL 1635
            PSP   T+P P    +T P   T    PT TT T   T   TPS  +T  +T  T +++ 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPT----PTQTTATEKTTLWVTPSIRSTAALTSQTGSSSG 2182

Query: 1636 PPTTTPSPPPTTTTTP 1651
            P T TPS P TTT  P
Sbjct: 2183 PVTVTPSAPGTTTCQP 2198



 Score = 42.4 bits (98), Expect = 0.012
 Identities = 27/77 (35%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 1595 TPPPTTTPSPPTTTTTTP----PPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTT 1650
            +P P T+P P  + +T P    P  TT +  TT  +TP   +T    + T S      ++
Sbjct: 2128 SPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGS------SS 2181

Query: 1651 PPPTTTPSPPTTTTPSP 1667
             P T TPS P TTT  P
Sbjct: 2182 GPVTVTPSAPGTTTCQP 2198



 Score = 40.8 bits (94), Expect = 0.035
 Identities = 37/124 (29%), Positives = 47/124 (37%), Gaps = 19/124 (15%)

Query: 4851 PKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMV 4910
            P  C QK    C  +  Y       ADTC N    +     C      CP G  +     
Sbjct: 331  PDFCPQK----CPNNMQYHECRSPCADTCSNQEHSRACEDHCVAG-CFCPEGTVLDDIGQ 385

Query: 4911 PGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCN 4970
             G C P     SK  CV+  A Y PG+  YS+ C +C C+            +C  VPC 
Sbjct: 386  TG-CVPV----SKCACVYNGAAYAPGA-TYSTDCTNCTCSG--------GRWSCQEVPCP 431

Query: 4971 TSCS 4974
             +CS
Sbjct: 432  GTCS 435



 Score = 40.8 bits (94), Expect = 0.035
 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 5/68 (7%)

Query: 1637 PTTTPSPPPTTTTTP----PPTTTPSPPTTTTPSPPITTTTTPPPTTTPSS-PITTTPSP 1691
            P T+P P  + +T P    P  TT +  TT   +P I +T      T  SS P+T TPS 
Sbjct: 2131 PGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVTPSA 2190

Query: 1692 PTTTMTTP 1699
            P TT   P
Sbjct: 2191 PGTTTCQP 2198



 Score = 39.7 bits (91), Expect = 0.079
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 1571 TPPPTTTPSPP--TTTTPSPPTITTTTPPPTTT----PSPPTTTTTTPPPTTTPSPPTTT 1624
            +P P T+P P    +T P+ PT T TT    TT    PS  +T   T    ++  P T T
Sbjct: 2128 SPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVT 2187

Query: 1625 PITPPTST 1632
            P  P T+T
Sbjct: 2188 PSAPGTTT 2195



 Score = 39.7 bits (91), Expect = 0.079
 Identities = 26/74 (35%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 1519 PTTTPSPPTTTTTTP----PPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPP 1574
            P T+P P  + +T P    P  TT +  TT  +TP   +T    + T S      ++ P 
Sbjct: 2131 PGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGS------SSGPV 2184

Query: 1575 TTTPSPPTTTTPSP 1588
            T TPS P TTT  P
Sbjct: 2185 TVTPSAPGTTTCQP 2198



 Score = 39.7 bits (91), Expect = 0.079
 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 3/71 (4%)

Query: 1558 PTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTT 1617
            P T+P P  + +T P     P+P  TT     T+  T    +T      T +++ P T T
Sbjct: 2131 PGTSPQPSLSASTEP---AVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTVT 2187

Query: 1618 PSPPTTTPITP 1628
            PS P TT   P
Sbjct: 2188 PSAPGTTTCQP 2198



 Score = 39.3 bits (90), Expect = 0.10
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 1539 PSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTIT-TTTPP 1597
            PSP   T   P  S +T P   TP+    TT T   T   +P   +T +  + T +++ P
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQ---TTATEKTTLWVTPSIRSTAALTSQTGSSSGP 2183

Query: 1598 PTTTPSPPTTTTTTP 1612
             T TPS P TTT  P
Sbjct: 2184 VTVTPSAPGTTTCQP 2198



 Score = 38.9 bits (89), Expect = 0.13
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 1641 PSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPS 1700
            PSP P T+  P  + +  P   T    P  TT T   T   +  I +T +  + T ++  
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPT----PTQTTATEKTTLWVTPSIRSTAALTSQTGSSSG 2182

Query: 1701 PTT-TPSSPITTTTTP 1715
            P T TPS+P TTT  P
Sbjct: 2183 PVTVTPSAPGTTTCQP 2198



 Score = 38.5 bits (88), Expect = 0.18
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 1618 PSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPS-PPITTTTTPP 1676
            PSP   T   P  S +T P   TP+    TT T   T   +P   +T +    T +++ P
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQ---TTATEKTTLWVTPSIRSTAALTSQTGSSSGP 2183

Query: 1677 PTTTPSSPITTTPSP 1691
             T TPS+P TTT  P
Sbjct: 2184 VTVTPSAPGTTTCQP 2198



 Score = 37.4 bits (85), Expect = 0.39
 Identities = 28/74 (37%), Positives = 33/74 (44%), Gaps = 4/74 (5%)

Query: 1604 PPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPT--TTPSPPPTTTTTPPPTTTPSPPT 1661
            P     T+P P+ + S     P TP  +T T   T   TPS   T   T   T + S P 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVP-TPTQTTATEKTTLWVTPSIRSTAALT-SQTGSSSGPV 2184

Query: 1662 TTTPSPPITTTTTP 1675
            T TPS P TTT  P
Sbjct: 2185 TVTPSAPGTTTCQP 2198



 Score = 37.4 bits (85), Expect = 0.39
 Identities = 23/72 (31%), Positives = 32/72 (44%)

Query: 4127 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4186
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4187 TPTPTGTQTGPP 4198
            TP+  GT T  P
Sbjct: 2187 TPSAPGTTTCQP 2198



 Score = 36.6 bits (83), Expect = 0.67
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 4142 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTGPPTH 4200
            P+P    +P  +   +T    PTPT T     TT  +T +   T   T  TG+ +GP T 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4201 TSTAP 4205
            T +AP
Sbjct: 2187 TPSAP 2191



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 1965 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2024
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2025 TPTPTGTQT 2033
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 1988 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2047
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2048 TPTPTGTQT 2056
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2011 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2070
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2071 TPTPTGTQT 2079
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2034 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2093
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2094 TPTPTGTQT 2102
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2057 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2116
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2117 TPTPTGTQT 2125
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2080 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2139
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2140 TPTPTGTQT 2148
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2103 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2162
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2163 TPTPTGTQT 2171
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2126 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2185
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2186 TPTPTGTQT 2194
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2149 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2208
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2209 TPTPTGTQT 2217
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2172 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2231
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2232 TPTPTGTQT 2240
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2195 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2254
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2255 TPTPTGTQT 2263
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2218 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2277
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2278 TPTPTGTQT 2286
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2241 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2300
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2301 TPTPTGTQT 2309
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2264 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2323
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2324 TPTPTGTQT 2332
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2287 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2346
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2347 TPTPTGTQT 2355
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2310 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2369
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2370 TPTPTGTQT 2378
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2333 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2392
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2393 TPTPTGTQT 2401
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2356 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2415
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2416 TPTPTGTQT 2424
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2379 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2438
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2439 TPTPTGTQT 2447
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2402 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2461
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2462 TPTPTGTQT 2470
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2425 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2484
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2485 TPTPTGTQT 2493
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2448 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2507
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2508 TPTPTGTQT 2516
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2471 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2530
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2531 TPTPTGTQT 2539
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2494 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2553
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2554 TPTPTGTQT 2562
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2517 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2576
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2577 TPTPTGTQT 2585
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2540 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2599
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2600 TPTPTGTQT 2608
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2563 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2622
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2623 TPTPTGTQT 2631
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2586 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2645
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2646 TPTPTGTQT 2654
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2609 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2668
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2669 TPTPTGTQT 2677
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2632 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2691
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2692 TPTPTGTQT 2700
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2655 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2714
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2715 TPTPTGTQT 2723
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2678 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2737
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2738 TPTPTGTQT 2746
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2701 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2760
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2761 TPTPTGTQT 2769
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2724 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2783
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2784 TPTPTGTQT 2792
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2747 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2806
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2807 TPTPTGTQT 2815
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2770 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2829
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2830 TPTPTGTQT 2838
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2793 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2852
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2853 TPTPTGTQT 2861
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2816 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2875
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2876 TPTPTGTQT 2884
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2839 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2898
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2899 TPTPTGTQT 2907
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2862 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2921
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2922 TPTPTGTQT 2930
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2885 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2944
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2945 TPTPTGTQT 2953
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2908 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2967
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2968 TPTPTGTQT 2976
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2931 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2990
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 2991 TPTPTGTQT 2999
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2954 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3013
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3014 TPTPTGTQT 3022
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 2977 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3036
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3037 TPTPTGTQT 3045
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3000 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3059
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3060 TPTPTGTQT 3068
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3023 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3082
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3083 TPTPTGTQT 3091
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3046 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3105
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3106 TPTPTGTQT 3114
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3069 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3128
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3129 TPTPTGTQT 3137
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3092 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3151
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3152 TPTPTGTQT 3160
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3115 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3174
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3175 TPTPTGTQT 3183
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3138 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3197
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3198 TPTPTGTQT 3206
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3161 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3220
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3221 TPTPTGTQT 3229
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3184 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3243
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3244 TPTPTGTQT 3252
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3207 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3266
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3267 TPTPTGTQT 3275
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3230 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3289
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3290 TPTPTGTQT 3298
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3253 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3312
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3313 TPTPTGTQT 3321
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3276 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3335
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3336 TPTPTGTQT 3344
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3299 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3358
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3359 TPTPTGTQT 3367
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3322 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3381
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3382 TPTPTGTQT 3390
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3345 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3404
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3405 TPTPTGTQT 3413
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3368 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3427
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3428 TPTPTGTQT 3436
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3391 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3450
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3451 TPTPTGTQT 3459
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3414 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3473
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3474 TPTPTGTQT 3482
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3437 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3496
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3497 TPTPTGTQT 3505
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3460 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3519
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3520 TPTPTGTQT 3528
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3483 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3542
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3543 TPTPTGTQT 3551
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3506 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3565
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3566 TPTPTGTQT 3574
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3529 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3588
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3589 TPTPTGTQT 3597
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3552 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3611
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3612 TPTPTGTQT 3620
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3575 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3634
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3635 TPTPTGTQT 3643
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3598 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3657
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3658 TPTPTGTQT 3666
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3621 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3680
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3681 TPTPTGTQT 3689
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3644 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3703
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3704 TPTPTGTQT 3712
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3667 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3726
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3727 TPTPTGTQT 3735
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3690 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3749
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3750 TPTPTGTQT 3758
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3713 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3772
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3773 TPTPTGTQT 3781
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3736 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3795
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3796 TPTPTGTQT 3804
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3759 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3818
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3819 TPTPTGTQT 3827
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3782 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3841
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3842 TPTPTGTQT 3850
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3805 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3864
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3865 TPTPTGTQT 3873
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3828 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3887
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3888 TPTPTGTQT 3896
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3851 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3910
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3911 TPTPTGTQT 3919
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3874 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3933
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3934 TPTPTGTQT 3942
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3897 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3956
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3957 TPTPTGTQT 3965
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3920 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3979
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 3980 TPTPTGTQT 3988
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3943 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4002
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4003 TPTPTGTQT 4011
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3966 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4025
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4026 TPTPTGTQT 4034
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 3989 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4048
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4049 TPTPTGTQT 4057
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4012 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4071
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4072 TPTPTGTQT 4080
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4035 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4094
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4095 TPTPTGTQT 4103
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4058 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4117
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4118 TPTPTGTQT 4126
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4081 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4140
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4141 TPTPTGTQT 4149
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4104 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4163
            P+  P T+        T     TPT T  T  TT+  TP+   T   T+   +++  VT 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVPTPTQTTATEKTTLWVTPSIRSTAALTSQTGSSSGPVTV 2186

Query: 4164 TPTPTGTQT 4172
            TP+  GT T
Sbjct: 2187 TPSAPGTTT 2195



 Score = 35.8 bits (81), Expect = 1.1
 Identities = 27/74 (36%), Positives = 32/74 (43%), Gaps = 4/74 (5%)

Query: 1525 PPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPT--TTPSPPPTTTTTPPPTTTPSPPT 1582
            P     T+P P+ + S     P TP  +T T   T   TPS   T   T   T + S P 
Sbjct: 2127 PSPAPGTSPQPSLSASTEPAVP-TPTQTTATEKTTLWVTPSIRSTAALT-SQTGSSSGPV 2184

Query: 1583 TTTPSPPTITTTTP 1596
            T TPS P  TT  P
Sbjct: 2185 TVTPSAPGTTTCQP 2198



 Score = 35.4 bits (80), Expect = 1.5
 Identities = 26/100 (26%), Positives = 37/100 (37%), Gaps = 16/100 (16%)

Query: 4877 DTCCNITVCKCNTSLCKEKPSVCPLGFE--VKSKMVPGRCCPFYWCESKGVCVHGNAEYQ 4934
            DTC N    +     C +    CP G    V   +    C P   C     C HG   Y 
Sbjct: 1000 DTCSNPQRAQLCEDHCVDG-CFCPPGRSCTVLDDITHSGCLPLGQCP----CTHGGRTYS 1054

Query: 4935 PGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCS 4974
            PG+  +++ C  C C+          +  C  +PC  +CS
Sbjct: 1055 PGTS-FNTTCSSCTCSG--------GLWQCQDLPCPGTCS 1085



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2001 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2060
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2061 PITTTTTVTPTPTPTGTQTP 2080
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2024 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2083
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2084 PITTTTTVTPTPTPTGTQTP 2103
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2047 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2106
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2107 PITTTTTVTPTPTPTGTQTP 2126
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2070 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2129
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2130 PITTTTTVTPTPTPTGTQTP 2149
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2093 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2152
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2153 PITTTTTVTPTPTPTGTQTP 2172
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2116 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2175
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2176 PITTTTTVTPTPTPTGTQTP 2195
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2139 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2198
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2199 PITTTTTVTPTPTPTGTQTP 2218
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2162 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2221
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2222 PITTTTTVTPTPTPTGTQTP 2241
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2185 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2244
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2245 PITTTTTVTPTPTPTGTQTP 2264
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2208 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2267
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2268 PITTTTTVTPTPTPTGTQTP 2287
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2231 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2290
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2291 PITTTTTVTPTPTPTGTQTP 2310
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2254 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2313
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2314 PITTTTTVTPTPTPTGTQTP 2333
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2277 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2336
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2337 PITTTTTVTPTPTPTGTQTP 2356
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2300 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2359
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2360 PITTTTTVTPTPTPTGTQTP 2379
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2323 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2382
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2383 PITTTTTVTPTPTPTGTQTP 2402
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2346 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2405
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2406 PITTTTTVTPTPTPTGTQTP 2425
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2369 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2428
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2429 PITTTTTVTPTPTPTGTQTP 2448
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2392 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2451
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2452 PITTTTTVTPTPTPTGTQTP 2471
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2415 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2474
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2475 PITTTTTVTPTPTPTGTQTP 2494
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2438 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2497
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2498 PITTTTTVTPTPTPTGTQTP 2517
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2461 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2520
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2521 PITTTTTVTPTPTPTGTQTP 2540
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2484 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2543
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2544 PITTTTTVTPTPTPTGTQTP 2563
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2507 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2566
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2567 PITTTTTVTPTPTPTGTQTP 2586
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2530 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2589
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2590 PITTTTTVTPTPTPTGTQTP 2609
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2553 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2612
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2613 PITTTTTVTPTPTPTGTQTP 2632
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2576 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2635
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2636 PITTTTTVTPTPTPTGTQTP 2655
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2599 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2658
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2659 PITTTTTVTPTPTPTGTQTP 2678
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2622 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2681
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2682 PITTTTTVTPTPTPTGTQTP 2701
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2645 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2704
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2705 PITTTTTVTPTPTPTGTQTP 2724
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2668 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2727
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2728 PITTTTTVTPTPTPTGTQTP 2747
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2691 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2750
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2751 PITTTTTVTPTPTPTGTQTP 2770
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2714 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2773
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2774 PITTTTTVTPTPTPTGTQTP 2793
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2737 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2796
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2797 PITTTTTVTPTPTPTGTQTP 2816
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2760 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2819
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2820 PITTTTTVTPTPTPTGTQTP 2839
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2783 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2842
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2843 PITTTTTVTPTPTPTGTQTP 2862
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2806 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2865
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2866 PITTTTTVTPTPTPTGTQTP 2885
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2829 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2888
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2889 PITTTTTVTPTPTPTGTQTP 2908
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2852 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2911
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2912 PITTTTTVTPTPTPTGTQTP 2931
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2875 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2934
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2935 PITTTTTVTPTPTPTGTQTP 2954
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2898 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2957
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2958 PITTTTTVTPTPTPTGTQTP 2977
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2921 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2980
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 2981 PITTTTTVTPTPTPTGTQTP 3000
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2944 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3003
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3004 PITTTTTVTPTPTPTGTQTP 3023
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2967 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3026
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3027 PITTTTTVTPTPTPTGTQTP 3046
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 2990 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3049
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3050 PITTTTTVTPTPTPTGTQTP 3069
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3013 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3072
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3073 PITTTTTVTPTPTPTGTQTP 3092
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3036 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3095
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3096 PITTTTTVTPTPTPTGTQTP 3115
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3059 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3118
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3119 PITTTTTVTPTPTPTGTQTP 3138
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3082 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3141
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3142 PITTTTTVTPTPTPTGTQTP 3161
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3105 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3164
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3165 PITTTTTVTPTPTPTGTQTP 3184
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3128 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3187
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3188 PITTTTTVTPTPTPTGTQTP 3207
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3151 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3210
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3211 PITTTTTVTPTPTPTGTQTP 3230
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3174 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3233
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3234 PITTTTTVTPTPTPTGTQTP 3253
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3197 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3256
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3257 PITTTTTVTPTPTPTGTQTP 3276
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3220 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3279
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3280 PITTTTTVTPTPTPTGTQTP 3299
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3243 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3302
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3303 PITTTTTVTPTPTPTGTQTP 3322
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3266 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3325
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3326 PITTTTTVTPTPTPTGTQTP 3345
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3289 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3348
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3349 PITTTTTVTPTPTPTGTQTP 3368
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3312 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3371
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3372 PITTTTTVTPTPTPTGTQTP 3391
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3335 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3394
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3395 PITTTTTVTPTPTPTGTQTP 3414
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3358 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3417
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3418 PITTTTTVTPTPTPTGTQTP 3437
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3381 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3440
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3441 PITTTTTVTPTPTPTGTQTP 3460
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3404 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3463
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3464 PITTTTTVTPTPTPTGTQTP 3483
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3427 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3486
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3487 PITTTTTVTPTPTPTGTQTP 3506
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3450 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3509
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3510 PITTTTTVTPTPTPTGTQTP 3529
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3473 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3532
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3533 PITTTTTVTPTPTPTGTQTP 3552
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3496 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3555
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3556 PITTTTTVTPTPTPTGTQTP 3575
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3519 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3578
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3579 PITTTTTVTPTPTPTGTQTP 3598
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3542 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3601
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3602 PITTTTTVTPTPTPTGTQTP 3621
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3565 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3624
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3625 PITTTTTVTPTPTPTGTQTP 3644
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3588 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3647
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3648 PITTTTTVTPTPTPTGTQTP 3667
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3611 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3670
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3671 PITTTTTVTPTPTPTGTQTP 3690
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3634 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3693
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3694 PITTTTTVTPTPTPTGTQTP 3713
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3657 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3716
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3717 PITTTTTVTPTPTPTGTQTP 3736
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3680 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3739
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3740 PITTTTTVTPTPTPTGTQTP 3759
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3703 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3762
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3763 PITTTTTVTPTPTPTGTQTP 3782
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3726 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3785
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3786 PITTTTTVTPTPTPTGTQTP 3805
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3749 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3808
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3809 PITTTTTVTPTPTPTGTQTP 3828
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3772 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3831
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3832 PITTTTTVTPTPTPTGTQTP 3851
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3795 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3854
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3855 PITTTTTVTPTPTPTGTQTP 3874
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3818 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3877
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3878 PITTTTTVTPTPTPTGTQTP 3897
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3841 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3900
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3901 PITTTTTVTPTPTPTGTQTP 3920
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3864 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3923
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3924 PITTTTTVTPTPTPTGTQTP 3943
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3887 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3946
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3947 PITTTTTVTPTPTPTGTQTP 3966
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3910 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3969
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3970 PITTTTTVTPTPTPTGTQTP 3989
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3933 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3992
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 3993 PITTTTTVTPTPTPTGTQTP 4012
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3956 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4015
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 4016 PITTTTTVTPTPTPTGTQTP 4035
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 3979 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4038
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 4039 PITTTTTVTPTPTPTGTQTP 4058
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4002 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4061
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 4062 PITTTTTVTPTPTPTGTQTP 4081
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4025 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4084
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 4085 PITTTTTVTPTPTPTGTQTP 4104
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4048 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4107
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 4108 PITTTTTVTPTPTPTGTQTP 4127
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4071 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4130
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 4131 PITTTTTVTPTPTPTGTQTP 4150
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 34.7 bits (78), Expect = 2.5
 Identities = 28/80 (35%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 4094 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4153
            P+P P GT   +  P  + +T    PTP    T TT    TT  VTP+   T   T  T 
Sbjct: 2127 PSPAP-GT---SPQPSLSASTEPAVPTP----TQTTATEKTTLWVTPSIRSTAALTSQTG 2178

Query: 4154 PITTTTTVTPTPTPTGTQTP 4173
              +   TVTP+   T T  P
Sbjct: 2179 SSSGPVTVTPSAPGTTTCQP 2198



 Score = 33.5 bits (75), Expect = 5.6
 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 7/71 (9%)

Query: 4336 CVLNDTYYAPGEEVYNGTYG-DTCYFVNCSLSCTLEFYNWSCPSTPSPTPTP------SK 4388
            C   D  Y+  + +YN T G   C    C  + T+     +CP TP+ TP          
Sbjct: 1954 CTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPH 2013

Query: 4389 STPTPSKPSST 4399
            ST +P+ P ST
Sbjct: 2014 STTSPALPVST 2024


>gi|169202626 PREDICTED: similar to mucin 5, partial [Homo sapiens]
          Length = 2013

 Score = 1516 bits (3924), Expect = 0.0
 Identities = 776/1723 (45%), Positives = 1009/1723 (58%), Gaps = 115/1723 (6%)

Query: 28   RTRNHGHN--VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQA 85
            R  N  HN  VCSTWG+FHYKTFDGDVFRFPGLC+Y F+  C  +Y++F + L+R   Q 
Sbjct: 70   RASNPAHNGRVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRRS--QE 127

Query: 86   EAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTL 145
             A   +  +L+ +    I LT+   ++NG  V  P    G+LI++S +YTKV +R GL L
Sbjct: 128  SAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVEARLGLVL 187

Query: 146  MWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVV 205
            MWN +D+L+LELDTK+ N TCGLCGD+NG+   SE LS     +P+EFGN+QK++ P   
Sbjct: 188  MWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKMDDPTEQ 247

Query: 206  CEDPEEEVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCRCPGGD--TC 263
            C+DP  E  P +CS     CE LL  + F+ C  LV +  YL AC+QD C C   D  +C
Sbjct: 248  CQDPVPE-PPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCEDTDLLSC 306

Query: 264  VCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLVYLESGSPCMDTCSHLEVSSLCEE 323
            VC T+AE+SRQC+HAGG P +WR    CP+ CP N+ Y E  SPC DTCS+ E S  CE+
Sbjct: 307  VCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEHSRACED 366

Query: 324  HRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCK 383
            H + GCFCPEGTV DDIG +GCVPVS+C C  +G  Y PG   + DC  C C+ GRW C+
Sbjct: 367  HCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSGGRWSCQ 426

Query: 384  DLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGDHNDSYALLGELAPCGSTDKQTC 443
            ++PCPGTC++ GG+H +TFDGK YT HGDC YVL K   + ++ +L EL  CG TD +TC
Sbjct: 427  EVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSAFTVLAELRRCGLTDSETC 486

Query: 444  LKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQ 503
            LK+V L  D  + VVV K+ G V LN++   LP   A+ ++FRPS++ I+   ++G++L 
Sbjct: 487  LKSVTLSLDGVQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQTSLGLQLN 546

Query: 504  VQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSC 563
            +QL P MQLF+ L    +GQ  GLCGNFN ++ DDF+T SG+VEAT A F NT+K Q++C
Sbjct: 547  LQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTFKTQAAC 606

Query: 564  HDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQN 623
             +  +  +DPCSL++E+  YA+HWCS L   + PFGRCH+AV P  YY  C +DTCNC+ 
Sbjct: 607  PNIRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFDTCNCER 666

Query: 624  NEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSE 683
            +EDCLCAALSSY  AC AKGV L GWR+ VC K + +CP S  + Y+++TCQ TCRSLSE
Sbjct: 667  SEDCLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCPKSMTYHYHVSTCQPTCRSLSE 726

Query: 684  ADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCR 743
             D  C  GF PVDGC CP  TFLD+ G+CV  + C CYHRG  +  G+ V      C C 
Sbjct: 727  GDITCSVGFIPVDGCICPKGTFLDDTGKCVQASNCPCYHRGSMIPNGESVHDSGAICTCT 786

Query: 744  DGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCP 803
             G+L C   +     C AP +  DC N T   T      SC TL    Y  +CV GCVCP
Sbjct: 787  HGKLSCIGGQAPAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCVPGCVCP 846

Query: 804  DGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIY 863
            DGL+ DG GGC+  ++CPCVHN   Y +G  I+V CNTCTC    W CT   C  TC++Y
Sbjct: 847  DGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVGCNTCTCDSRMWRCTDDPCLATCAVY 906

Query: 864  GSGHYITFDGKYYDFDGHCSYVAVQDYCG-QNSSLGSFSIITENVPCGTTGVTCSKAIKI 922
            G GHY+TFDG+ Y F+G C Y  VQ++CG ++S+  SF ++TENVPCGTTG TCSKAIKI
Sbjct: 907  GDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTCSKAIKI 966

Query: 923  FMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAP 982
            F+G  ELKL      VI  DE   V YT R++G YLVV++  G++++WDK+T++FI L+P
Sbjct: 967  FLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTDIGLVLLWDKKTSIFINLSP 1026

Query: 983  SYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPH 1042
             +KG VCGLCGNFD  + NDF TR   VV   L+FGNSWK +P+CPD     +PC+ NP 
Sbjct: 1027 EFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDPCTANPF 1086

Query: 1043 RRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQEC 1102
            R+SWA+KQCSIL    F+ CH+ V+P  +YEACV+D+C+CD+GGDCECFC+AVA+YAQ C
Sbjct: 1087 RKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVAAYAQAC 1146

Query: 1103 TKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEG 1162
             + G CV WRTP +CP+FCDYYNP  +CEWHY+PCG     TCR   G      V  LEG
Sbjct: 1147 HEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLR-DVWGLEG 1205

Query: 1163 CYPRCPKDRPIYEEDLKKCVTADKCG-----CYVEDTHYPPGASVPTEETCKSCVCTN-- 1215
            CYP+CP + PI++ED  +CV           C+V    Y PGA VP+++ C+SC+CT   
Sbjct: 1206 CYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERG 1265

Query: 1216 ------SSQVVC-----RPEEGKILNQTQDGAF-CYWEICGPNGTVEKHFNICSITTRPS 1263
                  +   VC     R   G ++  T DG   C    CG NGT+E+    CS TT P 
Sbjct: 1266 VECTYKAEACVCTYNGQRFHPGDVIYHTTDGTGGCISARCGANGTIERRVYPCSPTT-PV 1324

Query: 1264 TLTTFTTITLPTT-----------------------PTTFTTTTTTTTPTSSTVLSTTPK 1300
              TTF+  T P                         PTT  T+  T  PT+S  L   P 
Sbjct: 1325 PPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPTASASL---PP 1381

Query: 1301 LC---CLWSDWINEDHPSSGSDDGDRETFDG-------VCGAPEDIECRSVKDPHLSLEQ 1350
            +C   CLWS W++   P  G+D GD +T +        VC +P  +ECR+   P + L  
Sbjct: 1382 VCGEKCLWSPWMDVSRPGRGTDSGDFDTLENLRAHGYRVCESPRSVECRAEDAPGVPLRA 1441

Query: 1351 LGQKVQCDVSVGFICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTTPSPPP 1410
            LGQ+VQC   VG  C+N +Q      GLCY+Y+IRV CC P+  C T+ SP  TT  PP 
Sbjct: 1442 LGQRVQCSPDVGLTCRNREQAS----GLCYNYQIRVQCCTPL-ACSTSSSPAQTT--PPT 1494

Query: 1411 TSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPTTTP 1470
            TS TT    +  S P++T    P T + S   T  TTP P T  S   + +T  PP   P
Sbjct: 1495 TSKTTETRASGSSAPSST----PGTVSLS---TARTTPAPGTATSVKKTFSTPSPP---P 1544

Query: 1471 SPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTT-- 1528
             P T+T S  TTTP    T+  +  PT T  P T++ +    + T     + P+P     
Sbjct: 1545 VPATSTSSMSTTTPG---TSVVSSKPTLT-EPSTSSCLQELCTWTEWIDGSYPAPGINGG 1600

Query: 1529 ------------TTTTPPPTTTPSPPTTTPITP---------PTSTTTLPPTTTPSPPPT 1567
                         T    P +      + P TP          + T  L        PP 
Sbjct: 1601 DFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLPPI 1660

Query: 1568 TTTTP---PPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTT 1624
                        T +     T  P T+ TT P P  T +   TT TT  P+ +   PT T
Sbjct: 1661 CYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTAT 1720

Query: 1625 PITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSP 1667
                PT+T+    T T    P T    P  T         PSP
Sbjct: 1721 SRGGPTATSVTQGTHT---TPVTRNCHPRCTWTKWFDVDFPSP 1760



 Score =  222 bits (566), Expect = 7e-57
 Identities = 213/729 (29%), Positives = 288/729 (39%), Gaps = 95/729 (13%)

Query: 1731 PSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSI-TPPTFSPFSTTTPTTP-------- 1781
            P   TTP PPTT   + PP   SS  T +  P S  T P  S + TT  T+P        
Sbjct: 1317 PCSPTTPVPPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPTAS 1376

Query: 1782 ------CVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAA-----NISCRATMYPD 1830
                  C   C W+ W+D  +P      GD + + ++   G+       ++ CRA   P 
Sbjct: 1377 ASLPPVCGEKCLWSPWMDVSRPGRGTDSGDFDTLENLRAHGYRVCESPRSVECRAEDAPG 1436

Query: 1831 VPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTT 1890
            VP+  LGQ V C   VGL C+N +Q  G       C NY+I VQCC   T     T+++ 
Sbjct: 1437 VPLRALGQRVQCSPDVGLTCRNREQASG------LCYNYQIRVQCC---TPLACSTSSSP 1487

Query: 1891 ENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 1950
               TPPTT+  T T         +G+  P++TP T + +   T    GT T      +T 
Sbjct: 1488 AQTTPPTTSKTTETRA-------SGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTP 1540

Query: 1951 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTG 2007
            +   P P  + +   TTTP T+  +  PT T   T +      T T  +    P P   G
Sbjct: 1541 SP-PPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTWTEWIDGSYPAPGING 1599

Query: 2008 TQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG------TQTPT 2058
                T   +     T   +P       ++   TP+             G       Q P 
Sbjct: 1600 GDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLP- 1658

Query: 2059 TTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2117
              PI     +      T       T P  T  T  PTP PTG QT TT      +  T  
Sbjct: 1659 --PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQ 1716

Query: 2118 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2177
            PT T    PT T +T  T  TP    T    P  T         P+P P G    T   I
Sbjct: 1717 PTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFPSPGPHGGDKETYNNI 1773

Query: 2178 TTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-------QTPTTTPIT 2224
              +           T      ++     I     V       G        Q P    + 
Sbjct: 1774 IRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLVCRNQDQQGPFKMCLN 1833

Query: 2225 TTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TPTTTPITTTTTVTPTP 2279
                V    TP G   T TP T P T +   ++PT + +  Q + TTT +TT+TT TP  
Sbjct: 1834 YEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTP-- 1891

Query: 2280 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTVTPTPTPTGTQTPTTT 2336
                 QT TT   TT+TT  PT   T   T  TT   P +TT+    TP+P  T +  + 
Sbjct: 1892 -----QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISA 1946

Query: 2337 PITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQTPTTTPITTTTT--- 2389
            P   TT++T  PT + T  PT++    P T+TT+   + T +  QT TT+  TT+TT   
Sbjct: 1947 P---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGP 2003

Query: 2390 -VTPTPTPT 2397
              TP+P PT
Sbjct: 2004 GTTPSPVPT 2012



 Score =  222 bits (565), Expect = 9e-57
 Identities = 152/388 (39%), Positives = 206/388 (53%), Gaps = 53/388 (13%)

Query: 1219 VVCRPEEGKI-LNQTQDGAFCY-WEICGPNGTVEKHFNICSITTRP-------------- 1262
            V+C   EG I LN+ Q    CY +EI        +  N+C   TRP              
Sbjct: 1641 VICSHTEGLICLNKNQLPPICYNYEI---RIQCCETVNVCRDITRPPKTVATTRPTPHPT 1697

Query: 1263 --STLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLS---TTP--KLC---CLWSDWINED 1312
               T TTFTT  +P+  T   T T+   PT+++V     TTP  + C   C W+ W + D
Sbjct: 1698 GAQTQTTFTT-HMPSASTEQPTATSRGGPTATSVTQGTHTTPVTRNCHPRCTWTKWFDVD 1756

Query: 1313 HPSSGSDDGDRETFDGV-------CGAPEDI---ECRSVKDPHLSLEQLGQKVQCDVSVG 1362
             PS G   GD+ET++ +       C  PE+I   +CR+   P +S+E LGQ VQC    G
Sbjct: 1757 FPSPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEG 1816

Query: 1363 FICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTP 1422
             +C+N+DQ   GPF +C +Y++RV CC     C  T S P T PS  P+     P  +T 
Sbjct: 1817 LVCRNQDQ--QGPFKMCLNYEVRVLCCETPRGCPVT-STPVTAPS-TPSGRAISPTQSTS 1872

Query: 1423 SPPTTTTTTPPPTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPT-TTPSPPTTTPSPPT 1481
            S   + TTT   T+T S P T+TT    T+T S P + TT+ P T TT + P +T S P 
Sbjct: 1873 SWQKSRTTTLVTTSTTSTPQTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGPG 1932

Query: 1482 TTPSP-PTTTTTTPPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPS 1540
             TPSP PTT+T + P T+  S PTT       STT+ P ++T S PTT+TT+ P ++T S
Sbjct: 1933 NTPSPVPTTSTISAPTTSITSAPTT-------STTSAPTSSTTSAPTTSTTSAPTSSTTS 1985

Query: 1541 PPTTTPITPPTSTTTLPPTTTPSPPPTT 1568
             P T+  + PT++TT  P TTPSP PTT
Sbjct: 1986 SPQTSTTSAPTTSTTSGPGTTPSPVPTT 2013



 Score =  219 bits (559), Expect = 4e-56
 Identities = 215/729 (29%), Positives = 289/729 (39%), Gaps = 117/729 (16%)

Query: 1404 TTPSPPPTSTTTLPP-----TTTPSP-PTTTTTTPPPTTTPSPPITTTTTPPPTTTPSPP 1457
            TTP PP T + + PP     T TPS  P++  T PP +  P    TT  T P T  P+  
Sbjct: 1321 TTPVPPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWP----TTAGTSPRTRLPTAS 1376

Query: 1458 ISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTT---------PPPTTTPSPPTTTPI 1508
             S           SP      P   T S    T              P +        P 
Sbjct: 1377 ASLPPVCGEKCLWSPWMDVSRPGRGTDSGDFDTLENLRAHGYRVCESPRSVECRAEDAPG 1436

Query: 1509 TPPASTTTLPPTTTPSPPTTTTTTPPPTTTP-------SPPTTTPITPPTSTTTLPPTTT 1561
             P      L      SP    T       +             TP+    ST++ P  TT
Sbjct: 1437 VP---LRALGQRVQCSPDVGLTCRNREQASGLCYNYQIRVQCCTPLA--CSTSSSPAQTT 1491

Query: 1562 PSPPPTTTTTPPPTTTPSPPTTT--TPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPS 1619
            P  P T+ TT    +  S P++T  T S  T  TT  P T T    T +T +PPP    S
Sbjct: 1492 P--PTTSKTTETRASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATS 1549

Query: 1620 PPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTT 1679
              + +  TP TS  +  PT T   P T++      T       + P+P I          
Sbjct: 1550 TSSMSTTTPGTSVVSSKPTLT--EPSTSSCLQELCTWTEWIDGSYPAPGINGGDFDTFQN 1607

Query: 1680 TPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSST--------------------- 1718
                  T   SP +      S   TP + +      S T                     
Sbjct: 1608 LRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLPPICYNYEIR 1667

Query: 1719 -----------TTPSPPPTTMTT-PSPTTTPSPPTTTMTT-LPPTTTSSPLTTTPLPPSI 1765
                           PP T  TT P+P  T +   TT TT +P  +T  P  T+   P+ 
Sbjct: 1668 IQCCETVNVCRDITRPPKTVATTRPTPHPTGAQTQTTFTTHMPSASTEQPTATSRGGPTA 1727

Query: 1766 TPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVC--------GPGW 1817
            T  T     TT  T  C P C WT W D   P+    GGD E   ++          P  
Sbjct: 1728 TSVT-QGTHTTPVTRNCHPRCTWTKWFDVDFPSPGPHGGDKETYNNIIRSGEKICRRPEE 1786

Query: 1818 AANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCE 1877
               + CRA  +P+V I  LGQ V C    GL+C+N+DQ+     P   CLNYE+ V CCE
Sbjct: 1787 ITRLQCRAKSHPEVSIEHLGQVVQCSREEGLVCRNQDQQG----PFKMCLNYEVRVLCCE 1842

Query: 1878 CVTQPTTMTTTTTENPTPPTTTPITTTTT-----VTPTPTPTGTQ-TPTTTPITTTTTVT 1931
                        T    P T+TP+T  +T     ++PT + +  Q + TTT +TT+TT T
Sbjct: 1843 ------------TPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTST 1890

Query: 1932 PTPTPTGTQTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTTTTVTPTPTPTGTQTP 1988
            P       QT TT   TT+TT  PT   T    T+T + +P +TT+    TP+P  T + 
Sbjct: 1891 P-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTST 1943

Query: 1989 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTT--- 2044
             + P T+ T+   T T +   + TT+  TT+TT  PT + T + QT TT+  TT+TT   
Sbjct: 1944 ISAPTTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGP 2003

Query: 2045 -VTPTPTPT 2052
              TP+P PT
Sbjct: 2004 GTTPSPVPT 2012



 Score =  206 bits (523), Expect = 6e-52
 Identities = 214/729 (29%), Positives = 282/729 (38%), Gaps = 160/729 (21%)

Query: 1612 PPPTTTPSPPTTTPI-TPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSP--- 1667
            P   TTP PPTT    TPP   ++   T TPS  P++  T PP++  + PTT   SP   
Sbjct: 1317 PCSPTTPVPPTTFSFSTPPLVVSS---THTPSNGPSSAHTGPPSS--AWPTTAGTSPRTR 1371

Query: 1668 -PITTTTTPP---------PTTTPSSPITTTPSPPTTTM---------TTPSPTTTPSSP 1708
             P  + + PP         P    S P   T S    T+            SP +     
Sbjct: 1372 LPTASASLPPVCGEKCLWSPWMDVSRPGRGTDSGDFDTLENLRAHGYRVCESPRSVECRA 1431

Query: 1709 ITTTTTP---SSTTTPSPPPTTMT---------------------TPSPTTTPS------ 1738
                  P           P   +T                     TP   +T S      
Sbjct: 1432 EDAPGVPLRALGQRVQCSPDVGLTCRNREQASGLCYNYQIRVQCCTPLACSTSSSPAQTT 1491

Query: 1739 PPTTTMTT------------LPPT-------TTSSPLT--------TTPLPPSITPPTFS 1771
            PPTT+ TT             P T       TT +P T        +TP PP +   + S
Sbjct: 1492 PPTTSKTTETRASGSSAPSSTPGTVSLSTARTTPAPGTATSVKKTFSTPSPPPVPATSTS 1551

Query: 1772 PFSTTTPTTPCV----------------PLCNWTGWLDSGKPNFHKPGGDTELIGDVCGP 1815
              STTTP T  V                 LC WT W+D   P     GGD +   ++   
Sbjct: 1552 SMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTWTEWIDGSYPAPGINGGDFDTFQNLRDE 1611

Query: 1816 GWA-----ANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYE 1870
            G+       ++ CRA  +P+ P+  LGQ V+C  + GLIC N++Q P        C NYE
Sbjct: 1612 GYTFCESPRSVQCRAESFPNTPLADLGQDVICSHTEGLICLNKNQLP------PICYNYE 1665

Query: 1871 INVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 1930
            I +QCCE            T N     T P  T  T  PTP PTG QT TT      +  
Sbjct: 1666 IRIQCCE------------TVNVCRDITRPPKTVATTRPTPHPTGAQTQTTFTTHMPSAS 1713

Query: 1931 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1990
            T  PT T    PT T +T  T  TP    T    P  T         P+P P G    T 
Sbjct: 1714 TEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFPSPGPHGGDKETY 1770

Query: 1991 TPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG-------TQTPTTT 2037
              I  +           T      ++     I     V       G        Q P   
Sbjct: 1771 NNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLVCRNQDQQGPFKM 1830

Query: 2038 PITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TPTTTPITTTTTVT 2092
             +     V    TP G   T TP T P T +   ++PT + +  Q + TTT +TT+TT T
Sbjct: 1831 CLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTST 1890

Query: 2093 PTPTPTGTQTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTTTTVTPTPTPTGTQTP 2149
            P       QT TT   TT+TT  PT   T    T+T + +P +TT+    TP+P  T + 
Sbjct: 1891 P-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTST 1943

Query: 2150 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTT--- 2205
             + P T+ T+   T T +   + TT+  TT+TT  PT + T + QT TT+  TT+TT   
Sbjct: 1944 ISAPTTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGP 2003

Query: 2206 -VTPTPTPT 2213
              TP+P PT
Sbjct: 2004 GTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 1945 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2004
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2005 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2064
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2065 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2118
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2119 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2171
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2172 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2231
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2232 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2284
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2285 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2333
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2334 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2390
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2391 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2446
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2447 TPTTTPITTTTT----VTPTPTPT 2466
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 1968 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2027
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2028 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2087
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2088 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2141
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2142 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2194
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2195 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2254
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2255 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2307
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2308 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2356
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2357 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2413
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2414 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2469
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2470 TPTTTPITTTTT----VTPTPTPT 2489
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2060 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2119
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2120 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2179
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2180 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2233
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2234 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2286
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2287 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2346
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2347 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2399
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2400 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2448
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2449 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2505
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2506 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2561
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2562 TPTTTPITTTTT----VTPTPTPT 2581
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2106 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2165
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2166 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2225
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2226 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2279
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2280 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2332
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2333 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2392
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2393 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2445
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2446 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2494
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2495 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2551
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2552 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 2609
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 2610 TTTPITTTTT----VTPTPTPT 2627
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2129 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2188
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2189 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2248
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2249 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2302
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2303 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2355
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2356 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2415
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2416 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2468
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2469 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2517
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2518 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2574
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2575 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2630
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2631 TPTTTPITTTTT----VTPTPTPT 2650
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2152 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2211
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2212 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2271
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2272 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2325
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2326 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2378
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2379 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2438
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2439 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2491
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2492 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2540
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2541 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2597
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2598 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2653
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2654 TPTTTPITTTTT----VTPTPTPT 2673
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2175 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2234
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2235 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2294
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2295 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2348
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2349 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2401
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2402 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2461
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2462 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2514
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2515 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2563
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2564 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2620
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2621 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 2678
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 2679 TTTPITTTTT----VTPTPTPT 2696
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2198 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2257
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2258 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2317
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2318 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2371
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2372 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2424
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2425 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2484
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2485 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2537
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2538 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2586
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2587 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2643
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2644 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2699
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2700 TPTTTPITTTTT----VTPTPTPT 2719
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2221 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2280
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2281 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2340
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2341 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2394
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2395 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2447
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2448 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2507
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2508 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2560
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2561 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2609
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2610 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2666
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2667 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2722
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2723 TPTTTPITTTTT----VTPTPTPT 2742
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2244 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2303
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2304 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2363
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2364 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2417
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2418 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2470
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2471 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2530
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2531 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2583
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2584 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2632
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2633 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2689
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2690 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 2747
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 2748 TTTPITTTTT----VTPTPTPT 2765
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2290 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2349
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2350 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2409
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2410 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2463
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2464 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2516
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2517 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2576
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2577 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2629
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2630 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2678
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2679 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2735
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2736 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 2793
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 2794 TTTPITTTTT----VTPTPTPT 2811
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2313 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2372
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2373 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2432
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2433 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2486
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2487 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2539
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2540 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2599
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2600 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2652
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2653 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2701
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2702 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2758
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2759 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2814
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2815 TPTTTPITTTTT----VTPTPTPT 2834
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2336 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2395
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2396 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2455
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2456 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2509
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2510 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2562
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2563 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2622
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2623 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2675
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2676 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2724
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2725 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2781
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2782 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 2839
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 2840 TTTPITTTTT----VTPTPTPT 2857
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2382 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2441
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2442 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2501
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2502 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2555
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2556 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2608
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2609 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2668
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2669 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2721
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2722 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2770
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2771 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2827
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2828 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 2885
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 2886 TTTPITTTTT----VTPTPTPT 2903
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2405 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2464
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2465 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2524
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2525 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2578
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2579 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2631
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2632 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2691
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2692 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2744
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2745 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2793
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2794 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2850
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2851 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2906
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2907 TPTTTPITTTTT----VTPTPTPT 2926
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2428 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2487
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2488 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2547
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2548 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2601
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2602 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2654
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2655 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2714
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2715 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2767
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2768 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2816
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2817 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2873
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2874 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 2931
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 2932 TTTPITTTTT----VTPTPTPT 2949
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2474 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2533
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2534 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2593
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2594 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2647
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2648 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2700
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2701 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2760
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2761 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2813
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2814 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2862
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2863 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2919
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2920 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 2975
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 2976 TPTTTPITTTTT----VTPTPTPT 2995
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2543 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2602
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2603 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2662
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2663 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2716
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2717 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2769
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2770 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2829
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2830 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2882
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2883 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2931
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2932 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 2988
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 2989 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3046
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3047 TTTPITTTTT----VTPTPTPT 3064
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2566 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2625
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2626 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2685
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2686 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2739
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2740 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2792
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2793 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2852
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2853 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2905
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2906 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2954
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2955 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3011
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3012 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3069
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3070 TTTPITTTTT----VTPTPTPT 3087
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2589 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2648
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2649 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2708
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2709 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2762
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2763 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2815
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2816 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2875
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2876 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2928
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2929 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 2977
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 2978 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3034
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3035 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3092
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3093 TTTPITTTTT----VTPTPTPT 3110
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2612 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2671
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2672 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2731
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2732 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2785
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2786 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2838
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2839 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2898
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2899 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2951
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2952 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3000
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3001 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3057
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3058 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3113
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3114 TPTTTPITTTTT----VTPTPTPT 3133
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2658 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2717
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2718 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2777
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2778 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2831
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2832 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2884
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2885 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2944
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2945 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 2997
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 2998 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3046
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3047 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3103
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3104 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3159
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3160 TPTTTPITTTTT----VTPTPTPT 3179
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2681 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2740
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2741 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2800
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2801 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2854
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2855 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2907
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 2908 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2967
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 2968 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3020
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3021 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3069
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3070 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3126
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3127 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3184
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3185 TTTPITTTTT----VTPTPTPT 3202
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2773 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2832
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2833 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2892
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2893 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2946
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2947 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 2999
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3000 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3059
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3060 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3112
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3113 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3161
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3162 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3218
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3219 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3276
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3277 TTTPITTTTT----VTPTPTPT 3294
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2796 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2855
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2856 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2915
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2916 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2969
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 2970 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3022
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3023 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3082
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3083 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3135
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3136 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3184
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3185 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3241
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3242 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3299
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3300 TTTPITTTTT----VTPTPTPT 3317
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2842 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2901
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2902 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2961
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2962 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3015
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3016 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3068
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3069 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3128
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3129 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3181
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3182 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3230
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3231 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3287
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3288 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3343
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3344 TPTTTPITTTTT----VTPTPTPT 3363
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 2865 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2924
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2925 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2984
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 2985 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3038
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3039 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3091
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3092 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3151
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3152 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3204
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3205 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3253
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3254 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3310
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3311 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3368
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3369 TTTPITTTTT----VTPTPTPT 3386
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 2888 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2947
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 2948 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3007
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3008 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3061
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3062 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3114
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3115 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3174
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3175 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3227
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3228 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3276
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3277 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3333
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3334 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3389
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3390 TPTTTPITTTTT----VTPTPTPT 3409
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 3003 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3062
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3063 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3122
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3123 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3176
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3177 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3229
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3230 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3289
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3290 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3342
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3343 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3391
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3392 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3448
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3449 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3506
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3507 TTTPITTTTT----VTPTPTPT 3524
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 3049 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3108
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3109 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3168
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3169 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3222
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3223 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3275
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3276 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3335
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3336 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3388
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3389 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3437
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3438 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3494
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3495 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3552
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3553 TTTPITTTTT----VTPTPTPT 3570
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 3072 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3131
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3132 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3191
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3192 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3245
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3246 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3298
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3299 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3358
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3359 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3411
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3412 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3460
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3461 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3517
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3518 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3573
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3574 TPTTTPITTTTT----VTPTPTPT 3593
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 3118 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3177
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3178 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3237
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3238 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3291
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3292 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3344
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3345 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3404
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3405 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3457
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3458 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3506
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3507 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3563
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3564 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3621
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3622 TTTPITTTTT----VTPTPTPT 3639
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 3141 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3200
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3201 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3260
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3261 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3314
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3315 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3367
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3368 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3427
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3428 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3480
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3481 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3529
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3530 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3586
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3587 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3642
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3643 TPTTTPITTTTT----VTPTPTPT 3662
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 3164 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3223
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3224 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3283
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3284 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3337
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3338 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3390
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3391 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3450
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3451 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3503
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3504 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3552
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3553 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3609
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3610 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3665
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3666 TPTTTPITTTTT----VTPTPTPT 3685
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 160/562 (28%), Positives = 215/562 (38%), Gaps = 66/562 (11%)

Query: 3187 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3246
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3247 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3306
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3307 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3360
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3361 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3413
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3414 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3473
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3474 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3526
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3527 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3575
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3576 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3632
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3633 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTP 3690
              TP+P  T +  + P TT+ T  PT + T   T +TT  P T+TT+   + T +  QT 
Sbjct: 1932 GNTPSPVPTTSTISAP-TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTS 1990

Query: 3691 TTTPITTTTT----VTPTPTPT 3708
            TT+  TT+TT     TP+P PT
Sbjct: 1991 TTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 3233 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3292
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3293 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3352
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3353 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3406
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3407 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3459
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3460 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3519
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3520 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3572
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3573 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3621
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3622 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3678
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3679 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3734
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3735 TPTTTPITTTTT----VTPTPTPT 3754
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 3279 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3338
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3339 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3398
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3399 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3452
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3453 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3505
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3506 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3565
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3566 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3618
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3619 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3667
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3668 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3724
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3725 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3780
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3781 TPTTTPITTTTT----VTPTPTPT 3800
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  142 bits (358), Expect = 9e-33
 Identities = 159/564 (28%), Positives = 216/564 (38%), Gaps = 70/564 (12%)

Query: 3302 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3361
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3362 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3421
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3422 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3475
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3476 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3528
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3529 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3588
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3589 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 3641
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 3642 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 3690
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 3691 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTTTTV 3747
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   T  TT   P +TT+  
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 3748 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVTPTPTPTGTQ 3803
              TP+P  T +  + P   TT++T  PT + T  PT++    P T+TT+   + T +  Q
Sbjct: 1932 GNTPSPVPTTSTISAP---TTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQ 1988

Query: 3804 TPTTTPITTTTT----VTPTPTPT 3823
            T TT+  TT+TT     TP+P PT
Sbjct: 1989 TSTTSAPTTSTTSGPGTTPSPVPT 2012



 Score =  141 bits (355), Expect = 2e-32
 Identities = 163/590 (27%), Positives = 223/590 (37%), Gaps = 84/590 (14%)

Query: 3716 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3775
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3776 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3835
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3836 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3889
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3890 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3942
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3943 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4002
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 4003 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 4055
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 4056 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 4104
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 4105 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 4164
            TTT +TT+TT TP       QT TT   TT+TT  PT   T      + P T TT+ +P 
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTT------SAPTTRTTSASPA 1925

Query: 4165 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTS 4224
             T +G    T +P+ TT+T++    PT + T  PT ++T+     TTS P   +++  TS
Sbjct: 1926 STTSGPGN-TPSPVPTTSTIS---APTTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTS 1981

Query: 4225 RSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPST 4274
             +TSSP T +T                  S PT  TT+  G T SP P+T
Sbjct: 1982 STTSSPQTSTT------------------SAPTTSTTSGPGTTPSPVPTT 2013



 Score =  139 bits (350), Expect = 7e-32
 Identities = 154/561 (27%), Positives = 215/561 (38%), Gaps = 64/561 (11%)

Query: 3670 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3729
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3730 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3789
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3790 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3843
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3844 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3896
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3897 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3956
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 3957 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 4009
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 4010 ------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG-----TQTP 4058
                  Q P    +     V    TP G       P+T+T    P+ TP+G     TQ+ 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGC------PVTSTPVTAPS-TPSGRAISPTQST 1871

Query: 4059 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTTTTV 4115
            ++   + TTT+  T T +  QT TT   TT+TT  PT   T    T+T + +P +TT+  
Sbjct: 1872 SSWQKSRTTTLVTTSTTSTPQTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGP 1931

Query: 4116 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPT 4174
              TP+P  T +  + P T+ T+   T T +   + TT+  TT+TT  PT + T + QT T
Sbjct: 1932 GNTPSPVPTTSTISAPTTSITSAPTTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTST 1991

Query: 4175 TTPITTTTT----VTPTPTPT 4191
            T+  TT+TT     TP+P PT
Sbjct: 1992 TSAPTTSTTSGPGTTPSPVPT 2012



 Score =  137 bits (346), Expect = 2e-31
 Identities = 164/574 (28%), Positives = 219/574 (38%), Gaps = 70/574 (12%)

Query: 3762 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3821
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3822 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3881
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3882 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3935
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3936 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 3988
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 3989 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4048
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 4049 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 4101
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 4102 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 4150
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 4151 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHTSTAPIAELT 4210
            TTT +TT+TT TP       QT TT   TT+TT  PT   T   + P T T++A  A  T
Sbjct: 1879 TTTLVTTSTTSTP-------QTSTTYAHTTSTTSAPTARTT---SAPTTRTTSASPAS-T 1927

Query: 4211 TSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSP 4270
            TS P    S   T+ + S+P T  T+      P    TS    ST +APTT++   T +P
Sbjct: 1928 TSGPGNTPSPVPTTSTISAPTTSITSA-----PTTSTTSAPTSSTTSAPTTST---TSAP 1979

Query: 4271 PPSTTTSPPGTPTRGTTTGSSSAP--TPSTVQTT 4302
              STT+SP  + T   TT ++S P  TPS V TT
Sbjct: 1980 TSSTTSSPQTSTTSAPTTSTTSGPGTTPSPVPTT 2013



 Score =  134 bits (336), Expect = 3e-30
 Identities = 164/575 (28%), Positives = 224/575 (38%), Gaps = 74/575 (12%)

Query: 3785 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3844
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3845 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3904
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3905 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3958
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 3959 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 4011
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 4012 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4071
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 4072 TPTPTGTQTPTTTPITTT------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT- 4124
            +P P G    T   I  +           T      ++     I     V       G  
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 4125 ------QTPTTTPITTTTTVTPTPTPTG---TQTPTTTPITTT-TTVTPTPTPTGTQ-TP 4173
                  Q P    +     V    TP G   T TP T P T +   ++PT + +  Q + 
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSR 1878

Query: 4174 TTTPITTTTTVTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTE 4233
            TTT +TT+TT TP  + T   T   T T++AP A  TTS P        T+R+TS+    
Sbjct: 1879 TTTLVTTSTTSTPQTSTTYAHT---TSTTSAPTAR-TTSAP--------TTRTTSASPAS 1926

Query: 4234 STTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSA 4293
            +T+     P  +  TST      +APTT+    T +P  STT++P  + T   TT ++SA
Sbjct: 1927 TTSGPGNTPSPVPTTSTI-----SAPTTSI---TSAPTTSTTSAPTSSTTSAPTTSTTSA 1978

Query: 4294 PTPSTV---QTTTTSAWTPTPT--PLSTPSIIRTT 4323
            PT ST    QT+TTSA T + T  P +TPS + TT
Sbjct: 1979 PTSSTTSSPQTSTTSAPTTSTTSGPGTTPSPVPTT 2013



 Score =  131 bits (329), Expect = 2e-29
 Identities = 80/186 (43%), Positives = 104/186 (55%), Gaps = 16/186 (8%)

Query: 1463 TPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPASTTTLPPTTT 1522
            TP      S P T PS P+     PT +T++   + T +  TT       STT+ P T+T
Sbjct: 1843 TPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTT-------STTSTPQTST 1895

Query: 1523 PSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTT-PSPP 1581
                TT+TT+ P   T S PTT   +   ++TT  P  TPSP PTT+T   PTT+  S P
Sbjct: 1896 TYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITSAP 1955

Query: 1582 TTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTP 1641
            TT+T S PT +TT+ P T+T S PT++TT+ P T+T S PTT+        TT  P TTP
Sbjct: 1956 TTSTTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTS--------TTSGPGTTP 2007

Query: 1642 SPPPTT 1647
            SP PTT
Sbjct: 2008 SPVPTT 2013



 Score =  129 bits (325), Expect = 6e-29
 Identities = 77/178 (43%), Positives = 103/178 (57%), Gaps = 9/178 (5%)

Query: 1487 PTTTTTTPPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTP 1546
            P     T  P T PS P+   I+P  ST++   + T +  TT+TT+ P T+T    TT+ 
Sbjct: 1844 PRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTST 1903

Query: 1547 ITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSP-PTTTTPSPPTITTTTPPPTTTPSPP 1605
             + PT+ TT  PTT  +     +TT  P  TPSP PTT+T S PT + T+ P T+T S P
Sbjct: 1904 TSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITSAPTTSTTSAP 1963

Query: 1606 TTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTT 1663
            T++TT+ P T+T S PT+       STT+ P T+T S P TT+TT  P TTPSP  TT
Sbjct: 1964 TSSTTSAPTTSTTSAPTS-------STTSSPQTSTTSAP-TTSTTSGPGTTPSPVPTT 2013



 Score =  128 bits (321), Expect = 2e-28
 Identities = 76/171 (44%), Positives = 97/171 (56%), Gaps = 4/171 (2%)

Query: 1457 PISTTTTPPPTTTPSPPTTTPSPPTTTPSP--PTTTTTTPPPTTTPSPPTTTPITPPAST 1514
            P     T  P T PS P+     PT + S    + TTT    +TT +P T+T      ST
Sbjct: 1844 PRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTST 1903

Query: 1515 TTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPP 1574
            T+ P   T S PTT TT+  P +T S P  TP   PT++T   PTT+ +  PTT+TT  P
Sbjct: 1904 TSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITSAPTTSTTSAP 1963

Query: 1575 TT-TPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTT 1624
            T+ T S PTT+T S PT +TT+ P T+T S PTT+TT+  P TTPSP  TT
Sbjct: 1964 TSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTS-GPGTTPSPVPTT 2013



 Score =  127 bits (319), Expect = 3e-28
 Identities = 130/523 (24%), Positives = 202/523 (38%), Gaps = 63/523 (12%)

Query: 4472 CWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPND 4531
            C    C   C+  G  H+ TFDG  Y+  G+C+YVL +    S   F V  +   C   D
Sbjct: 425  CQEVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSA--FTVLAELRRCGLTD 482

Query: 4532 KVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDI 4591
              +C +++ +  +     ++TV ++    +V +N+    LP     + +++    +++  
Sbjct: 483  SETCLKSVTLSLDG----VQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQ 538

Query: 4592 PELGVLVSYNGLSFSVRLPYHRFGNNTKGQ-CGTCTNTTS---DDCILPSGEIVSNCEAA 4647
              LG+ ++   L  +++L + +     +GQ CG C N  S   DD    SG +    EA 
Sbjct: 539  TSLGLQLNLQ-LVPTMQL-FMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVV----EAT 592

Query: 4648 ADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDS--LFAQCH 4705
            A  +     ++  CP+  ++ + P        K   H        C  + D+   F +CH
Sbjct: 593  AAAFFNTFKTQAACPNIRNSFEDPCSLSVENEKYAQH-------WCSQLTDADGPFGRCH 645

Query: 4706 ALVPPQHYYDACVFDSCFMPGS-SLECASLQAYAALCAQQNICL-DWRNHTHGACLVECP 4763
            A V P  YY  C+FD+C    S    CA+L +Y   CA + + L  WR+      +  CP
Sbjct: 646  AAVKPGTYYSNCMFDTCNCERSEDCLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCP 705

Query: 4764 SHREYQACGPAEEPTCKSSSSQQNNT----VLVEGCFCPEGTMNYAPGFDVCVKTCGCVG 4819
                Y       +PTC+S S          + V+GC CP+GT     G  V    C C  
Sbjct: 706  KSMTYHYHVSTCQPTCRSLSEGDITCSVGFIPVDGCICPKGTFLDDTGKCVQASNCPCYH 765

Query: 4820 PDN-VPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYL-ATEVNPAD 4877
              + +P   GE        C C  G    I       Q P   C     +       P D
Sbjct: 766  RGSMIPN--GESVHDSGAICTCTHGKLSCI-----GGQAPAPVCAAPMVFFDCRNATPGD 818

Query: 4878 T------CCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGNA 4931
            T       C+     C +  C     VCP G     +   G C     C     CVH  A
Sbjct: 819  TGAGCQKSCHTLDMTCYSPQC-VPGCVCPDGLVADGE---GGCITAEDCP----CVHNEA 870

Query: 4932 EYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCS 4974
             Y+ G  +    C  C C  +        +  CT  PC  +C+
Sbjct: 871  SYRAGQTIRVG-CNTCTCDSR--------MWRCTDDPCLATCA 904



 Score =  127 bits (318), Expect = 4e-28
 Identities = 77/181 (42%), Positives = 100/181 (55%), Gaps = 11/181 (6%)

Query: 1548 TPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTT 1607
            TP     T  P T PS P     +P  +T+    + TT    T TT+TP  +TT +  T+
Sbjct: 1843 TPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTS 1902

Query: 1608 TTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTT-PSPPTTTTPS 1666
            TT+ P   TT +P T T    P STT+  P  TPSP PTT+T   PTT+  S PTT+T S
Sbjct: 1903 TTSAPTARTTSAPTTRTTSASPASTTS-GPGNTPSPVPTTSTISAPTTSITSAPTTSTTS 1961

Query: 1667 PPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPT 1726
             P ++TT+ P T+T S+P         T+ TT SP T+ +S  TT+TT    TTPSP PT
Sbjct: 1962 APTSSTTSAPTTSTTSAP---------TSSTTSSPQTSTTSAPTTSTTSGPGTTPSPVPT 2012

Query: 1727 T 1727
            T
Sbjct: 2013 T 2013



 Score =  126 bits (317), Expect = 5e-28
 Identities = 72/171 (42%), Positives = 100/171 (58%), Gaps = 2/171 (1%)

Query: 1526 PTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPT-TTPSPPPTTTTTPPPTTTPSPPTTT 1584
            P     T  P T PS P+   I+P  ST++   + TT     +TT+TP  +TT +  T+T
Sbjct: 1844 PRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTST 1903

Query: 1585 TPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPP 1644
            T +P   TT+ P   TT + P +TT+ P  T +P P T+T   P TS T+ P T+T S P
Sbjct: 1904 TSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITSAPTTSTTSAP 1963

Query: 1645 PTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTT 1695
             ++TT+ P T+T S PT++T S P T+TT+ P T+T S P  TTPSP  TT
Sbjct: 1964 TSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGP-GTTPSPVPTT 2013



 Score =  125 bits (314), Expect = 1e-27
 Identities = 75/183 (40%), Positives = 100/183 (54%), Gaps = 12/183 (6%)

Query: 1561 TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP 1620
            TP   P T+T   P T PS P+    SP   T++     TT    T+TT+TP  +TT + 
Sbjct: 1843 TPRGCPVTST---PVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAH 1899

Query: 1621 PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT 1680
             T+T   P   TT+ P T T S  P +TT+ P  T    PTT+T S P T+ T+ P T+T
Sbjct: 1900 TTSTTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITSAPTTST 1959

Query: 1681 PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP 1740
             S+P ++T S PTT+ T+   ++T SSP T+TT+          PTT TT  P TTPSP 
Sbjct: 1960 TSAPTSSTTSAPTTSTTSAPTSSTTSSPQTSTTS---------APTTSTTSGPGTTPSPV 2010

Query: 1741 TTT 1743
             TT
Sbjct: 2011 PTT 2013



 Score =  122 bits (307), Expect = 7e-27
 Identities = 72/172 (41%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 1509 TPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTT 1568
            TP     T  P T PS P+    +P  +T+    + T     TSTT+ P T+T     T+
Sbjct: 1843 TPRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTS 1902

Query: 1569 TTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITP 1628
            TT+ P   T S PTT T S    +TT+ P  T    PTT+T + P T+  S PTT+  + 
Sbjct: 1903 TTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITSAPTTSTTSA 1962

Query: 1629 PTSTTTLPPTT-TPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTT 1679
            PTS+TT  PTT T S P ++TT+ P T+T S PTT+T S P  TT +P PTT
Sbjct: 1963 PTSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGP-GTTPSPVPTT 2013



 Score =  117 bits (292), Expect = 4e-25
 Identities = 73/171 (42%), Positives = 94/171 (54%), Gaps = 10/171 (5%)

Query: 1605 PTTTTTTPPPTTTPSPPTTTPITPPTST--------TTLPPTTTPSPPPTTTTTPPPTTT 1656
            P     T  P T PS P+   I+P  ST        TTL  T+T S P T+TT    T+T
Sbjct: 1844 PRGCPVTSTPVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAHTTST 1903

Query: 1657 PSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPS 1716
             S PT  T S P T TT+  P +T S P   TPSP  TT T  +PTT+ +S  TT+TT +
Sbjct: 1904 TSAPTARTTSAPTTRTTSASPASTTSGP-GNTPSPVPTTSTISAPTTSITSAPTTSTTSA 1962

Query: 1717 STTTPSPPPTTMTTPSPT-TTPSPPTTTMTTLPPTTTSSPLTTTPLPPSIT 1766
             T++ +  PTT TT +PT +T S P T+ T+ P T+T+S   TTP P   T
Sbjct: 1963 PTSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGPGTTPSPVPTT 2013



 Score =  114 bits (286), Expect = 2e-24
 Identities = 69/175 (39%), Positives = 98/175 (56%), Gaps = 4/175 (2%)

Query: 1585 TPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPP 1644
            TP    +T+T   P T PS P+    +P  +T+    + T     TSTT+ P T+T    
Sbjct: 1843 TPRGCPVTST---PVTAPSTPSGRAISPTQSTSSWQKSRTTTLVTTSTTSTPQTSTTYAH 1899

Query: 1645 PTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTT 1704
             T+TT+ P   T S PTT T S    +TT+ P  T    P T+T S PTT++T+ +PTT+
Sbjct: 1900 TTSTTSAPTARTTSAPTTRTTSASPASTTSGPGNTPSPVPTTSTISAPTTSITS-APTTS 1958

Query: 1705 PSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTT 1759
             +S  T++TT + TT+ +  PT+ TT SP T+ +   TT TT  P TT SP+ TT
Sbjct: 1959 TTSAPTSSTTSAPTTSTTSAPTSSTTSSPQTSTTSAPTTSTTSGPGTTPSPVPTT 2013



 Score =  111 bits (278), Expect = 2e-23
 Identities = 113/414 (27%), Positives = 167/414 (40%), Gaps = 63/414 (15%)

Query: 4472 CWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEE----ISPSVDNFGVYIDNYHC 4527
            C    C   C  +GD HY+TFDG  YS+ G+C Y LV+        + D+F V  +N  C
Sbjct: 894  CTDDPCLATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPC 953

Query: 4528 DPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINY 4587
                  +C + + +     E  +K  H    +V+V    ++  +PY      + Q GI  
Sbjct: 954  GTTG-TTCSKAIKIFLGGFE--LKLSH---GKVEVIGTDESQEVPY-----TIRQMGIYL 1002

Query: 4588 VVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAA 4647
            VVD     VL+     S  + L    F     G CG   +   +D    S  +V +    
Sbjct: 1003 VVDTDIGLVLLWDKKTSIFINLS-PEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEF 1061

Query: 4648 ADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHAL 4707
             + W ++    P CP  +   K P           P +       C ++    FA CHA 
Sbjct: 1062 GNSWKLS----PSCP-DALAPKDPCT-------ANPFRKSWAQKQCSILHGPTFAACHAH 1109

Query: 4708 VPPQHYYDACVFDSCFM-PGSSLE--CASLQAYAALCAQQNICLDWRNHTHGACLVECPS 4764
            V P  YY+ACV D+C    G   E  C ++ AYA  C +  +C+ WR  T   C + C  
Sbjct: 1110 VEPARYYEACVNDACACDSGGDCECFCTAVAAYAQACHEVGLCVSWR--TPSICPLFCDY 1167

Query: 4765 HR-------EYQACGPAEEPTCKSSSSQQNNTVL-VEGCF--CPEGTMNYAPGFD----V 4810
            +         YQ CG     TC++        V  +EGC+  CP      AP FD     
Sbjct: 1168 YNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDVWGLEGCYPKCPP----EAPIFDEDKMQ 1223

Query: 4811 CVKTCGCVGPDNVPR--EFGEHF--------EFDCKNCVCLEGGSGIICQPKRC 4854
            CV TC    P   PR    G+ +        + +C++C+C E G     + + C
Sbjct: 1224 CVATCPT--PPLPPRCHVHGKSYRPGAVVPSDKNCQSCLCTERGVECTYKAEAC 1275



 Score =  108 bits (271), Expect = 1e-22
 Identities = 110/402 (27%), Positives = 165/402 (41%), Gaps = 49/402 (12%)

Query: 4481 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLI 4540
            C+ WG  HY TFDG  + + G C YV  E    + ++F + +       + + + P    
Sbjct: 81   CSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNIQLRR-----SQESAAPTLSR 135

Query: 4541 VRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSY 4600
            V  +   V+I+       +  V VN   V LP+ + G+ + QS  +Y      LG+++ +
Sbjct: 136  VLMKVDGVVIQLT-----KGSVLVNGHPVLLPFSQSGVLIQQSS-SYTKVEARLGLVLMW 189

Query: 4601 NGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPH 4660
            N     +     ++ N T G CG          +L     ++  E    Q + +DP    
Sbjct: 190  NHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQKM-DDP---- 244

Query: 4661 CPHSSSTTKRPAVTVPGGGKTTPHKDC-TPSPLCQ-LIKDSLFAQCHALVPPQHYYDACV 4718
                   T++    VP      P ++C T   +C+ L+   LF+ C ALV    Y +AC 
Sbjct: 245  -------TEQCQDPVP-----EPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACR 292

Query: 4719 FDSCFMPGSSL---ECASLQAYAALCAQQN-ICLDWRNHTHGACLVECPSHREYQACGPA 4774
             D CF   + L    C +L  Y+  C     +  DWR      C  +CP++ +Y  C   
Sbjct: 293  QDLCFCEDTDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDF--CPQKCPNNMQYHECRSP 350

Query: 4775 EEPTCKSSS-SQQNNTVLVEGCFCPEGTMNYAPGFDVC--VKTCGCV--GPDNVPREFGE 4829
               TC +   S+      V GCFCPEGT+    G   C  V  C CV  G    P   G 
Sbjct: 351  CADTCSNQEHSRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAP---GA 407

Query: 4830 HFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLAT 4871
             +  DC NC C   G    CQ   C   P T  V  G + +T
Sbjct: 408  TYSTDCTNCTC--SGGRWSCQEVPC---PGTCSVLGGAHFST 444



 Score =  102 bits (255), Expect = 8e-21
 Identities = 147/572 (25%), Positives = 199/572 (34%), Gaps = 76/572 (13%)

Query: 3877 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3936
            TP+  +T+ +P  T     TP TT  TT T  + +  P+ T  P T  ++T  T     T
Sbjct: 1477 TPLACSTSSSPAQT-----TPPTTSKTTETRASGSSAPSST--PGTVSLSTARTTPAPGT 1529

Query: 3937 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3996
             T  +   +TP     +  P P  + +   TTTP T+  +  PT T   T +      T 
Sbjct: 1530 ATSVKKTFSTP-----SPPPVPATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQELCTW 1584

Query: 3997 TTTVT---PTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 4050
            T  +    P P   G    T   +     T   +P       ++   TP+          
Sbjct: 1585 TEWIDGSYPAPGINGGDFDTFQNLRDEGYTFCESPRSVQCRAESFPNTPLADLGQDVICS 1644

Query: 4051 TPTG------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQT 4103
               G       Q P   PI     +      T       T P  T  T  PTP PTG QT
Sbjct: 1645 HTEGLICLNKNQLP---PICYNYEIRIQCCETVNVCRDITRPPKTVATTRPTPHPTGAQT 1701

Query: 4104 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4163
             TT      +  T  PT T    PT T +T  T  TP    T    P  T         P
Sbjct: 1702 QTTFTTHMPSASTEQPTATSRGGPTATSVTQGTHTTPV---TRNCHPRCTWTKWFDVDFP 1758

Query: 4164 TPTPTGTQTPTTTPITTT-TTVTPTPTP-TGTQTGPPTHTSTAPIAELTTSNPPPESSTP 4221
            +P P G    T   I  +   +   P   T  Q    +H   +            E    
Sbjct: 1759 SPGPHGGDKETYNNIIRSGEKICRRPEEITRLQCRAKSHPEVSIEHLGQVVQCSREEGLV 1818

Query: 4222 QTSRSTSSPLT-----ESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPST-- 4274
              ++    P       E   L    P    +TST      TAP+T SG   +SP  ST  
Sbjct: 1819 CRNQDQQGPFKMCLNYEVRVLCCETPRGCPVTSTPV----TAPSTPSG-RAISPTQSTSS 1873

Query: 4275 ----------TTSPPGTPTRGTT----TGSSSAPTPSTVQTTTTSAWTPTPT-----PLS 4315
                      TTS   TP   TT    T ++SAPT  T    TT   + +P      P +
Sbjct: 1874 WQKSRTTTLVTTSTTSTPQTSTTYAHTTSTTSAPTARTTSAPTTRTTSASPASTTSGPGN 1933

Query: 4316 TPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWS 4375
            TPS + TT     P++ +       T  AP           T    +   + T      S
Sbjct: 1934 TPSPVPTTSTISAPTTSITSAPTTSTTSAP-----------TSSTTSAPTTSTTSAPTSS 1982

Query: 4376 CPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGT 4407
              S+P  + T + +T T S P +TPS P P T
Sbjct: 1983 TTSSPQTSTTSAPTTSTTSGPGTTPS-PVPTT 2013



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 70/305 (22%), Positives = 99/305 (32%), Gaps = 85/305 (27%)

Query: 4164 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGP-----PTHTSTAPIAELTTSN---PP 4215
            TP P  T + +T P+  ++T TP+  P+   TGP     PT   T+P   L T++   PP
Sbjct: 1322 TPVPPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPTASASLPP 1381

Query: 4216 ----------------PESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAP 4259
                            P   T      T   L      +   P ++E  +   P  P   
Sbjct: 1382 VCGEKCLWSPWMDVSRPGRGTDSGDFDTLENLRAHGYRVCESPRSVECRAEDAPGVPLRA 1441

Query: 4260 TTTSGGHTLSPPPSTTTSPPG------------------TPTRGTTTGSSSAPTPSTVQT 4301
                 G  +   P    +                     TP   +T+ S +  TP T   
Sbjct: 1442 L----GQRVQCSPDVGLTCRNREQASGLCYNYQIRVQCCTPLACSTSSSPAQTTPPTTSK 1497

Query: 4302 TTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFV 4361
            TT +  + +  P STP  +  +  R  P              APG               
Sbjct: 1498 TTETRASGSSAPSSTPGTVSLSTARTTP--------------APGTAT------------ 1531

Query: 4362 NCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPEC-PDFDPPRQ 4420
              S+  T         STPSP P P  +T T S  ++TP      +KP    P      Q
Sbjct: 1532 --SVKKTF--------STPSPPPVP--ATSTSSMSTTTPGTSVVSSKPTLTEPSTSSCLQ 1579

Query: 4421 ENETW 4425
            E  TW
Sbjct: 1580 ELCTW 1584



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 30/74 (40%), Positives = 36/74 (48%), Gaps = 8/74 (10%)

Query: 1596 PPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTT 1655
            P   TTP PPTT + + PP    S  T TP   P+S  T PP+   S  PTT  T P T 
Sbjct: 1317 PCSPTTPVPPTTFSFSTPPLVVSS--THTPSNGPSSAHTGPPS---SAWPTTAGTSPRTR 1371

Query: 1656 TPSPPTTTTPSPPI 1669
                PT +   PP+
Sbjct: 1372 L---PTASASLPPV 1382



 Score = 40.8 bits (94), Expect = 0.035
 Identities = 37/124 (29%), Positives = 47/124 (37%), Gaps = 19/124 (15%)

Query: 4851 PKRCSQKPVTHCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMV 4910
            P  C QK    C  +  Y       ADTC N    +     C      CP G  +     
Sbjct: 331  PDFCPQK----CPNNMQYHECRSPCADTCSNQEHSRACEDHCVAG-CFCPEGTVLDDIGQ 385

Query: 4911 PGRCCPFYWCESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCN 4970
             G C P     SK  CV+  A Y PG+  YS+ C +C C+            +C  VPC 
Sbjct: 386  TG-CVPV----SKCACVYNGAAYAPGA-TYSTDCTNCTCSG--------GRWSCQEVPCP 431

Query: 4971 TSCS 4974
             +CS
Sbjct: 432  GTCS 435



 Score = 40.4 bits (93), Expect = 0.046
 Identities = 56/197 (28%), Positives = 72/197 (36%), Gaps = 39/197 (19%)

Query: 4248 TSTAPPST---PTAPTTTSGGHTLSPPPSTT-TSPPGT--PTRGTTTGSSSAPT------ 4295
            T+  PP+T    T P   S  HT S  PS+  T PP +  PT   T+  +  PT      
Sbjct: 1321 TTPVPPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPTASASLP 1380

Query: 4296 PSTVQTTTTSAWTPTPTP--------LSTPSIIRTTGLRPYPSSVLICCVLNDTYYAP-- 4345
            P   +    S W     P          T   +R  G R   S   + C   D    P  
Sbjct: 1381 PVCGEKCLWSPWMDVSRPGRGTDSGDFDTLENLRAHGYRVCESPRSVECRAEDAPGVPLR 1440

Query: 4346 --GEEVY-NGTYGDTC------------YFVNCSLSCTLEFYNWSCPSTPSPTPTPSKST 4390
              G+ V  +   G TC            Y +       L     S P+  +P PT SK+T
Sbjct: 1441 ALGQRVQCSPDVGLTCRNREQASGLCYNYQIRVQCCTPLACSTSSSPAQTTP-PTTSKTT 1499

Query: 4391 PTPSKPSSTPSKPTPGT 4407
             T +  SS PS  TPGT
Sbjct: 1500 ETRASGSSAPSS-TPGT 1515



 Score = 36.2 bits (82), Expect = 0.87
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query: 1626 ITPPTSTTTLPPTTTP--SPPPTTTTTPPPTTTPSPPTTTTPSPPITTTT-TPPPTTTPS 1682
            + P + TT +PPTT    +PP   ++T  P+  PS   T  PS    TT  T P T  P+
Sbjct: 1315 VYPCSPTTPVPPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPT 1374

Query: 1683 SPITTTP 1689
            +  +  P
Sbjct: 1375 ASASLPP 1381



 Score = 33.1 bits (74), Expect = 7.4
 Identities = 30/92 (32%), Positives = 38/92 (41%), Gaps = 18/92 (19%)

Query: 4336 CVLNDTYYAPGEEVYNGTYGDT-CYFVNCSLSCTLEFYNWSCPSTPSPTPTP-SKSTP-- 4391
            C  N   + PG+ +Y+ T G   C    C  + T+E   + C  T    PT  S STP  
Sbjct: 1277 CTYNGQRFHPGDVIYHTTDGTGGCISARCGANGTIERRVYPCSPTTPVPPTTFSFSTPPL 1336

Query: 4392 ------TPSK-PSSTPSKP-------TPGTKP 4409
                  TPS  PSS  + P       T GT P
Sbjct: 1337 VVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSP 1368


>gi|91982772 mucin 17 [Homo sapiens]
          Length = 4493

 Score = 1214 bits (3142), Expect = 0.0
 Identities = 1094/3531 (30%), Positives = 1576/3531 (44%), Gaps = 589/3531 (16%)

Query: 1396 ITTPSPPTTTPSPPPTS--TTTLPPTTTPSPPTTTTTTPPPT--TTPSPPITTTTTPPPT 1451
            ++TP   +T  S  PT+  +TT+P +T     T  T+ P  T     S  IT  TTP   
Sbjct: 184  MSTPLTTSTQASSSPTTPESTTIPKSTNSEGSTPLTSMPASTMKVASSEAITLLTTPVEI 243

Query: 1452 TTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPP 1511
            +TP   IS   +  PTT   P  +  +P  +  S P T           S  +T   TP 
Sbjct: 244  STPVT-ISAQASSSPTTAEGPSLSNSAP--SGGSTPLTRMPLSVMLVVSSEASTLSTTPA 300

Query: 1512 ASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTT 1571
            A+     P  T +  +++ TT   T+ P+   T   TP TST         S   T + T
Sbjct: 301  ATNI---PVITSTEASSSPTTAEGTSIPTSTYTEGSTPLTSTPASTMPVATSEMSTLSIT 357

Query: 1572 PPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTT---TPSPPTTTPITP 1628
            P  T+T    +T   S PT    T   T+T S  +T  T  P +T     S  +TT   P
Sbjct: 358  PVDTSTLVTTSTEPSSLPTTAEATSMLTSTLSEGSTPLTNMPVSTILVASSEASTTSTIP 417

Query: 1629 PTSTTTLPPTTTPSPPPTTTT-TPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITT 1687
              S T +   +  S  PTT   T   T+TPS  +T   S P++TT   P  ++ +S ++T
Sbjct: 418  VDSKTFVTTASEASSSPTTAEDTSIATSTPSEGSTPLTSMPVSTT---PVASSEASNLST 474

Query: 1688 TPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTP--SPPTTTMT 1745
            TP    T +TT   T   SSP T       T+TPS   T +T+ S +T P  S   +T++
Sbjct: 475  TPVDSKTQVTTS--TEASSSPPTAEVNSMPTSTPSEGSTPLTSMSVSTMPVASSEASTLS 532

Query: 1746 TLP-----PTTTSSPLTTTPLPPSITP-PTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNF 1799
            T P     P TTSS  +++   P  T  PT +P   +TP T  +P+              
Sbjct: 533  TTPVDTSTPVTTSSEASSSSTTPEGTSIPTSTPSEGSTPLTN-MPVSTRLVVSSEASTTS 591

Query: 1800 HKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVV-CDVSVGLICKNEDQKPG 1858
              P  D+           +++ +   T  P     + G T+    VS  L+  +E     
Sbjct: 592  TTP-ADSNTFVTTSSEASSSSTTAEGTSMPTSTYSERGTTITSMSVSTTLVASSEASTLS 650

Query: 1859 GV-IPMAFCLNYEINVQCCECVTQPTTMTTTT-TENPTPPTTTPITTTTTV-----TPTP 1911
               +     +             + T+M T+T TE  TP T+ P+ TT        T + 
Sbjct: 651  TTPVDSNTPVTTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSMPVNTTLVASSEASTLST 710

Query: 1912 TPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 1964
            TP  T TP TT       P T      PT TP+   TP T+   + T +T +   T + T
Sbjct: 711  TPVDTSTPVTTSTEASSSPTTADGASMPTSTPSEGSTPLTSMPVSKTLLTSSEASTLSTT 770

Query: 1965 P--TTTPITTTTTVTPTPTPT-GTQTPTTTP-------ITTTTTVTPTPTPTGTQTPTT- 2013
            P  T+T ITT+T  + +PT T GT  P +TP        +   ++TP  +P  +   TT 
Sbjct: 771  PLDTSTHITTSTEASCSPTTTEGTSMPISTPSEGSPLLTSIPVSITPVTSPEASTLSTTP 830

Query: 2014 ----TPITTTTTVTPTPTPT-GTQTPTTT-----------PITTTTTVTP-----TPTPT 2052
                +P+TT+T V+ +PTP  GT  PT+T           P++TT   T      + TP 
Sbjct: 831  VDSNSPVTTSTEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTLVATSAISTLSTTPV 890

Query: 2053 GTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-- 2103
             T TP T       +P T+  T  PT TP    TP T+   +TT V  +   T + TP  
Sbjct: 891  DTSTPVTNSTEARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVD 950

Query: 2104 TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTP------------TPTGTQTPT 2150
            T+TP+TT+T  T +PT   GT  PT+TP   TT +T TP            T + T   +
Sbjct: 951  TSTPVTTSTEATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEASTLSTTPVDS 1010

Query: 2151 TTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2209
             TP+TT+T   +P PT  GT  PT+TP   +T +T  P        +TT + ++ T T +
Sbjct: 1011 NTPLTTSTEASSPPPTAEGTSMPTSTPSEGSTPLTRMPV-------STTMVASSETSTLS 1063

Query: 2210 PTPTGTQTPTTT---PITTTTTVTPTPTPTGTQTPTTTPIT----TTTTVTPTPTPTGTQ 2262
             TP  T TP TT     +++TT   T  PT T +  +TP+T    +T  V  +   T + 
Sbjct: 1064 TTPADTSTPVTTYSQASSSSTTADGTSMPTSTYSEGSTPLTSVPVSTRLVVSSEASTLST 1123

Query: 2263 TP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2319
            TP  T+ P+TT+T  + +PT   GT  PT+ P   TT +   P  T     T    +   
Sbjct: 1124 TPVDTSIPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVST-----TLVVSSEAN 1178

Query: 2320 TVTPTPTPTGTQTPTTT-----PITTTTTVTPTPTPTGTQTPTT------TPITTTTTVT 2368
            T++ TP  + TQ  T+T     P T   T  PT TP    TP T      TP+ ++   T
Sbjct: 1179 TLSTTPVDSKTQVATSTEASSPPPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEAST 1238

Query: 2369 PTPTPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPIT----TTTTVTPTPTPTG 2421
             + +P  T TP TT   T+   TT   T  PT T +  +T +T    +TT VT     T 
Sbjct: 1239 LSTSPVDTSTPVTTSAETSSSPTTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEASTL 1298

Query: 2422 TQTPTTT--PITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------ 2466
              TP  T  P+ T+  V+ +PTP  GT  PT+T     T +T  P  T            
Sbjct: 1299 LTTPVDTKGPVVTSNEVSSSPTPAEGTSMPTSTYSEGRTPLTSIPVNTTLVASSAISILS 1358

Query: 2467 GTQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2525
             T    +TP+TT+T    +PT + GT  P + P   TT +T  P        +TTP+ ++
Sbjct: 1359 TTPVDNSTPVTTSTEACSSPTTSEGTSMPNSNPSEGTTPLTSIPV-------STTPVVSS 1411

Query: 2526 TTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTPTP 2578
               T + TP  T TP TT    T++ T       PT TP+  +TP  +   + T V  + 
Sbjct: 1412 EASTLSATPVDTSTPGTTSAEATSSPTTAEGISIPTSTPSEGKTPLKSIPVSNTPVANSE 1471

Query: 2579 TPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT-QTPTT 2634
              T + TP  + +P+ T+T V+ +PTP  GT    +TP   +T +T  P  T T  +   
Sbjct: 1472 ASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSIAISTPSEGSTALTSIPVSTTTVASSEI 1531

Query: 2635 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITT-------T 2686
              ++TT  VT TP  T +Q  +++P T   T   T T +   TP T+ P++T        
Sbjct: 1532 NSLSTTPAVTSTPVTTYSQA-SSSPTTADGTSMQTSTYSEGSTPLTSLPVSTMLVVSSEA 1590

Query: 2687 TTVTPTPTPTGTQTPTTTPITTTTT-----VTPTPTPTGTQTPTTTPITTTTTVTP-TPT 2740
             T++ TP  + TQ   +T  +++TT     +T +    G+   T+ P++TT   +P   T
Sbjct: 1591 NTLSTTPIDSKTQVTASTEASSSTTAEGSSMTISTPSEGSPLLTSIPVSTTPVASPEAST 1650

Query: 2741 PTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTT------TPITT----TTTVTPTPTPTG 2789
             + T   + +P+ T+T V+ +PTP  GT  PT+      TP+T+    TT V  +   T 
Sbjct: 1651 LSTTPVDSNSPVITSTEVSSSPTPAEGTSMPTSTYTEGRTPLTSITVRTTPVASSAISTL 1710

Query: 2790 TQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------ 2834
            + TP   +TP+TT+T    +PT + GT  P +TP   TT +T  P  T            
Sbjct: 1711 STTPVDNSTPVTTSTEARSSPTTSEGTSMPNSTPSEGTTPLTSIPVSTTPVLSSEASTLS 1770

Query: 2835 GTQTPTTTPITTTTTVTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQ 2883
             T   T+TP+TT+T  T +PT       PT T +   TP+T+T    T V  +   T + 
Sbjct: 1771 ATPIDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGMTPLTSTPVSHTLVANSEASTLST 1830

Query: 2884 TP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTT 2939
            TP  + +P+ T+T V+ +PTP  GT   T+TP   +T +T  P  T T  +  T  ++TT
Sbjct: 1831 TPVDSNSPVVTSTAVSSSPTPAEGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLSTT 1890

Query: 2940 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTV-----TPTPT 2993
              VT TP  T  Q  +++P T   +  PT TP   + P T+ P++TTT       T + T
Sbjct: 1891 PAVTSTPVTTYAQV-SSSPTTADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTT 1949

Query: 2994 PTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3046
               T+TP TT       P T   T  PTP  +   TP T+   +TT V  +   T + TP
Sbjct: 1950 LADTRTPVTTYSQASSSPTTADGTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTTP 2009

Query: 3047 --TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT------QTPTTTPI 3097
              T+TP TT+T  + +PT   GT   T+TP   TT +   P  T         T +TTP+
Sbjct: 2010 VDTSTPATTSTEGSSSPTTAGGTSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTPV 2069

Query: 3098 TTTTTVTPTPTPTGTQTP-----------------TTTPITTTTTVTP-TPTPTGTQTPT 3139
             + T VT +   + + T                  T+ P++TT   +P   T + T   +
Sbjct: 2070 DSKTQVTNSTEASSSATAEGSSMTISAPSEGSPLLTSIPLSTTPVASPEASTLSTTPVDS 2129

Query: 3140 TTPITTTTTVTPTPTPT-GT----------QTPTTTPITTTTTVTPTPTPTGTQTP--TT 3186
             +P+ T+T V+ +P PT GT          +TP T+   +TT V  +   T + TP  T+
Sbjct: 2130 NSPVITSTEVSSSPIPTEGTSMQTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDTS 2189

Query: 3187 TPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTT 3233
            TP+T +T    +PT + GT  PT+TP   +T  T  P  T             T   T+T
Sbjct: 2190 TPVTNSTEARSSPTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTST 2249

Query: 3234 PITTTTTVTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTP 3280
            P+TT+T  T +PT       PT T +  TTP+T+     T V  +   T + TP  + TP
Sbjct: 2250 PVTTSTEATSSPTTAEGTSIPTSTLSEGTTPLTSIPVSHTLVANSEVSTLSTTPVDSNTP 2309

Query: 3281 ITTTTTV-TPTPTPTGTQTPTTT-----------PITTT-----TTVTPTPTPTGTQTPT 3323
             TT+T   +P PT  GT  PT+T           P++TT      T T + TP  T TP 
Sbjct: 2310 FTTSTEASSPPPTAEGTSMPTSTSSEGNTPLTRMPVSTTMVASFETSTLSTTPADTSTPV 2369

Query: 3324 TT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPIT 3374
            TT       P T   T  PT T +   TP T+   +T  V  +   T + TP  T+TP+T
Sbjct: 2370 TTYSQAGSSPTTADDTSMPTSTYSEGSTPLTSVPVSTMPVVSSEASTHSTTPVDTSTPVT 2429

Query: 3375 TTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3433
            T+T  + +PT   GT  PT+ P   TT +   P        +TTP+ ++   T + TP  
Sbjct: 2430 TSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPV-------STTPVVSSEAGTLSTTPVD 2482

Query: 3434 TQTPTTT-------PITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTP-TPTPTGTQTPT 3484
            T TP TT       P T    V P  T + G+   T+ P++TT   +P   T + T   +
Sbjct: 2483 TSTPMTTSTEASSSPTTAEDIVVPISTASEGSTLLTSIPVSTTPVASPEASTLSTTPVDS 2542

Query: 3485 TTPITTTTTVTPTPTPT-GTQTPTTT----------------PITTTTTVTPTPTPTGTQ 3527
             +P+ T+T ++ + T   GT  PT+T                P+ ++   T + TP  T 
Sbjct: 2543 NSPVVTSTEISSSATSAEGTSMPTSTYSEGSTPLRSMPVSTKPLASSEASTLSTTPVDTS 2602

Query: 3528 TPTTTPITTT---TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3584
             P TT   T+   TT   T  P  T +  +T +T+    T     +   T +TTP+ T T
Sbjct: 2603 IPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILVSTMPVASSEASTLSTTPVDTRT 2662

Query: 3585 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3644
             VT   T TGT   +++P T   +  PT TP    TP T  + +TT +  +   T + TP
Sbjct: 2663 LVT---TSTGT---SSSPTTAEGSSMPTSTPGERSTPLTNILVSTTLLANSEASTLSTTP 2716

Query: 3645 --TTTPITTTTTVTPTP-----------TPTGTQTP------TTTPITTTTTVTPTPTPT 3685
              T+TP+TT+   + +P           TP+   TP      +T P+ ++   T + T  
Sbjct: 2717 VDTSTPVTTSAEASSSPTTAEGTSMRISTPSDGSTPLTSILVSTLPVASSEASTVSTTAV 2776

Query: 3686 GTQTPTTT-------PITTTTTVTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTG 3732
             T  P TT       P T   T  PT TP+ T TP T      TP+ ++   T + TP  
Sbjct: 2777 DTSIPVTTSTEASSSPTTAEVTSMPTSTPSETSTPLTSMPVNHTPVASSEAGTLSTTPVD 2836

Query: 3733 TQTPTTT-------PITTTTTVTPTPTPTGTQT------PTTTPITTTTTVTPTPTPTGT 3779
            T TP TT       P T    V P  T +   T       +TTP+ ++   T + TP  T
Sbjct: 2837 TSTPVTTSTKASSSPTTAEGIVVPISTASEGSTLLTSIPVSTTPVASSEASTLSTTPVDT 2896

Query: 3780 QTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTV------TPTPTPTGTQ 3826
              P TT       P T   T  P  TP+   TP T+ + +T  V      T + TP  T+
Sbjct: 2897 SIPVTTSTEGSSSPTTAEGTSMPISTPSEVSTPLTSILVSTVPVAGSEASTLSTTPVDTR 2956

Query: 3827 TPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTT 3877
            TP TT       P T   T  P  TP   +TP T+   +T  V  +   T ++TP  T+T
Sbjct: 2957 TPVTTSAEASSSPTTAEGTSMPISTPGERRTPLTSMSVSTMPVASSEASTLSRTPADTST 3016

Query: 3878 PITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTP 3924
            P+TT+T  + +PT   GT  P +TP   +T +T  P  T             T   + +P
Sbjct: 3017 PVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTSIPVSTTPVAIPEASTLSTTPVDSNSP 3076

Query: 3925 ITTTTTVTPTPTPT-GTQTPT------TTPIT----TTTTVTPTPTPTGTQTP--TTTPI 3971
            + T+T V+ +PTP  GT  P       +TP+T    +TT VT +   T + TP  T+TP+
Sbjct: 3077 VVTSTEVSSSPTPAEGTSMPISTYSEGSTPLTGVPVSTTPVTSSAISTLSTTPVDTSTPV 3136

Query: 3972 TTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPIT 4018
            TT+T    +PT + GT  PT+TP   +T +T  P  T             T   T+TP+T
Sbjct: 3137 TTSTEAHSSPTTSEGTSMPTSTPSEGSTPLTYMPVSTMLVVSSEDSTLSATPVDTSTPVT 3196

Query: 4019 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP----------------TPTGTQTPTTT- 4061
            T+T  T + T  GT  PT+TP    T +T  P                TP  + TP TT 
Sbjct: 3197 TSTEATSSTTAEGTSIPTSTPSEGMTPLTSVPVSNTPVASSEASILSTTPVDSNTPLTTS 3256

Query: 4062 ------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTT 4113
                  P T   T  PT TP+   TP T+   +TTTV  + T T + TP  T+TP+TT +
Sbjct: 3257 TEASSSPPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYS 3316

Query: 4114 TVTPTP-------TPTGTQTPTTTPIT----TTTTVTPTPTPTGTQTP--TTTPITTTTT 4160
              + +P        PT T +  +TP+T    +TT V  +   T + TP  T+TP+TT+T 
Sbjct: 3317 QASSSPPIADGTSMPTSTYSEGSTPLTNMSFSTTPVVSSEASTLSTTPVDTSTPVTTSTE 3376

Query: 4161 VTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHT-STAPIAELTTSNPPPE- 4217
             + +PT   GT  PT++P   TT +   P  T        +T ST P+   T      E 
Sbjct: 3377 ASLSPTTAEGTSIPTSSPSEGTTPLASMPVSTTPVVSSEVNTLSTTPVDSNTLVTTSTEA 3436

Query: 4218 SSTPQTSRSTSSPLTE----STTL----LSTLPPAIEMTST--APPSTPTAPTTTSGGHT 4267
            SS+P  +  TS P +     ST L    LST P A    ST    P   + P TTS    
Sbjct: 3437 SSSPTIAEGTSLPTSTTSEGSTPLSIMPLSTTPVASSEASTLSTTPVDTSTPVTTSSPTN 3496

Query: 4268 LSPPPSTTTSPP------------GTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLS 4315
             SP  +  TS P              P   T   SS A T ST    + +  T +    S
Sbjct: 3497 SSPTTAEVTSMPTSTAGEGSTPLTNMPVSTTPVASSEASTLSTTPVDSNTFVTSSSQASS 3556

Query: 4316 TPSIIRTTGLR----PYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEF 4371
            +P+ ++ T +R       SS L   +L+ TY    E                        
Sbjct: 3557 SPATLQVTTMRMSTPSEGSSSLTTMLLSSTYVTSSEA----------------------- 3593

Query: 4372 YNWSCPSTPS-------PTPTPSKSTPTPSK----PSSTPSK-PTPGTKPP 4410
               S PSTPS        T T S STPTP +    P STPS+  TP T  P
Sbjct: 3594 ---STPSTPSVDRSTPVTTSTQSNSTPTPPEVITLPMSTPSEVSTPLTIMP 3641



 Score = 1213 bits (3138), Expect = 0.0
 Identities = 1142/3704 (30%), Positives = 1642/3704 (44%), Gaps = 716/3704 (19%)

Query: 1391 PMDKCITTPSPPTTTPSPPPTSTTTLPPTT-TPSPPTTTTTTPPPTTTPSPPITTTTTPP 1449
            P+   +   S  +TT + P  S T +   +   S PTT   T   T+TPS   T  T+ P
Sbjct: 399  PVSTILVASSEASTTSTIPVDSKTFVTTASEASSSPTTAEDTSIATSTPSEGSTPLTSMP 458

Query: 1450 PTTTP---SPPISTTTTPPPTTTP---------SPPTT-TPSPPTTTPSPPTTTTTTPPP 1496
             +TTP   S   + +TTP  + T          SPPT    S PT+TPS  +T  T+   
Sbjct: 459  VSTTPVASSEASNLSTTPVDSKTQVTTSTEASSSPPTAEVNSMPTSTPSEGSTPLTSMSV 518

Query: 1497 TTTP--SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTT 1554
            +T P  S   +T  T P  T+T  P TT S  ++++TTP  T   S PT+TP    T  T
Sbjct: 519  STMPVASSEASTLSTTPVDTST--PVTTSSEASSSSTTPEGT---SIPTSTPSEGSTPLT 573

Query: 1555 TLPPTT---TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTT 1611
             +P +T     S   TT+TTP  + T    ++   S  T    T  PT+T S   TT T+
Sbjct: 574  NMPVSTRLVVSSEASTTSTTPADSNTFVTTSSEASSSSTTAEGTSMPTSTYSERGTTITS 633

Query: 1612 PPPTTT------PSPPTTTPITPPTSTTTLPPTTTPSPP------PTTTTTPPPTTTPSP 1659
               +TT       S  +TTP+   T  TT    T+ S        PT+T T   T   S 
Sbjct: 634  MSVSTTLVASSEASTLSTTPVDSNTPVTTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSM 693

Query: 1660 PTTTT---PSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPS---SPITTTT 1713
            P  TT    S   T +TTP  T+TP +  T   S PTT      PT+TPS   +P+T+  
Sbjct: 694  PVNTTLVASSEASTLSTTPVDTSTPVTTSTEASSSPTTADGASMPTSTPSEGSTPLTSMP 753

Query: 1714 TPSSTTTPSPPPTTMTTPSPTTTP---------SPPTTTMTTLPPTTTS--SPLTTTPLP 1762
               +  T S   T  TTP  T+T          SP TT  T++P +T S  SPL T+ +P
Sbjct: 754  VSKTLLTSSEASTLSTTPLDTSTHITTSTEASCSPTTTEGTSMPISTPSEGSPLLTS-IP 812

Query: 1763 PSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANIS 1822
             SITP T SP ++T  TTP          +DS  P        TE+      P  A   S
Sbjct: 813  VSITPVT-SPEASTLSTTP----------VDSNSP----VTTSTEVSSS---PTPAEGTS 854

Query: 1823 CRATMYPD--VPIGQL--GQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCEC 1878
               + Y +   P+  +    T+V   ++  +           +  +  +      +    
Sbjct: 855  MPTSTYSEGRTPLTSMPVSTTLVATSAISTLSTTP-------VDTSTPVTNSTEARSSPT 907

Query: 1879 VTQPTTMTTTTT-ENPTPPTTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPTPTP 1936
             ++ T+M T+T  E  TP T+ P +TT  V+    T + T   T+TP+TT+T  T +PT 
Sbjct: 908  TSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVDTSTPVTTSTEATSSPTT 967

Query: 1937 T-GTQTPTTTPITTTTTVTPTP------------TPTGTQTPTTTPITTTTTVT-PTPTP 1982
              GT  PT+TP   TT +T TP            T + T   + TP+TT+T  + P PT 
Sbjct: 968  AEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEASTLSTTPVDSNTPLTTSTEASSPPPTA 1027

Query: 1983 TGTQTPTTTPI----------TTTTTVTPTPTPTGTQTP--TTTPITT-------TTTVT 2023
             GT  PT+TP            +TT V  + T T + TP  T+TP+TT       +TT  
Sbjct: 1028 EGTSMPTSTPSEGSTPLTRMPVSTTMVASSETSTLSTTPADTSTPVTTYSQASSSSTTAD 1087

Query: 2024 PTPTPTGTQTPTTTPITT----TTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-G 2076
             T  PT T +  +TP+T+    T  V  +   T + TP  T+ P+TT+T  + +PT   G
Sbjct: 1088 GTSMPTSTYSEGSTPLTSVPVSTRLVVSSEASTLSTTPVDTSIPVTTSTEASSSPTTAEG 1147

Query: 2077 TQTPTTTPITTTT------------------TVTPTPTPTGTQTPTTT-----PITTTTT 2113
            T  PT+ P   TT                  T++ TP  + TQ  T+T     P T   T
Sbjct: 1148 TSIPTSPPSEGTTPLASMPVSTTLVVSSEANTLSTTPVDSKTQVATSTEASSPPPTAEVT 1207

Query: 2114 VTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTGTQTPTTTPITTT---TTVTPTP 2164
              PT TP    TP T      TP+ ++   T + +P  T TP TT   T+   TT   T 
Sbjct: 1208 SMPTSTPGERSTPLTSMPVRHTPVASSEASTLSTSPVDTSTPVTTSAETSSSPTTAEGTS 1267

Query: 2165 TPTGTQTPTTTPITT----TTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPT-GTQT 2217
             PT T +  +T +T+    TT VT     T   TP  T  P+ T+  V+ +PTP  GT  
Sbjct: 1268 LPTSTTSEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKGPVVTSNEVSSSPTPAEGTSM 1327

Query: 2218 PTTT-----------PITTTTTVTP-----TPTPTGTQTPTTT-------PITTTTTVTP 2254
            PT+T           P+ TT   +      + TP    TP TT       P T+  T  P
Sbjct: 1328 PTSTYSEGRTPLTSIPVNTTLVASSAISILSTTPVDNSTPVTTSTEACSSPTTSEGTSMP 1387

Query: 2255 TPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PT 2301
               P+   TP      +TTP+ ++   T + TP  T TP TT    T++ T       PT
Sbjct: 1388 NSNPSEGTTPLTSIPVSTTPVVSSEASTLSATPVDTSTPGTTSAEATSSPTTAEGISIPT 1447

Query: 2302 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTT 2358
             TP+  +TP  +   + T V  +   T + TP  + +P+ T+T V+ +PTP  GT    +
Sbjct: 1448 STPSEGKTPLKSIPVSNTPVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSIAIS 1507

Query: 2359 TPITTTTTVTPTPTPTGT----------QTP--TTTPITTTTTVTPTPTP-------TGT 2399
            TP   +T +T  P  T T           TP  T+TP+TT +  + +PT        T T
Sbjct: 1508 TPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTSTPVTTYSQASSSPTTADGTSMQTST 1567

Query: 2400 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP----------------TPT 2443
             +  +TP+T+    T     +   T +TTPI + T VT +                 TP+
Sbjct: 1568 YSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDSKTQVTASTEASSSTTAEGSSMTISTPS 1627

Query: 2444 -GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTTT--- 2497
             G+   T+ P++TT   +P   T + T   + +P+ T+T V+ +PTP  GT  PT+T   
Sbjct: 1628 EGSPLLTSIPVSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPTPAEGTSMPTSTYTE 1687

Query: 2498 ---PITT----TTTVTPTPTPTGTQTPT--TTPITTTTTVTPTPTPT-GTQTPTTTPITT 2547
               P+T+    TT V  +   T + TP   +TP+TT+T    +PT + GT  P +TP   
Sbjct: 1688 GRTPLTSITVRTTPVASSAISTLSTTPVDNSTPVTTSTEARSSPTTSEGTSMPNSTPSEG 1747

Query: 2548 TTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPT-------PTGTQTPTT 2588
            TT +T  P  T             T   T+TP+TT+T  T +PT       PT T +   
Sbjct: 1748 TTPLTSIPVSTTPVLSSEASTLSATPIDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGM 1807

Query: 2589 TPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTT 2641
            TP+T+T    T V  +   T + TP  + +P+ T+T V+ +PTP  GT   T+TP   +T
Sbjct: 1808 TPLTSTPVSHTLVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSIATSTPSEGST 1867

Query: 2642 TVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2700
             +T  P  T T   + T  ++TT  VT TP  T  Q  +++P T   +  PT TP   + 
Sbjct: 1868 ALTSIPVSTTTVASSETNTLSTTPAVTSTPVTTYAQV-SSSPTTADGSSMPTSTPREGRP 1926

Query: 2701 PTTT-PITTTTTV-----TPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTP 2747
            P T+ P++TTT       T + T   T+TP TT       P T   T  PTP  +   TP
Sbjct: 1927 PLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSPTTADGTSMPTPAYSEGSTP 1986

Query: 2748 TTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTV 2804
             T+   +TT V  +   T + TP  T+TP TT+T  + +PT  G T   T+TP   TT +
Sbjct: 1987 LTSMPLSTTLVVSSEASTLSTTPVDTSTPATTSTEGSSSPTTAGGTSIQTSTPSERTTPL 2046

Query: 2805 TPTPTPTGT------QTPTTTPITTTTTVTPTPTPTGTQTP-----------------TT 2841
               P  T         T +TTP+ + T VT +   + + T                  T+
Sbjct: 2047 AGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNSTEASSSATAEGSSMTISAPSEGSPLLTS 2106

Query: 2842 TPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GT----------QTPTTTP 2889
             P++TT   +P   T + T   + +P+ T+T V+ +P PT GT          +TP T+ 
Sbjct: 2107 IPLSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPIPTEGTSMQTSTYSDRRTPLTSM 2166

Query: 2890 ITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTP 2946
              +TT V  +   T + TP  T+TP+T +T    +PT + GT  PT+TP   +T  T  P
Sbjct: 2167 PVSTTVVASSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPSEGSTPFTSMP 2226

Query: 2947 TPT------------GTQTPTTTPITTTTTVTPTPT-------PTGTQTPTTTPITTT-- 2985
              T             T   T+TP+TT+T  T +PT       PT T +  TTP+T+   
Sbjct: 2227 VSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGTTPLTSIPV 2286

Query: 2986 --TTVTPTPTPTGTQTP--TTTPITTTTTVT-PTPTPTGTQTPTTT-----------PIT 3029
              T V  +   T + TP  + TP TT+T  + P PT  GT  PT+T           P++
Sbjct: 2287 SHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMPTSTSSEGNTPLTRMPVS 2346

Query: 3030 TTT-----TVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTT 3077
            TT      T T + TP  T TP TT       P T   T  PT T +   TP T+   +T
Sbjct: 2347 TTMVASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPTSTYSEGSTPLTSVPVST 2406

Query: 3078 TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTG 3134
              V  +   T + TP  T+TP+TT+T  + +PT   GT  PT+ P   TT +   P  T 
Sbjct: 2407 MPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVSTT 2466

Query: 3135 ------------TQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTT 3170
                        T   T+TP+TT+T  + +PT              G+   T+ P++TT 
Sbjct: 2467 PVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTAEDIVVPISTASEGSTLLTSIPVSTTP 2526

Query: 3171 TVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTTT----------------PI 3212
              +P   T + T   + +P+ T+T ++ + T   GT  PT+T                P+
Sbjct: 2527 VASPEASTLSTTPVDSNSPVVTSTEISSSATSAEGTSMPTSTYSEGSTPLRSMPVSTKPL 2586

Query: 3213 TTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTT------PIT 3259
             ++   T + TP  T  P TT       P T   T  P  TP+   T  T+      P+ 
Sbjct: 2587 ASSEASTLSTTPVDTSIPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILVSTMPVA 2646

Query: 3260 TTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTP 3312
            ++   T + TP  T+T  TT   T+++ T       PT TP    TP T  + +TT +  
Sbjct: 2647 SSEASTLSTTPVDTRTLVTTSTGTSSSPTTAEGSSMPTSTPGERSTPLTNILVSTTLLAN 2706

Query: 3313 TPTPTGTQTP--TTTPITTTTTVTPTPT-----------PTGTQTPTTT------PITTT 3353
            +   T + TP  T+TP+TT+   + +PT           P+   TP T+      P+ ++
Sbjct: 2707 SEASTLSTTPVDTSTPVTTSAEASSSPTTAEGTSMRISTPSDGSTPLTSILVSTLPVASS 2766

Query: 3354 TTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTT------TPITTTT 3400
               T + T   T  P TT       P T   T  PT TP+ T TP T      TP+ ++ 
Sbjct: 2767 EASTVSTTAVDTSIPVTTSTEASSSPTTAEVTSMPTSTPSETSTPLTSMPVNHTPVASSE 2826

Query: 3401 TVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQT------PTTTPITTTTT 3447
              T + TP  T TP TT       P T    V P  T +   T       +TTP+ ++  
Sbjct: 2827 AGTLSTTPVDTSTPVTTSTKASSSPTTAEGIVVPISTASEGSTLLTSIPVSTTPVASSEA 2886

Query: 3448 VTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTV------ 3494
             T + TP  T  P TT       P T   T  P  TP+   TP T+ + +T  V      
Sbjct: 2887 STLSTTPVDTSIPVTTSTEGSSSPTTAEGTSMPISTPSEVSTPLTSILVSTVPVAGSEAS 2946

Query: 3495 TPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 3547
            T + TP  T+TP TT       P T   T  P  TP   +TP T+   +T  V  +   T
Sbjct: 2947 TLSTTPVDTRTPVTTSAEASSSPTTAEGTSMPISTPGERRTPLTSMSVSTMPVASSEAST 3006

Query: 3548 GTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTG---------- 3594
             ++TP  T+TP+TT+T  + +PT   GT  P +TP   +T +T  P  T           
Sbjct: 3007 LSRTPADTSTPVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTSIPVSTTPVAIPEASTL 3066

Query: 3595 --TQTPTTTPITTTTTVTPTPTPT-GTQTPTTT------PIT----TTTTVTPTPTPTGT 3641
              T   + +P+ T+T V+ +PTP  GT  P +T      P+T    +TT VT +   T +
Sbjct: 3067 STTPVDSNSPVVTSTEVSSSPTPAEGTSMPISTYSEGSTPLTGVPVSTTPVTSSAISTLS 3126

Query: 3642 QTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------G 3686
             TP  T+TP+TT+T    +PT + GT  PT+TP   +T +T  P  T             
Sbjct: 3127 TTPVDTSTPVTTSTEAHSSPTTSEGTSMPTSTPSEGSTPLTYMPVSTMLVVSSEDSTLSA 3186

Query: 3687 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP----------------TP 3730
            T   T+TP+TT+T  T + T  GT  PT+TP    T +T  P                TP
Sbjct: 3187 TPVDTSTPVTTSTEATSSTTAEGTSIPTSTPSEGMTPLTSVPVSNTPVASSEASILSTTP 3246

Query: 3731 TGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP- 3782
              + TP TT       P T   T  PT TP+   TP T+   +TTTV  + T T + TP 
Sbjct: 3247 VDSNTPLTTSTEASSSPPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETSTLSTTPA 3306

Query: 3783 -TTTPITTTTTVTPTPT-------PTGTQTPTTTPIT----TTTTVTPTPTPTGTQTP-- 3828
             T+TP+TT +  + +P        PT T +  +TP+T    +TT V  +   T + TP  
Sbjct: 3307 DTSTPVTTYSQASSSPPIADGTSMPTSTYSEGSTPLTNMSFSTTPVVSSEASTLSTTPVD 3366

Query: 3829 TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTG------TQTPTTTPITT 3881
            T+TP+TT+T  + +PT   GT  PT++P   TT +   P  T         T +TTP+ +
Sbjct: 3367 TSTPVTTSTEASLSPTTAEGTSIPTSSPSEGTTPLASMPVSTTPVVSSEVNTLSTTPVDS 3426

Query: 3882 TTTVT-----------------PTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQ 3918
             T VT                 PT T +   TP      +TTP+ ++   T + TP  T 
Sbjct: 3427 NTLVTTSTEASSSPTIAEGTSLPTSTTSEGSTPLSIMPLSTTPVASSEASTLSTTPVDTS 3486

Query: 3919 TPTTT-------PITTTTTVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQT 3965
            TP TT       P T   T  PT T     TP      +TTP+ ++   T + TP  + T
Sbjct: 3487 TPVTTSSPTNSSPTTAEVTSMPTSTAGEGSTPLTNMPVSTTPVASSEASTLSTTPVDSNT 3546

Query: 3966 PTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP--TPTGTQTPTTTP 4016
              T+       P T   T     TP+   +  TT + ++T VT +   TP+      +TP
Sbjct: 3547 FVTSSSQASSSPATLQVTTMRMSTPSEGSSSLTTMLLSSTYVTSSEASTPSTPSVDRSTP 3606

Query: 4017 ITTTTTVTPTPTPT-------GTQTPTTTPIT----TTTTVTPTPTPTGTQTP--TTTPI 4063
            +TT+T    TPTP         T +  +TP+T    +TT+VT +   T +  P  T+TP+
Sbjct: 3607 VTTSTQSNSTPTPPEVITLPMSTPSEVSTPLTIMPVSTTSVTISEAGTASTLPVDTSTPV 3666

Query: 4064 TTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPTPTP 4121
             T+T V+ +P TP GT  P  TP   +T +T  P  T   T +  + ++T + VT TP  
Sbjct: 3667 ITSTQVSSSPVTPEGTTMPIWTPSEGSTPLTTMPVSTTRVTSSEGSTLSTPSVVTSTPVT 3726

Query: 4122 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP---TPTGTQTPTTTPI 4178
            T T+  +++    +TT++ +  P    T  TT + +TT VT  P   TP+     T+  +
Sbjct: 3727 TSTEAISSSATLDSTTMSVS-MPMEISTLGTTILVSTTPVTRFPESSTPSIPSVYTSMSM 3785

Query: 4179 TTTTTVTPTPTPT-GTQTGPPTHTS-------TAPIAELTTSNPPPESSTPQTSRSTSSP 4230
            TT +  + +PT   GT T P + TS       T  I+ ++  +P   S+       TS+P
Sbjct: 3786 TTASEGSSSPTTLEGTTTMPMSTTSERSTLLTTVLISPISVMSPSEASTLSTPPGDTSTP 3845

Query: 4231 LTESTTLLSTLPPA----IEMTSTAPPSTP--------TAPTTTSGGHTLSPPP--STTT 4276
            L  ST   S   PA    I ++ T+  STP        T PT+  G    S PP  ++TT
Sbjct: 3846 LLTSTKAGSFSIPAEVTTIRISITSERSTPLTTLLVSTTLPTSFPGASIASTPPLDTSTT 3905

Query: 4277 SPPGTPTRGTTT--------------GSSSAPT---PSTVQTTTTSAWTPTPT-PLSTPS 4318
              P T T  T T              GS+   T   PST  T++T+   P  T  +STP 
Sbjct: 3906 FTPSTDTASTPTIPVATTISVSVITEGSTPGTTIFIPSTPVTSSTADVFPATTGAVSTPV 3965

Query: 4319 IIRTTGLRPYPSSVLICCVLNDTYY---------APGEEVYNGTYGDTCYFVNCSLSCTL 4369
            I  T    P  SS       + T           AP   V   T   T      S  CT 
Sbjct: 3966 ITSTELNTPSTSSSSTTTSFSTTKEFTTPAMTTAAPLTYVTMSTAPSTPR--TTSRGCTT 4023

Query: 4370 EFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECP 4413
                 S  STP  + + +    TPS  SS PS  T  T PP  P
Sbjct: 4024 SASTLSATSTPHTSTSVTTRPVTPSSESSRPSTITSHTIPPTFP 4067



 Score = 1209 bits (3129), Expect = 0.0
 Identities = 1123/3709 (30%), Positives = 1628/3709 (43%), Gaps = 728/3709 (19%)

Query: 1398 TPSPPTTTPSPPPTSTTTLPPTTTP-SPPTTTTTTPPPTTTPSPPITTTTTPPPTTTPSP 1456
            TP+   TT      STT  P +T   S PTT   T  P +TPS    ++T    +T P P
Sbjct: 111  TPTESRTTSESTSDSTTLFPSSTEDTSSPTTPEGTDVPMSTPSEESISSTMAFVSTAPLP 170

Query: 1457 PISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPASTTT 1516
                 T+       S P TT +  +++P+ P +TT    P +T S  +T   + PAST  
Sbjct: 171  SFEAYTSLTYKVDMSTPLTTSTQASSSPTTPESTTI---PKSTNSEGSTPLTSMPASTMK 227

Query: 1517 LPPT------TTPSPPTTTTT-----TPPPTTT--PSPPTTTPITPPTSTTTLPPTT--- 1560
            +  +      TTP   +T  T     +  PTT   PS   + P    T  T +P +    
Sbjct: 228  VASSEAITLLTTPVEISTPVTISAQASSSPTTAEGPSLSNSAPSGGSTPLTRMPLSVMLV 287

Query: 1561 TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTP-- 1618
              S   T +TTP  T  P   +T   S PT    T  PT+T +  +T  T+ P +T P  
Sbjct: 288  VSSEASTLSTTPAATNIPVITSTEASSSPTTAEGTSIPTSTYTEGSTPLTSTPASTMPVA 347

Query: 1619 -SPPTTTPITPPTSTTTLPPTTTPSPPPTTT-TTPPPTTTPSPPTTTTPSPPI------- 1669
             S  +T  ITP  ++T +  +T PS  PTT   T   T+T S  +T   + P+       
Sbjct: 348  TSEMSTLSITPVDTSTLVTTSTEPSSLPTTAEATSMLTSTLSEGSTPLTNMPVSTILVAS 407

Query: 1670 ----TTTTTP----------------PPTTTPSSPITTTPSPPTTTMTTPSPTTTP---S 1706
                TT+T P                P T   +S  T+TPS  +T +T+   +TTP   S
Sbjct: 408  SEASTTSTIPVDSKTFVTTASEASSSPTTAEDTSIATSTPSEGSTPLTSMPVSTTPVASS 467

Query: 1707 SPITTTTTP--------SSTTTPSPPPTTMTTPSPTTTPSPPTTTMT-----TLP----- 1748
                 +TTP        +ST   S PPT      PT+TPS  +T +T     T+P     
Sbjct: 468  EASNLSTTPVDSKTQVTTSTEASSSPPTAEVNSMPTSTPSEGSTPLTSMSVSTMPVASSE 527

Query: 1749 -------PTTTSSPLTTTP-LPPSITPPTFSPFSTTTPTTPCVPLCNWTGW----LDSGK 1796
                   P  TS+P+TT+     S T P  +   T+TP+    PL N        + S  
Sbjct: 528  ASTLSTTPVDTSTPVTTSSEASSSSTTPEGTSIPTSTPSEGSTPLTNMPVSTRLVVSSEA 587

Query: 1797 PNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVC-DVSVGLICKNEDQ 1855
                    D+           +++ +   T  P     + G T+    VS  L+  +E  
Sbjct: 588  STTSTTPADSNTFVTTSSEASSSSTTAEGTSMPTSTYSERGTTITSMSVSTTLVASSEAS 647

Query: 1856 KPGGV-IPMAFCLNYEINVQCCECVTQPTTMTTTT-TENPTPPTTTPITTTTTV-----T 1908
                  +     +             + T+M T+T TE  TP T+ P+ TT        T
Sbjct: 648  TLSTTPVDSNTPVTTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSMPVNTTLVASSEAST 707

Query: 1909 PTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 1961
             + TP  T TP TT       P T      PT TP+   TP T+   + T +T +   T 
Sbjct: 708  LSTTPVDTSTPVTTSTEASSSPTTADGASMPTSTPSEGSTPLTSMPVSKTLLTSSEASTL 767

Query: 1962 TQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTP-------ITTTTTVTPTPTPTGTQTP 2011
            + TP  T+T ITT+T  + +PT T GT  P +TP        +   ++TP  +P  +   
Sbjct: 768  STTPLDTSTHITTSTEASCSPTTTEGTSMPISTPSEGSPLLTSIPVSITPVTSPEASTLS 827

Query: 2012 TT-----TPITTTTTVTPTPTPT-GTQTPTTT-----------PITTTTTVTP-----TP 2049
            TT     +P+TT+T V+ +PTP  GT  PT+T           P++TT   T      + 
Sbjct: 828  TTPVDSNSPVTTSTEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTLVATSAISTLST 887

Query: 2050 TPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2102
            TP  T TP T       +P T+  T  PT TP    TP T+   +TT V  +   T + T
Sbjct: 888  TPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSAT 947

Query: 2103 P--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTP------------TPTGTQ 2147
            P  T+TP+TT+T  T +PT   GT  PT+TP   TT +T TP            T + T 
Sbjct: 948  PVDTSTPVTTSTEATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEASTLSTTP 1007

Query: 2148 TPTTTPITTTTTVT-PTPTPTGTQTPTTTPI----------TTTTTVTPTPTPTGTQTP- 2195
              + TP+TT+T  + P PT  GT  PT+TP            +TT V  + T T + TP 
Sbjct: 1008 VDSNTPLTTSTEASSPPPTAEGTSMPTSTPSEGSTPLTRMPVSTTMVASSETSTLSTTPA 1067

Query: 2196 -TTTPITT-------TTTVTPTPTPTGTQTPTTTPITT----TTTVTPTPTPTGTQTP-- 2241
             T+TP+TT       +TT   T  PT T +  +TP+T+    T  V  +   T + TP  
Sbjct: 1068 DTSTPVTTYSQASSSSTTADGTSMPTSTYSEGSTPLTSVPVSTRLVVSSEASTLSTTPVD 1127

Query: 2242 TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTT------------------TVTPTPTPT 2282
            T+ P+TT+T  + +PT   GT  PT+ P   TT                  T++ TP  +
Sbjct: 1128 TSIPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVSTTLVVSSEANTLSTTPVDS 1187

Query: 2283 GTQTPTTT-----PITTTTTVTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTGTQ 2331
             TQ  T+T     P T   T  PT TP    TP T      TP+ ++   T + +P  T 
Sbjct: 1188 KTQVATSTEASSPPPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEASTLSTSPVDTS 1247

Query: 2332 TPTTTPITTT---TTVTPTPTPTGTQTPTTTPITT----TTTVTPTPTPTGTQTPTTT-- 2382
            TP TT   T+   TT   T  PT T +  +T +T+    TT VT     T   TP  T  
Sbjct: 1248 TPVTTSAETSSSPTTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKG 1307

Query: 2383 PITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTG------------TQTPTTTP 2429
            P+ T+  V+ +PTP  GT  PT+T     T +T  P  T             T    +TP
Sbjct: 1308 PVVTSNEVSSSPTPAEGTSMPTSTYSEGRTPLTSIPVNTTLVASSAISILSTTPVDNSTP 1367

Query: 2430 ITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2488
            +TT+T    +PT + GT  P + P   TT +T  P        +TTP+ ++   T + TP
Sbjct: 1368 VTTSTEACSSPTTSEGTSMPNSNPSEGTTPLTSIPV-------STTPVVSSEASTLSATP 1420

Query: 2489 TGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP- 2540
              T TP TT    T++ T       PT TP+  +TP  +   + T V  +   T + TP 
Sbjct: 1421 VDTSTPGTTSAEATSSPTTAEGISIPTSTPSEGKTPLKSIPVSNTPVANSEASTLSTTPV 1480

Query: 2541 -TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT----------QTP-- 2586
             + +P+ T+T V+ +PTP  GT    +TP   +T +T  P  T T           TP  
Sbjct: 1481 DSNSPVVTSTAVSSSPTPAEGTSIAISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAV 1540

Query: 2587 TTTPITTTTTVTPTPTP-------TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2639
            T+TP+TT +  + +PT        T T +  +TP+T+    T     +   T +TTPI +
Sbjct: 1541 TSTPVTTYSQASSSPTTADGTSMQTSTYSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDS 1600

Query: 2640 TTTVTPTP----------------TPT-GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTT 2681
             T VT +                 TP+ G+   T+ P++TT   +P   T + T   + +
Sbjct: 1601 KTQVTASTEASSSTTAEGSSMTISTPSEGSPLLTSIPVSTTPVASPEASTLSTTPVDSNS 1660

Query: 2682 PITTTTTVTPTPTPT-GTQTPTTT------PITT----TTTVTPTPTPTGTQTPT--TTP 2728
            P+ T+T V+ +PTP  GT  PT+T      P+T+    TT V  +   T + TP   +TP
Sbjct: 1661 PVITSTEVSSSPTPAEGTSMPTSTYTEGRTPLTSITVRTTPVASSAISTLSTTPVDNSTP 1720

Query: 2729 ITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPI 2775
            +TT+T    +PT + GT  P +TP   TT +T  P  T             T   T+TP+
Sbjct: 1721 VTTSTEARSSPTTSEGTSMPNSTPSEGTTPLTSIPVSTTPVLSSEASTLSATPIDTSTPV 1780

Query: 2776 TTTTTVTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPIT 2822
            TT+T  T +PT       PT T +   TP+T+T    T V  +   T + TP  + +P+ 
Sbjct: 1781 TTSTEATSSPTTAEGTSIPTSTLSEGMTPLTSTPVSHTLVANSEASTLSTTPVDSNSPVV 1840

Query: 2823 TTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPT 2880
            T+T V+ +PTP  GT   T+TP   +T +T  P  T T   + T  ++TT  VT TP  T
Sbjct: 1841 TSTAVSSSPTPAEGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLSTTPAVTSTPVTT 1900

Query: 2881 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTT-PITTTTTV-----TPTPTPTGTQTPTTT 2934
              Q  +++P T   +  PT TP   + P T+ P++TTT       T + T   T+TP TT
Sbjct: 1901 YAQV-SSSPTTADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTT 1959

Query: 2935 -------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTT 2985
                   P T   T  PTP  +   TP T+   +TT V  +   T + TP  T+TP TT+
Sbjct: 1960 YSQASSSPTTADGTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTTPVDTSTPATTS 2019

Query: 2986 TTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGT------QTPTTTPITTTTTVTPTP 3038
            T  + +PT  G T   T+TP   TT +   P  T         T +TTP+ + T VT + 
Sbjct: 2020 TEGSSSPTTAGGTSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNST 2079

Query: 3039 TPTGTQTP-----------------TTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTV 3080
              + + T                  T+ P++TT   +P   T + T   + +P+ T+T V
Sbjct: 2080 EASSSATAEGSSMTISAPSEGSPLLTSIPLSTTPVASPEASTLSTTPVDSNSPVITSTEV 2139

Query: 3081 TPTPTPT-GT----------QTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVT 3127
            + +P PT GT          +TP T+   +TT V  +   T + TP  T+TP+T +T   
Sbjct: 2140 SSSPIPTEGTSMQTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEAR 2199

Query: 3128 PTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTP 3174
             +PT + GT  PT+TP   +T  T  P  T             T   T+TP+TT+T  T 
Sbjct: 2200 SSPTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATS 2259

Query: 3175 TPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVT-P 3220
            +PT       PT T +  TTP+T+     T V  +   T + TP  + TP TT+T  + P
Sbjct: 2260 SPTTAEGTSIPTSTLSEGTTPLTSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSP 2319

Query: 3221 TPTPTGTQTPTTT-----------PITTTT-----TVTPTPTPTGTQTPTTT-------P 3257
             PT  GT  PT+T           P++TT      T T + TP  T TP TT       P
Sbjct: 2320 PPTAEGTSMPTSTSSEGNTPLTRMPVSTTMVASFETSTLSTTPADTSTPVTTYSQAGSSP 2379

Query: 3258 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT 3315
             T   T  PT T +   TP T+   +T  V  +   T + TP  T+TP+TT+T  + +PT
Sbjct: 2380 TTADDTSMPTSTYSEGSTPLTSVPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPT 2439

Query: 3316 PT-GTQTPTTTPITTTTTVTPTPTPTG------------TQTPTTTPITTTTTVTPTPTP 3362
               GT  PT+ P   TT +   P  T             T   T+TP+TT+T  + +PT 
Sbjct: 2440 TAEGTSIPTSPPSEGTTPLASMPVSTTPVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTT 2499

Query: 3363 T------------GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT 3409
                         G+   T+ P++TT   +P   T + T   + +P+ T+T ++ + T  
Sbjct: 2500 AEDIVVPISTASEGSTLLTSIPVSTTPVASPEASTLSTTPVDSNSPVVTSTEISSSATSA 2559

Query: 3410 -GTQTPTTT----------------PITTTTTVTPTPTPTGTQTPTTTPITTT---TTVT 3449
             GT  PT+T                P+ ++   T + TP  T  P TT   T+   TT  
Sbjct: 2560 EGTSMPTSTYSEGSTPLRSMPVSTKPLASSEASTLSTTPVDTSIPVTTSTETSSSPTTAK 2619

Query: 3450 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3509
             T  P  T +  +T +T+    T     +   T +TTP+ T T VT   T TGT   +++
Sbjct: 2620 DTSMPISTPSEVSTSLTSILVSTMPVASSEASTLSTTPVDTRTLVT---TSTGT---SSS 2673

Query: 3510 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTP 3567
            P T   +  PT TP    TP T  + +TT +  +   T + TP  T+TP+TT+   + +P
Sbjct: 2674 PTTAEGSSMPTSTPGERSTPLTNILVSTTLLANSEASTLSTTPVDTSTPVTTSAEASSSP 2733

Query: 3568 T-----------PTGTQTPTTT------PITTTTTVTPTPTPTGTQTPTTT-------PI 3603
            T           P+   TP T+      P+ ++   T + T   T  P TT       P 
Sbjct: 2734 TTAEGTSMRISTPSDGSTPLTSILVSTLPVASSEASTVSTTAVDTSIPVTTSTEASSSPT 2793

Query: 3604 TTTTTVTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTGTQTPTTT-------PIT 3650
            T   T  PT TP+ T TP T      TP+ ++   T + TP  T TP TT       P T
Sbjct: 2794 TAEVTSMPTSTPSETSTPLTSMPVNHTPVASSEAGTLSTTPVDTSTPVTTSTKASSSPTT 2853

Query: 3651 TTTTVTPTPTPTGTQT------PTTTPITTTTTVTPTPTPTGTQTPTTT-------PITT 3697
                V P  T +   T       +TTP+ ++   T + TP  T  P TT       P T 
Sbjct: 2854 AEGIVVPISTASEGSTLLTSIPVSTTPVASSEASTLSTTPVDTSIPVTTSTEGSSSPTTA 2913

Query: 3698 TTTVTPTPTPTGTQTPTTTPITTTTTV------TPTPTPTGTQTPTTT-------PITTT 3744
              T  P  TP+   TP T+ + +T  V      T + TP  T+TP TT       P T  
Sbjct: 2914 EGTSMPISTPSEVSTPLTSILVSTVPVAGSEASTLSTTPVDTRTPVTTSAEASSSPTTAE 2973

Query: 3745 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-G 3801
             T  P  TP   +TP T+   +T  V  +   T ++TP  T+TP+TT+T  + +PT   G
Sbjct: 2974 GTSMPISTPGERRTPLTSMSVSTMPVASSEASTLSRTPADTSTPVTTSTEASSSPTTAEG 3033

Query: 3802 TQTPTTTPITTTTTVTPTPTPTG------------TQTPTTTPITTTTTVTPTPTPT-GT 3848
            T  P +TP   +T +T  P  T             T   + +P+ T+T V+ +PTP  GT
Sbjct: 3034 TGIPISTPSEGSTPLTSIPVSTTPVAIPEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGT 3093

Query: 3849 QTPTTT------PIT----TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQ 3895
              P +T      P+T    +TT VT +   T + TP  T+TP+TT+T    +PT + GT 
Sbjct: 3094 SMPISTYSEGSTPLTGVPVSTTPVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSEGTS 3153

Query: 3896 TPTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPTPTGTQTP 3943
             PT+TP   +T +T  P  T             T   T+TP+TT+T  T + T  GT  P
Sbjct: 3154 MPTSTPSEGSTPLTYMPVSTMLVVSSEDSTLSATPVDTSTPVTTSTEATSSTTAEGTSIP 3213

Query: 3944 TTTPITTTTTVTPTP----------------TPTGTQTPTTT-------PITTTTTVTPT 3980
            T+TP    T +T  P                TP  + TP TT       P T   T  PT
Sbjct: 3214 TSTPSEGMTPLTSVPVSNTPVASSEASILSTTPVDSNTPLTTSTEASSSPPTAEGTSMPT 3273

Query: 3981 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT-------PTG 4031
             TP+   TP T+   +TTTV  + T T + TP  T+TP+TT +  + +P        PT 
Sbjct: 3274 STPSEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSSPPIADGTSMPTS 3333

Query: 4032 TQTPTTTPIT----TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTT 4084
            T +  +TP+T    +TT V  +   T + TP  T+TP+TT+T  + +PT   GT  PT++
Sbjct: 3334 TYSEGSTPLTNMSFSTTPVVSSEASTLSTTPVDTSTPVTTSTEASLSPTTAEGTSIPTSS 3393

Query: 4085 PITTTTTVTPTPTPTG------TQTPTTTPITTTTTVT-----------------PTPTP 4121
            P   TT +   P  T         T +TTP+ + T VT                 PT T 
Sbjct: 3394 PSEGTTPLASMPVSTTPVVSSEVNTLSTTPVDSNTLVTTSTEASSSPTIAEGTSLPTSTT 3453

Query: 4122 TGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPT 4168
            +   TP      +TTP+ ++   T + TP  T TP TT       P T   T  PT T  
Sbjct: 3454 SEGSTPLSIMPLSTTPVASSEASTLSTTPVDTSTPVTTSSPTNSSPTTAEVTSMPTSTAG 3513

Query: 4169 GTQTP-TTTPITTT-------TTVTPTPTPTGTQTGPPTHTSTAP----IAELTTSNP-- 4214
               TP T  P++TT       +T++ TP  + T     +  S++P    +  +  S P  
Sbjct: 3514 EGSTPLTNMPVSTTPVASSEASTLSTTPVDSNTFVTSSSQASSSPATLQVTTMRMSTPSE 3573

Query: 4215 ----------------PPESSTPQT-SRSTSSPLTESTTLLST-LPPAIEMTSTAPPSTP 4256
                              E+STP T S   S+P+T ST   ST  PP +     + PS  
Sbjct: 3574 GSSSLTTMLLSSTYVTSSEASTPSTPSVDRSTPVTTSTQSNSTPTPPEVITLPMSTPSEV 3633

Query: 4257 TAPTT----TSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTP--- 4309
            + P T    ++   T+S   + +T P  T T    T +  + +P T + TT   WTP   
Sbjct: 3634 STPLTIMPVSTTSVTISEAGTASTLPVDTST-PVITSTQVSSSPVTPEGTTMPIWTPSEG 3692

Query: 4310 -TP----------------TPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNG 4352
             TP                + LSTPS++ +T +     ++     L+ T  +    +   
Sbjct: 3693 STPLTTMPVSTTRVTSSEGSTLSTPSVVTSTPVTTSTEAISSSATLDSTTMSVSMPMEIS 3752

Query: 4353 TYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPS 4401
            T G T   +  S +    F   S PS PS     S S  T S+ SS+P+
Sbjct: 3753 TLGTT---ILVSTTPVTRFPESSTPSIPS--VYTSMSMTTASEGSSSPT 3796



 Score = 1200 bits (3105), Expect = 0.0
 Identities = 1064/3462 (30%), Positives = 1549/3462 (44%), Gaps = 597/3462 (17%)

Query: 1396 ITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPPPTTT-- 1453
            + +    T + +P  TST     T   S PTT      PT+TPS   T  T+ P + T  
Sbjct: 700  VASSEASTLSTTPVDTSTPVTTSTEASSSPTTADGASMPTSTPSEGSTPLTSMPVSKTLL 759

Query: 1454 PSPPISTTTTPPPTTTPSPPTTTPSP--PTTTP--SPPTTTTTTPPPTTTPSPPTTTPIT 1509
             S   ST +T P  T+    T+T +   PTTT   S P +T +   P  T  P + TP+T
Sbjct: 760  TSSEASTLSTTPLDTSTHITTSTEASCSPTTTEGTSMPISTPSEGSPLLTSIPVSITPVT 819

Query: 1510 PP-ASTTTLPPTTTPSPPTTTT---TTPPPTTTPSPPTTTPITPPTSTTTLPPTTT---P 1562
             P AST +  P  + SP TT+T   ++P P    S PT+T     T  T++P +TT    
Sbjct: 820  SPEASTLSTTPVDSNSPVTTSTEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTLVAT 879

Query: 1563 SPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTP---- 1618
            S   T +TTP  T+TP   +T   S PT +  T  PT+TP   +T  T+ P +TTP    
Sbjct: 880  SAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSS 939

Query: 1619 --------SPPTTTPITPPTSTTTLPPTTTPSPPPTTTT---TPPPTTTPSPPTTTTPSP 1667
                       T+TP+T  T  T+ P T   +  PT+T    T P T+TP   T    S 
Sbjct: 940  EARTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSE 999

Query: 1668 PITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPS---SPITTTTTPSSTTTPSPP 1724
              T +TTP  + TP +  T   SPP T   T  PT+TPS   +P+T     ++    S  
Sbjct: 1000 ASTLSTTPVDSNTPLTTSTEASSPPPTAEGTSMPTSTPSEGSTPLTRMPVSTTMVASSET 1059

Query: 1725 PTTMTTPSPTTTP--------SPPTTTMTTLPPTTT----SSPLTTTPLPPSITPPTFSP 1772
             T  TTP+ T+TP        S  TT   T  PT+T    S+PLT+ P+   +   + + 
Sbjct: 1060 STLSTTPADTSTPVTTYSQASSSSTTADGTSMPTSTYSEGSTPLTSVPVSTRLVVSSEAS 1119

Query: 1773 FSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVP 1832
              +TTP    +P+   T    S  P                        +   T  P  P
Sbjct: 1120 TLSTTPVDTSIPVTTSTE--ASSSPT-----------------------TAEGTSIPTSP 1154

Query: 1833 IGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTEN 1892
              + G T +  + V                    ++ E N      V   T + T+T E 
Sbjct: 1155 PSE-GTTPLASMPVST---------------TLVVSSEANTLSTTPVDSKTQVATST-EA 1197

Query: 1893 PTPPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 1950
             +PP T  +T+  T TP    TP  +     TP+ ++   T + +P  T TP TT   T+
Sbjct: 1198 SSPPPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEASTLSTSPVDTSTPVTTSAETS 1257

Query: 1951 ---TTVTPTPTPTGTQTPTTTPITT----TTTVTPTPTPTGTQTPTTT--PITTTTTVTP 2001
               TT   T  PT T +  +T +T+    TT VT     T   TP  T  P+ T+  V+ 
Sbjct: 1258 SSPTTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKGPVVTSNEVSS 1317

Query: 2002 TPTPT-GTQTPTTTPITTTTTVTPTPTPTG------------TQTPTTTPITTTTTVTPT 2048
            +PTP  GT  PT+T     T +T  P  T             T    +TP+TT+T    +
Sbjct: 1318 SPTPAEGTSMPTSTYSEGRTPLTSIPVNTTLVASSAISILSTTPVDNSTPVTTSTEACSS 1377

Query: 2049 PTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2107
            PT + GT  P + P   TT +T  P        +TTP+ ++   T + TP  T TP TT 
Sbjct: 1378 PTTSEGTSMPNSNPSEGTTPLTSIPV-------STTPVVSSEASTLSATPVDTSTPGTTS 1430

Query: 2108 ITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTT 2158
               T++ T       PT TP+  +TP  +   + T V  +   T + TP  + +P+ T+T
Sbjct: 1431 AEATSSPTTAEGISIPTSTPSEGKTPLKSIPVSNTPVANSEASTLSTTPVDSNSPVVTST 1490

Query: 2159 TVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT----------QTP--TTTPITTTTT 2205
             V+ +PTP  GT    +TP   +T +T  P  T T           TP  T+TP+TT + 
Sbjct: 1491 AVSSSPTPAEGTSIAISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTSTPVTTYSQ 1550

Query: 2206 VTPTPTP-------TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP-- 2256
             + +PT        T T +  +TP+T+    T     +   T +TTPI + T VT +   
Sbjct: 1551 ASSSPTTADGTSMQTSTYSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDSKTQVTASTEA 1610

Query: 2257 --------------TPT-GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTP 2300
                          TP+ G+   T+ P++TT   +P   T + T   + +P+ T+T V+ 
Sbjct: 1611 SSSTTAEGSSMTISTPSEGSPLLTSIPVSTTPVASPEASTLSTTPVDSNSPVITSTEVSS 1670

Query: 2301 TPTPT-GTQTPTTT------PITT----TTTVTPTPTPTGTQTPT--TTPITTTTTVTPT 2347
            +PTP  GT  PT+T      P+T+    TT V  +   T + TP   +TP+TT+T    +
Sbjct: 1671 SPTPAEGTSMPTSTYTEGRTPLTSITVRTTPVASSAISTLSTTPVDNSTPVTTSTEARSS 1730

Query: 2348 PTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTP 2394
            PT + GT  P +TP   TT +T  P  T             T   T+TP+TT+T  T +P
Sbjct: 1731 PTTSEGTSMPNSTPSEGTTPLTSIPVSTTPVLSSEASTLSATPIDTSTPVTTSTEATSSP 1790

Query: 2395 T-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT 2441
            T       PT T +   TP+T+T    T V  +   T + TP  + +P+ T+T V+ +PT
Sbjct: 1791 TTAEGTSIPTSTLSEGMTPLTSTPVSHTLVANSEASTLSTTPVDSNSPVVTSTAVSSSPT 1850

Query: 2442 PT-GTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPI 2499
            P  GT   T+TP   +T +T  P  T T   + T  ++TT  VT TP  T  Q  +++P 
Sbjct: 1851 PAEGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLSTTPAVTSTPVTTYAQV-SSSPT 1909

Query: 2500 TTTTTVTPTPTPTGTQTPTTT-PITTTTTV-----TPTPTPTGTQTPTTT-------PIT 2546
            T   +  PT TP   + P T+ P++TTT       T + T   T+TP TT       P T
Sbjct: 1910 TADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSPTT 1969

Query: 2547 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT 2604
               T  PTP  +   TP T+   +TT V  +   T + TP  T+TP TT+T  + +PT  
Sbjct: 1970 ADGTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTTPVDTSTPATTSTEGSSSPTTA 2029

Query: 2605 G-TQTPTTTPITTTTTVTPTPTPTGT------QTPTTTPITTTTTVTPTPTPTGTQTP-- 2655
            G T   T+TP   TT +   P  T         T +TTP+ + T VT +   + + T   
Sbjct: 2030 GGTSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNSTEASSSATAEG 2089

Query: 2656 ---------------TTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GT 2698
                           T+ P++TT   +P   T + T   + +P+ T+T V+ +P PT GT
Sbjct: 2090 SSMTISAPSEGSPLLTSIPLSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPIPTEGT 2149

Query: 2699 ----------QTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQ 2745
                      +TP T+   +TT V  +   T + TP  T+TP+T +T    +PT + GT 
Sbjct: 2150 SMQTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTS 2209

Query: 2746 TPTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPT------- 2786
             PT+TP   +T  T  P  T             T   T+TP+TT+T  T +PT       
Sbjct: 2210 MPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSI 2269

Query: 2787 PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVT-PTPTPTGTQTP 2839
            PT T +  TTP+T+     T V  +   T + TP  + TP TT+T  + P PT  GT  P
Sbjct: 2270 PTSTLSEGTTPLTSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMP 2329

Query: 2840 TTT-----------PITTTT-----TVTPTPTPTGTQTPTTT-------PITTTTTVTPT 2876
            T+T           P++TT      T T + TP  T TP TT       P T   T  PT
Sbjct: 2330 TSTSSEGNTPLTRMPVSTTMVASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPT 2389

Query: 2877 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTT 2933
             T +   TP T+   +T  V  +   T + TP  T+TP+TT+T  + +PT   GT  PT+
Sbjct: 2390 STYSEGSTPLTSVPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTS 2449

Query: 2934 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTT 2986
             P   TT +   P        +TTP+ ++   T + TP  T TP TT       P T   
Sbjct: 2450 PPSEGTTPLASMPV-------STTPVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTAED 2502

Query: 2987 TVTPTPTPT-GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GT 3043
             V P  T + G+   T+ P++TT   +P   T + T   + +P+ T+T ++ + T   GT
Sbjct: 2503 IVVPISTASEGSTLLTSIPVSTTPVASPEASTLSTTPVDSNSPVVTSTEISSSATSAEGT 2562

Query: 3044 QTPTTT----------------PITTTTTVTPTPTPTGTQTPTTTPITTT---TTVTPTP 3084
              PT+T                P+ ++   T + TP  T  P TT   T+   TT   T 
Sbjct: 2563 SMPTSTYSEGSTPLRSMPVSTKPLASSEASTLSTTPVDTSIPVTTSTETSSSPTTAKDTS 2622

Query: 3085 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3144
             P  T +  +T +T+    T     +   T +TTP+ T T VT   T TGT   +++P T
Sbjct: 2623 MPISTPSEVSTSLTSILVSTMPVASSEASTLSTTPVDTRTLVT---TSTGT---SSSPTT 2676

Query: 3145 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT-- 3200
               +  PT TP    TP T  + +TT +  +   T + TP  T+TP+TT+   + +PT  
Sbjct: 2677 AEGSSMPTSTPGERSTPLTNILVSTTLLANSEASTLSTTPVDTSTPVTTSAEASSSPTTA 2736

Query: 3201 ---------PTGTQTPTTT------PITTTTTVTPTPTPTGTQTPTTT-------PITTT 3238
                     P+   TP T+      P+ ++   T + T   T  P TT       P T  
Sbjct: 2737 EGTSMRISTPSDGSTPLTSILVSTLPVASSEASTVSTTAVDTSIPVTTSTEASSSPTTAE 2796

Query: 3239 TTVTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTGTQTPTTT-------PITTTT 3285
             T  PT TP+ T TP T      TP+ ++   T + TP  T TP TT       P T   
Sbjct: 2797 VTSMPTSTPSETSTPLTSMPVNHTPVASSEAGTLSTTPVDTSTPVTTSTKASSSPTTAEG 2856

Query: 3286 TVTPTPTPTGTQT------PTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTT 3332
             V P  T +   T       +TTP+ ++   T + TP  T  P TT       P T   T
Sbjct: 2857 IVVPISTASEGSTLLTSIPVSTTPVASSEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGT 2916

Query: 3333 VTPTPTPTGTQTPTTTPITTTTTV------TPTPTPTGTQTPTTT-------PITTTTTV 3379
              P  TP+   TP T+ + +T  V      T + TP  T+TP TT       P T   T 
Sbjct: 2917 SMPISTPSEVSTPLTSILVSTVPVAGSEASTLSTTPVDTRTPVTTSAEASSSPTTAEGTS 2976

Query: 3380 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQT 3436
             P  TP   +TP T+   +T  V  +   T ++TP  T+TP+TT+T  + +PT   GT  
Sbjct: 2977 MPISTPGERRTPLTSMSVSTMPVASSEASTLSRTPADTSTPVTTSTEASSSPTTAEGTGI 3036

Query: 3437 PTTTPITTTTTVTPTPTPTG------------TQTPTTTPITTTTTVTPTPTPT-GTQTP 3483
            P +TP   +T +T  P  T             T   + +P+ T+T V+ +PTP  GT  P
Sbjct: 3037 PISTPSEGSTPLTSIPVSTTPVAIPEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMP 3096

Query: 3484 TTT------PIT----TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPT 3530
             +T      P+T    +TT VT +   T + TP  T+TP+TT+T    +PT + GT  PT
Sbjct: 3097 ISTYSEGSTPLTGVPVSTTPVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSEGTSMPT 3156

Query: 3531 TTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3578
            +TP   +T +T  P  T             T   T+TP+TT+T  T + T  GT  PT+T
Sbjct: 3157 STPSEGSTPLTYMPVSTMLVVSSEDSTLSATPVDTSTPVTTSTEATSSTTAEGTSIPTST 3216

Query: 3579 PITTTTTVTPTP----------------TPTGTQTPTTT-------PITTTTTVTPTPTP 3615
            P    T +T  P                TP  + TP TT       P T   T  PT TP
Sbjct: 3217 PSEGMTPLTSVPVSNTPVASSEASILSTTPVDSNTPLTTSTEASSSPPTAEGTSMPTSTP 3276

Query: 3616 TGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT-------PTGTQT 3666
            +   TP T+   +TTTV  + T T + TP  T+TP+TT +  + +P        PT T +
Sbjct: 3277 SEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSSPPIADGTSMPTSTYS 3336

Query: 3667 PTTTPIT----TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPIT 3719
              +TP+T    +TT V  +   T + TP  T+TP+TT+T  + +PT   GT  PT++P  
Sbjct: 3337 EGSTPLTNMSFSTTPVVSSEASTLSTTPVDTSTPVTTSTEASLSPTTAEGTSIPTSSPSE 3396

Query: 3720 TTTTVTPTPTPTG------TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3773
             TT +   P  T         T +TTP+ + T VT +   + + T        T+T +  
Sbjct: 3397 GTTPLASMPVSTTPVVSSEVNTLSTTPVDSNTLVTTSTEASSSPTIAEGTSLPTSTTSEG 3456

Query: 3774 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQ 3826
             TP      +TTP+ ++   T + TP  T TP TT       P T   T  PT T     
Sbjct: 3457 STPLSIMPLSTTPVASSEASTLSTTPVDTSTPVTTSSPTNSSPTTAEVTSMPTSTAGEGS 3516

Query: 3827 TP------TTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQT 3873
            TP      +TTP+ ++   T + TP  + T  T+       P T   T     TP+   +
Sbjct: 3517 TPLTNMPVSTTPVASSEASTLSTTPVDSNTFVTSSSQASSSPATLQVTTMRMSTPSEGSS 3576

Query: 3874 PTTTPITTTTTVTPTP--TPTGTQTPTTTPITTTTTVTPTPTPT-------GTQTPTTTP 3924
              TT + ++T VT +   TP+      +TP+TT+T    TPTP         T +  +TP
Sbjct: 3577 SLTTMLLSSTYVTSSEASTPSTPSVDRSTPVTTSTQSNSTPTPPEVITLPMSTPSEVSTP 3636

Query: 3925 IT----TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTV 3977
            +T    +TT+VT +   T +  P  T+TP+ T+T V+ +P TP GT  P  TP   +T +
Sbjct: 3637 LTIMPVSTTSVTISEAGTASTLPVDTSTPVITSTQVSSSPVTPEGTTMPIWTPSEGSTPL 3696

Query: 3978 TPTPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 4036
            T  P  T   T +  + ++T + VT TP  T T+  +++    +TT++ +  P    T  
Sbjct: 3697 TTMPVSTTRVTSSEGSTLSTPSVVTSTPVTTSTEAISSSATLDSTTMSVS-MPMEISTLG 3755

Query: 4037 TTPITTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTT------ 4089
            TT + +TT VT  P  +    P+  T ++ TT    + +PT  +  TT P++TT      
Sbjct: 3756 TTILVSTTPVTRFPESSTPSIPSVYTSMSMTTASEGSSSPTTLEGTTTMPMSTTSERSTL 3815

Query: 4090 -TTVTPTP----TPTGTQT------PTTTPITTTTTVTPTPTPTGTQT-------PTTTP 4131
             TTV  +P    +P+   T       T+TP+ T+T       P    T         +TP
Sbjct: 3816 LTTVLISPISVMSPSEASTLSTPPGDTSTPLLTSTKAGSFSIPAEVTTIRISITSERSTP 3875

Query: 4132 ITTTTTVTPTPTP-TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT----- 4185
            +TT    T  PT   G    +T P+ T+TT TP+   T T +  T P+ TT +V+     
Sbjct: 3876 LTTLLVSTTLPTSFPGASIASTPPLDTSTTFTPS---TDTASTPTIPVATTISVSVITEG 3932

Query: 4186 PTPTPTGTQTGPPTHTSTAPIAELTTS------------NPPPESSTPQTSRSTSSPLTE 4233
             TP  T      P  +STA +   TT             N P  SS+  T+ S S+    
Sbjct: 3933 STPGTTIFIPSTPVTSSTADVFPATTGAVSTPVITSTELNTPSTSSS-STTTSFSTTKEF 3991

Query: 4234 STTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTT---TGS 4290
            +T  ++T  P   +T +  PST   P TTS G T S    + TS P T T  TT   T S
Sbjct: 3992 TTPAMTTAAPLTYVTMSTAPST---PRTTSRGCTTSASTLSATSTPHTSTSVTTRPVTPS 4048

Query: 4291 SSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSV 4332
            S +  PST+ + T     P P   STP     +     P +V
Sbjct: 4049 SESSRPSTITSHTIPPTFP-PAHSSTPPTTSASSTTVNPEAV 4089



 Score = 1185 bits (3065), Expect = 0.0
 Identities = 1037/3357 (30%), Positives = 1518/3357 (45%), Gaps = 510/3357 (15%)

Query: 1400 SPPTTTPSPPPTSTTTLPPTTT---PSPPTTTTTTPPPTTTP--------SPPITTTTTP 1448
            S PT+T S   T  T++P +TT    S  +T +TTP  T+TP        S P T+  T 
Sbjct: 854  SMPTSTYSEGRTPLTSMPVSTTLVATSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTS 913

Query: 1449 PPTTTPSPPISTTTTPPPTTTP----------SPPTTTPSPPTTTP---SPPTTTTTTPP 1495
             PT+TP    +  T+ P +TTP          + P  T +P TT+    S PTT   T  
Sbjct: 914  MPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVDTSTPVTTSTEATSSPTTAEGTSI 973

Query: 1496 PTTTPS----PPTTTPIT------PPASTTTLPPTTTPSPPTTTT--TTPPPTTT-PSPP 1542
            PT+TPS    P T+TP++        AST +  P  + +P TT+T  ++PPPT    S P
Sbjct: 974  PTSTPSEGTTPLTSTPVSHTLVANSEASTLSTTPVDSNTPLTTSTEASSPPPTAEGTSMP 1033

Query: 1543 TTTPITPPTSTTTLPPTTT---PSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPT 1599
            T+TP    T  T +P +TT    S   T +TTP  T+TP    +   S  T    T  PT
Sbjct: 1034 TSTPSEGSTPLTRMPVSTTMVASSETSTLSTTPADTSTPVTTYSQASSSSTTADGTSMPT 1093

Query: 1600 TTPSPPTTTTTTPPPTT---TPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTT-TPPPTT 1655
            +T S  +T  T+ P +T     S  +T   TP  ++  +  +T  S  PTT   T  PT+
Sbjct: 1094 STYSEGSTPLTSVPVSTRLVVSSEASTLSTTPVDTSIPVTTSTEASSSPTTAEGTSIPTS 1153

Query: 1656 TPSPPTTTTPSPPITTT-----------TTPPPTTTPSSPITTTPSPPTTTMTTPSPTTT 1704
             PS  TT   S P++TT           TTP  + T  +  T   SPP T   T  PT+T
Sbjct: 1154 PPSEGTTPLASMPVSTTLVVSSEANTLSTTPVDSKTQVATSTEASSPPPTAEVTSMPTST 1213

Query: 1705 P---SSPITT----------------TTTPSSTTTP--------SPPPTTMTTPSPTTTP 1737
            P   S+P+T+                +T+P  T+TP        S P T   T  PT+T 
Sbjct: 1214 PGERSTPLTSMPVRHTPVASSEASTLSTSPVDTSTPVTTSAETSSSPTTAEGTSLPTSTT 1273

Query: 1738 SPPTTTMTTLPPTTT--SSPLTTTPL--PPSITPPTFSPFSTTTPTTPCVPLCNWTGWLD 1793
            S  +T +T++P +TT  +SP  +T L  P     P  +    ++  TP       T    
Sbjct: 1274 SEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKGPVVTSNEVSSSPTPAEGTSMPTSTYS 1333

Query: 1794 SGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCD---VSVGLIC 1850
             G+        +T L+        ++ IS  +T   D        T  C     S G   
Sbjct: 1334 EGRTPLTSIPVNTTLVA-------SSAISILSTTPVDNSTPVTTSTEACSSPTTSEGTSM 1386

Query: 1851 KNEDQKPGGVIPMAFCLNYEINVQCCECV-TQPTTMTTTTTENPTPPTTTPITTTTTVT- 1908
             N +    G  P+       I V     V ++ +T++ T  +  TP TT+   T++  T 
Sbjct: 1387 PNSNPSE-GTTPLT-----SIPVSTTPVVSSEASTLSATPVDTSTPGTTSAEATSSPTTA 1440

Query: 1909 -----PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT- 1960
                 PT TP+  +TP  +   + T V  +   T + TP  + +P+ T+T V+ +PTP  
Sbjct: 1441 EGISIPTSTPSEGKTPLKSIPVSNTPVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAE 1500

Query: 1961 GTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2019
            GT    +TP   +T +T  P  T T  +     ++TT  VT TP  T +Q  +++P T  
Sbjct: 1501 GTSIAISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTSTPVTTYSQA-SSSPTTAD 1559

Query: 2020 TTVTPTPTPTGTQTP-TTTPITT-------TTTVTPTPTPTGTQTPTTTPITTTTT---- 2067
             T   T T +   TP T+ P++T         T++ TP  + TQ   +T  +++TT    
Sbjct: 1560 GTSMQTSTYSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDSKTQVTASTEASSSTTAEGS 1619

Query: 2068 -VTPTPTPTGTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQ 2124
             +T +    G+   T+ P++TT   +P   T + T   + +P+ T+T V+ +PTP  GT 
Sbjct: 1620 SMTISTPSEGSPLLTSIPVSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPTPAEGTS 1679

Query: 2125 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT-------PI 2177
             P       T+T T   TP  + T  TTP+ ++   T + TP    TP TT       P 
Sbjct: 1680 MP-------TSTYTEGRTPLTSITVRTTPVASSAISTLSTTPVDNSTPVTTSTEARSSPT 1732

Query: 2178 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT- 2234
            T+  T  P  TP+   TP T+   +TT V  +   T + TP  T+TP+TT+T  T +PT 
Sbjct: 1733 TSEGTSMPNSTPSEGTTPLTSIPVSTTPVLSSEASTLSATPIDTSTPVTTSTEATSSPTT 1792

Query: 2235 ------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT 2282
                  PT T +   TP+T+T    T V  +   T + TP  + +P+ T+T V+ +PTP 
Sbjct: 1793 AEGTSIPTSTLSEGMTPLTSTPVSHTLVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPA 1852

Query: 2283 -GTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2340
             GT   T+TP   +T +T  P  T T  +  T  ++TT  VT TP  T  Q  +++P T 
Sbjct: 1853 EGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLSTTPAVTSTPVTTYAQV-SSSPTTA 1911

Query: 2341 TTTVTPTPTPTGTQTP-TTTPITTTTTV-----TPTPTPTGTQTPTTT-------PITTT 2387
              +  PT TP   + P T+ P++TTT       T + T   T+TP TT       P T  
Sbjct: 1912 DGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSPTTAD 1971

Query: 2388 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-G 2444
             T  PTP  +   TP T+   +TT V  +   T + TP  T+TP TT+T  + +PT   G
Sbjct: 1972 GTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTTPVDTSTPATTSTEGSSSPTTAGG 2031

Query: 2445 TQTPTTTPITTTTTVTPTPTPTGT------QTPTTTPITTTTTVTPTPTPTGTQTP---- 2494
            T   T+TP   TT +   P  T         T +TTP+ + T VT +   + + T     
Sbjct: 2032 TSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNSTEASSSATAEGSS 2091

Query: 2495 -------------TTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GT-- 2537
                         T+ P++TT   +P   T + T   + +P+ T+T V+ +P PT GT  
Sbjct: 2092 MTISAPSEGSPLLTSIPLSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPIPTEGTSM 2151

Query: 2538 --------QTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTP 2586
                    +TP T+   +TT V  +   T + TP  T+TP+T +T    +PT + GT  P
Sbjct: 2152 QTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMP 2211

Query: 2587 TTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPT-------PT 2627
            T+TP   +T  T  P  T             T   T+TP+TT+T  T +PT       PT
Sbjct: 2212 TSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPT 2271

Query: 2628 GTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTV-TPTPTPTGTQTPTT 2680
             T +  TTP+T+     T V  +   T + TP  + TP TT+T   +P PT  GT  PT+
Sbjct: 2272 STLSEGTTPLTSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMPTS 2331

Query: 2681 T-----------PITTT-----TTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPT 2717
            T           P++TT      T T + TP  T TP TT       P T   T  PT T
Sbjct: 2332 TSSEGNTPLTRMPVSTTMVASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPTST 2391

Query: 2718 PTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTP 2774
             +   TP T+   +T  V  +   T + TP  T+TP+TT+T  + +PT   GT  PT+ P
Sbjct: 2392 YSEGSTPLTSVPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTSPP 2451

Query: 2775 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTV 2827
               TT +   P        +TTP+ ++   T + TP  T TP TT       P T    V
Sbjct: 2452 SEGTTPLASMPV-------STTPVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTAEDIV 2504

Query: 2828 TPTPTPT-GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQT 2884
             P  T + G+   T+ P++TT   +P   T + T   + +P+ T+T ++ + T   GT  
Sbjct: 2505 VPISTASEGSTLLTSIPVSTTPVASPEASTLSTTPVDSNSPVVTSTEISSSATSAEGTSM 2564

Query: 2885 PTTT----------------PITTTTTVTPTPTPTGTQTPTTTPITTT---TTVTPTPTP 2925
            PT+T                P+ ++   T + TP  T  P TT   T+   TT   T  P
Sbjct: 2565 PTSTYSEGSTPLRSMPVSTKPLASSEASTLSTTPVDTSIPVTTSTETSSSPTTAKDTSMP 2624

Query: 2926 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2985
              T +  +T +T+    T     +   T +TTP+ T T VT   T TGT   +++P T  
Sbjct: 2625 ISTPSEVSTSLTSILVSTMPVASSEASTLSTTPVDTRTLVT---TSTGT---SSSPTTAE 2678

Query: 2986 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTP----- 3038
             +  PT TP    TP T  + +TT +  +   T + TP  T+TP+TT+   + +P     
Sbjct: 2679 GSSMPTSTPGERSTPLTNILVSTTLLANSEASTLSTTPVDTSTPVTTSAEASSSPTTAEG 2738

Query: 3039 ------TPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTT 3079
                  TP+   TP      +T P+ ++   T + T   T  P TT       P T   T
Sbjct: 2739 TSMRISTPSDGSTPLTSILVSTLPVASSEASTVSTTAVDTSIPVTTSTEASSSPTTAEVT 2798

Query: 3080 VTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTV 3126
              PT TP+ T TP T      TP+ ++   T + TP  T TP TT       P T    V
Sbjct: 2799 SMPTSTPSETSTPLTSMPVNHTPVASSEAGTLSTTPVDTSTPVTTSTKASSSPTTAEGIV 2858

Query: 3127 TPTPTPTGTQT------PTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVT 3173
             P  T +   T       +TTP+ ++   T + TP  T  P TT       P T   T  
Sbjct: 2859 VPISTASEGSTLLTSIPVSTTPVASSEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGTSM 2918

Query: 3174 PTPTPTGTQTPTTTPITTTTTV------TPTPTPTGTQTPTTT-------PITTTTTVTP 3220
            P  TP+   TP T+ + +T  V      T + TP  T+TP TT       P T   T  P
Sbjct: 2919 PISTPSEVSTPLTSILVSTVPVAGSEASTLSTTPVDTRTPVTTSAEASSSPTTAEGTSMP 2978

Query: 3221 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPT 3277
              TP   +TP T+   +T  V  +   T ++TP  T+TP+TT+T  + +PT   GT  P 
Sbjct: 2979 ISTPGERRTPLTSMSVSTMPVASSEASTLSRTPADTSTPVTTSTEASSSPTTAEGTGIPI 3038

Query: 3278 TTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPTPT-GTQTPTT 3324
            +TP   +T +T  P  T             T   + +P+ T+T V+ +PTP  GT  P +
Sbjct: 3039 STPSEGSTPLTSIPVSTTPVAIPEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMPIS 3098

Query: 3325 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTT 3377
            T    +T +T  P        +TTP+T++   T + TP  T TP TT       P T+  
Sbjct: 3099 TYSEGSTPLTGVPV-------STTPVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSEG 3151

Query: 3378 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPTGTQ 3435
            T  PT TP+   TP T    +T  V  +   T + TP  T+TP+TT+T  T + T  GT 
Sbjct: 3152 TSMPTSTPSEGSTPLTYMPVSTMLVVSSEDSTLSATPVDTSTPVTTSTEATSSTTAEGTS 3211

Query: 3436 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3495
             PT+TP    T +T  P        + TP+ ++     + TP  + TP T   T+T   +
Sbjct: 3212 IPTSTPSEGMTPLTSVPV-------SNTPVASSEASILSTTPVDSNTPLT---TSTEASS 3261

Query: 3496 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTT 3554
              PT  GT  PT+TP   +T +T  P  T T  +  T+ ++TT   T TP  T +Q  ++
Sbjct: 3262 SPPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSS 3321

Query: 3555 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPT 3612
             PI   T++ PT T +   TP T    +TT V  +   T + TP  T+TP+TT+T  + +
Sbjct: 3322 PPIADGTSM-PTSTYSEGSTPLTNMSFSTTPVVSSEASTLSTTPVDTSTPVTTSTEASLS 3380

Query: 3613 PTPT-GTQTPTTTPITTTTTVTPTPTPT------GTQTPTTTPITTTTTVTPTPTPTGTQ 3665
            PT   GT  PT++P   TT +   P  T         T +TTP+ + T VT +   + + 
Sbjct: 3381 PTTAEGTSIPTSSPSEGTTPLASMPVSTTPVVSSEVNTLSTTPVDSNTLVTTSTEASSSP 3440

Query: 3666 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---T 3722
            T        T+T +   TP      +TTP+ ++   T + TP  T TP TT   T    T
Sbjct: 3441 TIAEGTSLPTSTTSEGSTPLSIMPLSTTPVASSEASTLSTTPVDTSTPVTTSSPTNSSPT 3500

Query: 3723 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3782
            T   T  PT T    +TP+T     T     +   T +TTP+ + T V  T +   + +P
Sbjct: 3501 TAEVTSMPTSTAGEGSTPLTNMPVSTTPVASSEASTLSTTPVDSNTFV--TSSSQASSSP 3558

Query: 3783 TTTPITTTTTVTPTPTPTGTQTPTTTPITTT-TTVTPTPTPTGTQTPTTTPITTTT--TV 3839
             T  +TT    TP+    G+ + TT  +++T  T +   TP+      +TP+TT+T    
Sbjct: 3559 ATLQVTTMRMSTPS---EGSSSLTTMLLSSTYVTSSEASTPSTPSVDRSTPVTTSTQSNS 3615

Query: 3840 TPTP---------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPT 3888
            TPTP         TP+   TP T    +TT+VT +   T +  P  T+TP+ T+T V+ +
Sbjct: 3616 TPTPPEVITLPMSTPSEVSTPLTIMPVSTTSVTISEAGTASTLPVDTSTPVITSTQVSSS 3675

Query: 3889 P-TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQTPTTT 3946
            P TP GT  P  TP   +T +T  P  T   T +  + ++T + VT TP  T T+  +++
Sbjct: 3676 PVTPEGTTMPIWTPSEGSTPLTTMPVSTTRVTSSEGSTLSTPSVVTSTPVTTSTEAISSS 3735

Query: 3947 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPTPT 4005
                +TT++    P    T  TT + +TT VT  P  +    P+  T ++ TT    + +
Sbjct: 3736 ATLDSTTMS-VSMPMEISTLGTTILVSTTPVTRFPESSTPSIPSVYTSMSMTTASEGSSS 3794

Query: 4006 PTGTQTPTTTPITTT-------TTVTPTP----TPTGTQT------PTTTPITTTTTVTP 4048
            PT  +  TT P++TT       TTV  +P    +P+   T       T+TP+ T+T    
Sbjct: 3795 PTTLEGTTTMPMSTTSERSTLLTTVLISPISVMSPSEASTLSTPPGDTSTPLLTSTKAGS 3854

Query: 4049 TPTPTGTQT-------PTTTPITTTTTVTPTPTP-TGTQTPTTTPITTTTTVTPTPTPTG 4100
               P    T         +TP+TT    T  PT   G    +T P+ T+TT TP+   T 
Sbjct: 3855 FSIPAEVTTIRISITSERSTPLTTLLVSTTLPTSFPGASIASTPPLDTSTTFTPS---TD 3911

Query: 4101 TQTPTTTPITTT-------------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 4147
            T +  T P+ TT             TT+    TP  + T    P TT    TP  T T  
Sbjct: 3912 TASTPTIPVATTISVSVITEGSTPGTTIFIPSTPVTSSTADVFPATTGAVSTPVITSTEL 3971

Query: 4148 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHTSTAPIA 4207
             TP+T+  +TTT+ + T   T     T  P+T  T  T   TP  T  G  T  ST    
Sbjct: 3972 NTPSTSSSSTTTSFSTTKEFTTPAMTTAAPLTYVTMSTAPSTPRTTSRGCTTSASTLS-- 4029

Query: 4208 ELTTSNPPPESSTPQTSRSTSSPLTESTTLLS-TLPPAIEMTSTAPPSTPTAPTTTSGGH 4266
               TS P   +S      + SS  +  +T+ S T+PP      T PP+  + P TTS   
Sbjct: 4030 --ATSTPHTSTSVTTRPVTPSSESSRPSTITSHTIPP------TFPPAHSSTPPTTSASS 4081

Query: 4267 TLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTT 4323
            T   P + TT    T    T T S    T + V T TT    PT    STP++ RTT
Sbjct: 4082 TTVNPEAVTTMTTRTKP-STRTTSFPTVTTTAVPTNTTIKSNPT----STPTVPRTT 4133



 Score = 1184 bits (3063), Expect = 0.0
 Identities = 1042/3429 (30%), Positives = 1528/3429 (44%), Gaps = 596/3429 (17%)

Query: 1391 PMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPS-PPTTTTTTPPPTTTPSPPITTTTTPP 1449
            P+ K + T S  +T  + P  ++T +  +T  S  PTTT  T  P +TPS      T+ P
Sbjct: 753  PVSKTLLTSSEASTLSTTPLDTSTHITTSTEASCSPTTTEGTSMPISTPSEGSPLLTSIP 812

Query: 1450 PTTTP--SPPISTTTTPP-----PTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSP 1502
             + TP  SP  ST +T P     P TT +  +++P+P   T  P +T +    P T+   
Sbjct: 813  VSITPVTSPEASTLSTTPVDSNSPVTTSTEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPV 872

Query: 1503 PTTTPITPPASTTTLPPTTTPSPPTTTT---TTPPPTTTPSPPTTTPITPPTSTTTLPPT 1559
             TT   T   ST +  P  T +P T +T   ++P  +   S PT+TP    T  T++P +
Sbjct: 873  STTLVATSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPGEGSTPLTSMPDS 932

Query: 1560 TTP---SPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTT 1616
            TTP   S   T + TP  T+TP   +T   S PT    T  PT+TPS  TT  T+ P + 
Sbjct: 933  TTPVVSSEARTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSH 992

Query: 1617 T------PSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPIT 1670
            T       S  +TTP+   T  TT   T   SPPPT   T  PT+TPS  +T     P++
Sbjct: 993  TLVANSEASTLSTTPVDSNTPLTT--STEASSPPPTAEGTSMPTSTPSEGSTPLTRMPVS 1050

Query: 1671 TT-----------TTPPPTTTPSSPITTTPSPPTTTMTTPSPTTT---PSSPITTTTTPS 1716
            TT           TTP  T+TP +  +   S  TT   T  PT+T    S+P+T+    +
Sbjct: 1051 TTMVASSETSTLSTTPADTSTPVTTYSQASSSSTTADGTSMPTSTYSEGSTPLTSVPVST 1110

Query: 1717 STTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTT 1776
                 S   T  TTP  T+ P   +T  ++ P T   + + T+P     TP    P STT
Sbjct: 1111 RLVVSSEASTLSTTPVDTSIPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVSTT 1170

Query: 1777 ------TPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPD 1830
                    T    P+ + T    S + +   P  +   +     PG       R+T    
Sbjct: 1171 LVVSSEANTLSTTPVDSKTQVATSTEASSPPPTAEVTSM-PTSTPGE------RSTPLTS 1223

Query: 1831 VPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTM----- 1885
            +P+     T V       +  +       V   A            E  + PTT      
Sbjct: 1224 MPVRH---TPVASSEASTLSTSPVDTSTPVTTSA------------ETSSSPTTAEGTSL 1268

Query: 1886 -TTTTTENPTPPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTP 1942
             T+TT+E  T  T+ P++TT   +P   T   T   T  P+ T+  V+ +PTP  GT  P
Sbjct: 1269 PTSTTSEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKGPVVTSNEVSSSPTPAEGTSMP 1328

Query: 1943 TTTPITTTTTVTPTPTPTG------------TQTPTTTPITTTTTVTPTPTPT-GTQTPT 1989
            T+T     T +T  P  T             T    +TP+TT+T    +PT + GT  P 
Sbjct: 1329 TSTYSEGRTPLTSIPVNTTLVASSAISILSTTPVDNSTPVTTSTEACSSPTTSEGTSMPN 1388

Query: 1990 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT--- 2046
            + P   TT +T  P        +TTP+ ++   T + TP  T TP TT    T++ T   
Sbjct: 1389 SNPSEGTTPLTSIPV-------STTPVVSSEASTLSATPVDTSTPGTTSAEATSSPTTAE 1441

Query: 2047 ----PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-G 2099
                PT TP+  +TP  +   + T V  +   T + TP  + +P+ T+T V+ +PTP  G
Sbjct: 1442 GISIPTSTPSEGKTPLKSIPVSNTPVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAEG 1501

Query: 2100 TQTPTTTPITTTTTVTPTPTPTGT----------QTP--TTTPITTTTTVTPTPTP---- 2143
            T    +TP   +T +T  P  T T           TP  T+TP+TT +  + +PT     
Sbjct: 1502 TSIAISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTSTPVTTYSQASSSPTTADGT 1561

Query: 2144 ---TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP------------- 2187
               T T +  +TP+T+    T     +   T +TTPI + T VT +              
Sbjct: 1562 SMQTSTYSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDSKTQVTASTEASSSTTAEGSSM 1621

Query: 2188 ---TPT-GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTP 2241
               TP+ G+   T+ P++TT   +P   T + T   + +P+ T+T V+ +PTP  GT  P
Sbjct: 1622 TISTPSEGSPLLTSIPVSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPTPAEGTSMP 1681

Query: 2242 TTT------PITT----TTTVTPTPTPTGTQTPT--TTPITTTTTVTPTPTPT-GTQTPT 2288
            T+T      P+T+    TT V  +   T + TP   +TP+TT+T    +PT + GT  P 
Sbjct: 1682 TSTYTEGRTPLTSITVRTTPVASSAISTLSTTPVDNSTPVTTSTEARSSPTTSEGTSMPN 1741

Query: 2289 TTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPT-------PTG 2329
            +TP   TT +T  P  T             T   T+TP+TT+T  T +PT       PT 
Sbjct: 1742 STPSEGTTPLTSIPVSTTPVLSSEASTLSATPIDTSTPVTTSTEATSSPTTAEGTSIPTS 1801

Query: 2330 TQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTT 2382
            T +   TP+T+T    T V  +   T + TP  + +P+ T+T V+ +PTP  GT   T+T
Sbjct: 1802 TLSEGMTPLTSTPVSHTLVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSIATST 1861

Query: 2383 PITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2441
            P   +T +T  P  T T   + T  ++TT  VT TP  T  Q  +++P T   +  PT T
Sbjct: 1862 PSEGSTALTSIPVSTTTVASSETNTLSTTPAVTSTPVTTYAQV-SSSPTTADGSSMPTST 1920

Query: 2442 PTGTQTPTTT-PITTTTTV-----TPTPTPTGTQTPTTT-------PITTTTTVTPTPTP 2488
            P   + P T+ P++TTT       T + T   T+TP TT       P T   T  PTP  
Sbjct: 1921 PREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSPTTADGTSMPTPAY 1980

Query: 2489 TGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPTG-TQTPTTTPI 2545
            +   TP T+   +TT V  +   T + TP  T+TP TT+T  + +PT  G T   T+TP 
Sbjct: 1981 SEGSTPLTSMPLSTTLVVSSEASTLSTTPVDTSTPATTSTEGSSSPTTAGGTSIQTSTPS 2040

Query: 2546 TTTTTVTPTPTPTGT------QTPTTTPITTTTTVTPTPTPTGTQTP------------- 2586
              TT +   P  T         T +TTP+ + T VT +   + + T              
Sbjct: 2041 ERTTPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNSTEASSSATAEGSSMTISAPSEG 2100

Query: 2587 ----TTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GT----------Q 2630
                T+ P++TT   +P   T + T   + +P+ T+T V+ +P PT GT          +
Sbjct: 2101 SPLLTSIPLSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPIPTEGTSMQTSTYSDRR 2160

Query: 2631 TPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTT 2687
            TP T+   +TT V  +   T + TP  T+TP+T +T    +PT + GT  PT+TP   +T
Sbjct: 2161 TPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPSEGST 2220

Query: 2688 TVTPTPTPT------------GTQTPTTTPITTTTTVTPTPT-------PTGTQTPTTTP 2728
              T  P  T             T   T+TP+TT+T  T +PT       PT T +  TTP
Sbjct: 2221 PFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGTTP 2280

Query: 2729 ITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVT-PTPTPTGTQTPTTT-------- 2773
            +T+     T V  +   T + TP  + TP TT+T  + P PT  GT  PT+T        
Sbjct: 2281 LTSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMPTSTSSEGNTPL 2340

Query: 2774 ---PITTTT-----TVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTT 2818
               P++TT      T T + TP  T TP TT       P T   T  PT T +   TP T
Sbjct: 2341 TRMPVSTTMVASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPTSTYSEGSTPLT 2400

Query: 2819 TPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTP 2875
            +   +T  V  +   T + TP  T+TP+TT+T  + +PT   GT  PT+ P   TT +  
Sbjct: 2401 SVPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLAS 2460

Query: 2876 TPTPTG------------TQTPTTTPITTTTTVTPTPTPT------------GTQTPTTT 2911
             P  T             T   T+TP+TT+T  + +PT              G+   T+ 
Sbjct: 2461 MPVSTTPVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTAEDIVVPISTASEGSTLLTSI 2520

Query: 2912 PITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTTT------------ 2957
            P++TT   +P   T + T   + +P+ T+T ++ + T   GT  PT+T            
Sbjct: 2521 PVSTTPVASPEASTLSTTPVDSNSPVVTSTEISSSATSAEGTSMPTSTYSEGSTPLRSMP 2580

Query: 2958 ----PITTTTTVTPTPTPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPITTTTT 3010
                P+ ++   T + TP  T  P TT   T+   TT   T  P  T +  +T +T+   
Sbjct: 2581 VSTKPLASSEASTLSTTPVDTSIPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILV 2640

Query: 3011 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3070
             T     +   T +TTP+ T T VT   T TGT   +++P T   +  PT TP    TP 
Sbjct: 2641 STMPVASSEASTLSTTPVDTRTLVT---TSTGT---SSSPTTAEGSSMPTSTPGERSTPL 2694

Query: 3071 TTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT-----------PTGTQTPTT 3117
            T  + +TT +  +   T + TP  T+TP+TT+   + +PT           P+   TP T
Sbjct: 2695 TNILVSTTLLANSEASTLSTTPVDTSTPVTTSAEASSSPTTAEGTSMRISTPSDGSTPLT 2754

Query: 3118 T------PITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTT- 3163
            +      P+ ++   T + T   T  P TT       P T   T  PT TP+ T TP T 
Sbjct: 2755 SILVSTLPVASSEASTVSTTAVDTSIPVTTSTEASSSPTTAEVTSMPTSTPSETSTPLTS 2814

Query: 3164 -----TPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQT----- 3206
                 TP+ ++   T + TP  T TP TT       P T    V P  T +   T     
Sbjct: 2815 MPVNHTPVASSEAGTLSTTPVDTSTPVTTSTKASSSPTTAEGIVVPISTASEGSTLLTSI 2874

Query: 3207 -PTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPI 3258
              +TTP+ ++   T + TP  T  P TT       P T   T  P  TP+   TP T+ +
Sbjct: 2875 PVSTTPVASSEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGTSMPISTPSEVSTPLTSIL 2934

Query: 3259 TTTTTV------TPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPIT 3305
             +T  V      T + TP  T+TP TT       P T   T  P  TP   +TP T+   
Sbjct: 2935 VSTVPVAGSEASTLSTTPVDTRTPVTTSAEASSSPTTAEGTSMPISTPGERRTPLTSMSV 2994

Query: 3306 TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTP 3362
            +T  V  +   T ++TP  T+TP+TT+T  + +PT   GT  P +TP   +T +T  P  
Sbjct: 2995 STMPVASSEASTLSRTPADTSTPVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTSIPVS 3054

Query: 3363 TG------------TQTPTTTPITTTTTVTPTPTPT-GTQTPTTT------PIT----TT 3399
            T             T   + +P+ T+T V+ +PTP  GT  P +T      P+T    +T
Sbjct: 3055 TTPVAIPEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMPISTYSEGSTPLTGVPVST 3114

Query: 3400 TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT- 3455
            T VT +   T + TP  T+TP+TT+T    +PT + GT  PT+TP   +T +T  P  T 
Sbjct: 3115 TPVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSEGTSMPTSTPSEGSTPLTYMPVSTM 3174

Query: 3456 -----------GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP------ 3498
                        T   T+TP+TT+T  T + T  GT  PT+TP    T +T  P      
Sbjct: 3175 LVVSSEDSTLSATPVDTSTPVTTSTEATSSTTAEGTSIPTSTPSEGMTPLTSVPVSNTPV 3234

Query: 3499 ----------TPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3541
                      TP  + TP TT       P T   T  PT TP+   TP T+   +TTTV 
Sbjct: 3235 ASSEASILSTTPVDSNTPLTTSTEASSSPPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVA 3294

Query: 3542 PTPTPTGTQTP--TTTPITTTTTVTPTPT-------PTGTQTPTTTPIT----TTTTVTP 3588
             + T T + TP  T+TP+TT +  + +P        PT T +  +TP+T    +TT V  
Sbjct: 3295 SSETSTLSTTPADTSTPVTTYSQASSSPPIADGTSMPTSTYSEGSTPLTNMSFSTTPVVS 3354

Query: 3589 TPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTG----- 3640
            +   T + TP  T+TP+TT+T  + +PT   GT  PT++P   TT +   P  T      
Sbjct: 3355 SEASTLSTTPVDTSTPVTTSTEASLSPTTAEGTSIPTSSPSEGTTPLASMPVSTTPVVSS 3414

Query: 3641 -TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3699
               T +TTP+ + T VT +   + + T        T+T +   TP      +TTP+ ++ 
Sbjct: 3415 EVNTLSTTPVDSNTLVTTSTEASSSPTIAEGTSLPTSTTSEGSTPLSIMPLSTTPVASSE 3474

Query: 3700 TVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTP------TTTPITTTTT 3746
              T + TP  T TP TT       P T   T  PT T     TP      +TTP+ ++  
Sbjct: 3475 ASTLSTTPVDTSTPVTTSSPTNSSPTTAEVTSMPTSTAGEGSTPLTNMPVSTTPVASSEA 3534

Query: 3747 VTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP-- 3797
             T + TP  + T  T+       P T   T     TP+   +  TT + ++T VT +   
Sbjct: 3535 STLSTTPVDSNTFVTSSSQASSSPATLQVTTMRMSTPSEGSSSLTTMLLSSTYVTSSEAS 3594

Query: 3798 TPTGTQTPTTTPITTTTTVTPTPTPT-------GTQTPTTTPIT----TTTTVTPTPTPT 3846
            TP+      +TP+TT+T    TPTP         T +  +TP+T    +TT+VT +   T
Sbjct: 3595 TPSTPSVDRSTPVTTSTQSNSTPTPPEVITLPMSTPSEVSTPLTIMPVSTTSVTISEAGT 3654

Query: 3847 GTQTP--TTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT-TPI 3902
             +  P  T+TP+ T+T V+ +P TP GT  P  TP   +T +T  P  T   T +  + +
Sbjct: 3655 ASTLPVDTSTPVITSTQVSSSPVTPEGTTMPIWTPSEGSTPLTTMPVSTTRVTSSEGSTL 3714

Query: 3903 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3962
            +T + VT TP  T T+  +++    +TT++ +  P    T  TT + +TT VT  P  + 
Sbjct: 3715 STPSVVTSTPVTTSTEAISSSATLDSTTMSVS-MPMEISTLGTTILVSTTPVTRFPESST 3773

Query: 3963 TQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTT-------TTVTPTP----TPTGTQ 4010
               P+  T ++ TT    + +PT  +  TT P++TT       TTV  +P    +P+   
Sbjct: 3774 PSIPSVYTSMSMTTASEGSSSPTTLEGTTTMPMSTTSERSTLLTTVLISPISVMSPSEAS 3833

Query: 4011 T------PTTTPITTTTTVTPTPTPTGTQT-------PTTTPITTTTTVTPTPTP-TGTQ 4056
            T       T+TP+ T+T       P    T         +TP+TT    T  PT   G  
Sbjct: 3834 TLSTPPGDTSTPLLTSTKAGSFSIPAEVTTIRISITSERSTPLTTLLVSTTLPTSFPGAS 3893

Query: 4057 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT-------------TTVTPTPTPTGTQT 4103
              +T P+ T+TT TP+   T T +  T P+ TT             TT+    TP  + T
Sbjct: 3894 IASTPPLDTSTTFTPS---TDTASTPTIPVATTISVSVITEGSTPGTTIFIPSTPVTSST 3950

Query: 4104 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4163
                P TT    TP  T T   TP+T+  +TTT+ + T   T     T  P+T  T  T 
Sbjct: 3951 ADVFPATTGAVSTPVITSTELNTPSTSSSSTTTSFSTTKEFTTPAMTTAAPLTYVTMSTA 4010

Query: 4164 TPTP--------------TGTQTPTTTPITTTTTVTPT-----PTPTGTQTGPPT----H 4200
              TP              + T TP T+   TT  VTP+     P+   + T PPT    H
Sbjct: 4011 PSTPRTTSRGCTTSASTLSATSTPHTSTSVTTRPVTPSSESSRPSTITSHTIPPTFPPAH 4070

Query: 4201 TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTES-TTLLSTLPPA---IEMTSTAPPSTP 4256
            +ST P    +++   PE+ T  T+R+  S  T S  T+ +T  P    I+   T+ P+ P
Sbjct: 4071 SSTPPTTSASSTTVNPEAVTTMTTRTKPSTRTTSFPTVTTTAVPTNTTIKSNPTSTPTVP 4130

Query: 4257 TAPTTTSGG 4265
               T    G
Sbjct: 4131 RTTTCFGDG 4139



 Score = 1110 bits (2870), Expect = 0.0
 Identities = 1045/3472 (30%), Positives = 1519/3472 (43%), Gaps = 705/3472 (20%)

Query: 1627 TPPTSTTTLPPTT--TPSPPPTTTTTPPPTTTPSP---PTTTTPSPPITTTTTPPPTTTP 1681
            T  TST  + P    + S  P  T+     T+ +P    T  TP+   TT+ +   +TT 
Sbjct: 69   TGTTSTNVVEPRMYLSCSTNPEMTSIESSVTSDTPGVSSTRMTPTESRTTSESTSDSTTL 128

Query: 1682 SSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPP---------PTTMTTPS 1732
                T   S PTT   T  P +TPS    ++T    +T P P             M+TP 
Sbjct: 129  FPSSTEDTSSPTTPEGTDVPMSTPSEESISSTMAFVSTAPLPSFEAYTSLTYKVDMSTPL 188

Query: 1733 PTTT---PSPPTTTMTTLPPTTT---SSPLT------------------TTPLPPSITPP 1768
             T+T    SP T   TT+P +T    S+PLT                  TTP+  S TP 
Sbjct: 189  TTSTQASSSPTTPESTTIPKSTNSEGSTPLTSMPASTMKVASSEAITLLTTPVEIS-TPV 247

Query: 1769 TFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMY 1828
            T S  ++++PTT   P  + +       P    P     ++  V       + +  AT  
Sbjct: 248  TISAQASSSPTTAEGPSLSNSAPSGGSTPLTRMP---LSVMLVVSSEASTLSTTPAATNI 304

Query: 1829 PDVPIGQLGQ--TVVCDVSVGLICKNE-----DQKPGGVIPMAFCLNYEINVQCCECVTQ 1881
            P +   +     T     S+      E        P   +P+A      +++   +  T 
Sbjct: 305  PVITSTEASSSPTTAEGTSIPTSTYTEGSTPLTSTPASTMPVATSEMSTLSITPVDTSTL 364

Query: 1882 PTT----------------MTTTTTENPTPPTTTPITT---------TTTVTPTPTPT-- 1914
             TT                +T+T +E  TP T  P++T         TT+  P  + T  
Sbjct: 365  VTTSTEPSSLPTTAEATSMLTSTLSEGSTPLTNMPVSTILVASSEASTTSTIPVDSKTFV 424

Query: 1915 -----GTQTPTTTPITTTTTVTPT--PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 1967
                  + +PTT   T+  T TP+   TP  +   +TTP+ ++     + TP  ++T  T
Sbjct: 425  TTASEASSSPTTAEDTSIATSTPSEGSTPLTSMPVSTTPVASSEASNLSTTPVDSKTQVT 484

Query: 1968 T-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITT 2018
            T       P T      PT TP+   TP T+   +T  V  +   T + TP  T+TP+TT
Sbjct: 485  TSTEASSSPPTAEVNSMPTSTPSEGSTPLTSMSVSTMPVASSEASTLSTTPVDTSTPVTT 544

Query: 2019 TTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTPT------GTQTPTTTPITTTTTVT-- 2069
            ++   + + TP GT  PT+TP   +T +T  P  T         T +TTP  + T VT  
Sbjct: 545  SSEASSSSTTPEGTSIPTSTPSEGSTPLTNMPVSTRLVVSSEASTTSTTPADSNTFVTTS 604

Query: 2070 -----PTPTPTGTQTPTTTPITTTTTVTP----------------TPTPTGTQTPTTTPI 2108
                  + T  GT  PT+T     TT+T                 + TP  + TP TT  
Sbjct: 605  SEASSSSTTAEGTSMPTSTYSERGTTITSMSVSTTLVASSEASTLSTTPVDSNTPVTTST 664

Query: 2109 TTT---TTVTPTPTPTGTQTPTTTPITT----TTTVTPTPTPTGTQTP--TTTPITTTTT 2159
              T   TT   T  PT T T  +TP+T+    TT V  +   T + TP  T+TP+TT+T 
Sbjct: 665  EATSSSTTAEGTSMPTSTYTEGSTPLTSMPVNTTLVASSEASTLSTTPVDTSTPVTTSTE 724

Query: 2160 VTPTPT-------PTGTQTPTTTPIT----TTTTVTPTPTPTGTQTP--TTTPITTTTTV 2206
             + +PT       PT T +  +TP+T    + T +T +   T + TP  T+T ITT+T  
Sbjct: 725  ASSSPTTADGASMPTSTPSEGSTPLTSMPVSKTLLTSSEASTLSTTPLDTSTHITTSTEA 784

Query: 2207 TPTPTPT-GTQTPTTTP-------ITTTTTVTPTPTPTGTQTPTT-----TPITTTTTVT 2253
            + +PT T GT  P +TP        +   ++TP  +P  +   TT     +P+TT+T V+
Sbjct: 785  SCSPTTTEGTSMPISTPSEGSPLLTSIPVSITPVTSPEASTLSTTPVDSNSPVTTSTEVS 844

Query: 2254 PTPTPT-GTQTPTTT-----------PITTTTTVTP-----TPTPTGTQTPTT------- 2289
             +PTP  GT  PT+T           P++TT   T      + TP  T TP T       
Sbjct: 845  SSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTLVATSAISTLSTTPVDTSTPVTNSTEARS 904

Query: 2290 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPT 2347
            +P T+  T  PT TP    TP T+   +TT V  +   T + TP  T+TP+TT+T  T +
Sbjct: 905  SPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVDTSTPVTTSTEATSS 964

Query: 2348 PTPT-GTQTPTTTPITTTTTVTPTP------------TPTGTQTPTTTPITTTTTV-TPT 2393
            PT   GT  PT+TP   TT +T TP            T + T   + TP+TT+T   +P 
Sbjct: 965  PTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEASTLSTTPVDSNTPLTTSTEASSPP 1024

Query: 2394 PTPTGTQTPTTTPI----------TTTTTVTPTPTPTGTQTP--TTTPITT-------TT 2434
            PT  GT  PT+TP            +TT V  + T T + TP  T+TP+TT       +T
Sbjct: 1025 PTAEGTSMPTSTPSEGSTPLTRMPVSTTMVASSETSTLSTTPADTSTPVTTYSQASSSST 1084

Query: 2435 TVTPTPTPTGTQTPTTTPIT----TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTP 2488
            T   T  PT T +  +TP+T    +T  V  +   T + TP  T+ P+TT+T  + +PT 
Sbjct: 1085 TADGTSMPTSTYSEGSTPLTSVPVSTRLVVSSEASTLSTTPVDTSIPVTTSTEASSSPTT 1144

Query: 2489 T-GTQTPTTTPITTTT------------------TVTPTPTPTGTQTPTTT-----PITT 2524
              GT  PT+ P   TT                  T++ TP  + TQ  T+T     P T 
Sbjct: 1145 AEGTSIPTSPPSEGTTPLASMPVSTTLVVSSEANTLSTTPVDSKTQVATSTEASSPPPTA 1204

Query: 2525 TTTVTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTGTQTPTTTPITTT---TTVT 2575
              T  PT TP    TP T      TP+ ++   T + +P  T TP TT   T+   TT  
Sbjct: 1205 EVTSMPTSTPGERSTPLTSMPVRHTPVASSEASTLSTSPVDTSTPVTTSAETSSSPTTAE 1264

Query: 2576 PTPTPTGTQTPTTTPIT----TTTTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPT-G 2628
             T  PT T +  +T +T    +TT VT     T   TP  T  P+ T+  V+ +PTP  G
Sbjct: 1265 GTSLPTSTTSEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKGPVVTSNEVSSSPTPAEG 1324

Query: 2629 TQTPTTT-----------PITTTTTVTP-----TPTPTGTQTPTTT-------PITTTTT 2665
            T  PT+T           P+ TT   +      + TP    TP TT       P T+  T
Sbjct: 1325 TSMPTSTYSEGRTPLTSIPVNTTLVASSAISILSTTPVDNSTPVTTSTEACSSPTTSEGT 1384

Query: 2666 VTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT------ 2713
              P   P+   TP      +TTP+ ++   T + TP  T TP TT    T++ T      
Sbjct: 1385 SMPNSNPSEGTTPLTSIPVSTTPVVSSEASTLSATPVDTSTPGTTSAEATSSPTTAEGIS 1444

Query: 2714 -PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQT 2769
             PT TP+  +TP  +   + T V  +   T + TP  + +P+ T+T V+ +PTP  GT  
Sbjct: 1445 IPTSTPSEGKTPLKSIPVSNTPVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSI 1504

Query: 2770 PTTTPITTTTTVTPTPTPTGT----------QTP--TTTPITTTTTVTPTPT-------P 2810
              +TP   +T +T  P  T T           TP  T+TP+TT +  + +PT        
Sbjct: 1505 AISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTSTPVTTYSQASSSPTTADGTSMQ 1564

Query: 2811 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT----------------P 2854
            T T +  +TP+T+    T     +   T +TTPI + T VT +                 
Sbjct: 1565 TSTYSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDSKTQVTASTEASSSTTAEGSSMTIS 1624

Query: 2855 TPT-GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTT- 2910
            TP+ G+   T+ P++TT   +P   T + T   + +P+ T+T V+ +PTP  GT  PT+ 
Sbjct: 1625 TPSEGSPLLTSIPVSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPTPAEGTSMPTST 1684

Query: 2911 -----TPITT----TTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTP 2958
                 TP+T+    TT V  +   T + TP   +TP+TT+T    +PT + GT  P +TP
Sbjct: 1685 YTEGRTPLTSITVRTTPVASSAISTLSTTPVDNSTPVTTSTEARSSPTTSEGTSMPNSTP 1744

Query: 2959 ITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPT-------PTGTQT 2999
               TT +T  P  T             T   T+TP+TT+T  T +PT       PT T +
Sbjct: 1745 SEGTTPLTSIPVSTTPVLSSEASTLSATPIDTSTPVTTSTEATSSPTTAEGTSIPTSTLS 1804

Query: 3000 PTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPIT 3052
               TP+T+T    T V  +   T + TP  + +P+ T+T V+ +PTP  GT   T+TP  
Sbjct: 1805 EGMTPLTSTPVSHTLVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSIATSTPSE 1864

Query: 3053 TTTTVTPTPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3111
             +T +T  P  T T  +  T  ++TT  VT TP  T  Q  +++P T   +  PT TP  
Sbjct: 1865 GSTALTSIPVSTTTVASSETNTLSTTPAVTSTPVTTYAQV-SSSPTTADGSSMPTSTPRE 1923

Query: 3112 TQTP-TTTPITTTTTV-----TPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGT 3158
             + P T+ P++TTT       T + T   T+TP TT       P T   T  PTP  +  
Sbjct: 1924 GRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSPTTADGTSMPTPAYSEG 1983

Query: 3159 QTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTT 3215
             TP T+   +TT V  +   T + TP  T+TP TT+T  + +PT   GT   T+TP   T
Sbjct: 1984 STPLTSMPLSTTLVVSSEASTLSTTPVDTSTPATTSTEGSSSPTTAGGTSIQTSTPSERT 2043

Query: 3216 TTVTPTPTPTGT------QTPTTTPITTTTTVTPTPTPTGTQTP---------------- 3253
            T +   P  T         T +TTP+ + T VT +   + + T                 
Sbjct: 2044 TPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNSTEASSSATAEGSSMTISAPSEGSPL 2103

Query: 3254 -TTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GT----------QTPT 3300
             T+ P++TT   +P   T + T   + +P+ T+T V+ +P PT GT          +TP 
Sbjct: 2104 LTSIPLSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPIPTEGTSMQTSTYSDRRTPL 2163

Query: 3301 TTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVT 3357
            T+   +TT V  +   T + TP  T+TP+T +T    +PT + GT  PT+TP   +T  T
Sbjct: 2164 TSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPSEGSTPFT 2223

Query: 3358 PTPTPT------------GTQTPTTTPITTTTTVTPTPT-------PTGTQTPTTTPITT 3398
              P  T             T   T+TP+TT+T  T +PT       PT T +  TTP+T+
Sbjct: 2224 SMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGTTPLTS 2283

Query: 3399 T----TTVTPTPTPTGTQTP--TTTPITTTTTV-TPTPTPTGTQTPTTT----------- 3440
                 T V  +   T + TP  + TP TT+T   +P PT  GT  PT+T           
Sbjct: 2284 IPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMPTSTSSEGNTPLTRM 2343

Query: 3441 PITTT-----TTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPI 3488
            P++TT      T T + TP  T TP TT       P T   T  PT T +   TP T+  
Sbjct: 2344 PVSTTMVASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPTSTYSEGSTPLTSVP 2403

Query: 3489 TTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPT 3545
             +T  V  +   T + TP  T+TP+TT+T  + +PT   GT  PT+ P   TT +   P 
Sbjct: 2404 VSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPV 2463

Query: 3546 PT------------GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPIT 3581
             T             T   T+TP+TT+T  + +PT              G+   T+ P++
Sbjct: 2464 STTPVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTAEDIVVPISTASEGSTLLTSIPVS 2523

Query: 3582 TTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTTT--------------- 3624
            TT   +P   T + T   + +P+ T+T ++ + T   GT  PT+T               
Sbjct: 2524 TTPVASPEASTLSTTPVDSNSPVVTSTEISSSATSAEGTSMPTSTYSEGSTPLRSMPVST 2583

Query: 3625 -PITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTP------TTT 3670
             P+ ++   T + TP  T  P TT       P T   T  P  TP+   T       +T 
Sbjct: 2584 KPLASSEASTLSTTPVDTSIPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILVSTM 2643

Query: 3671 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTT 3723
            P+ ++   T + TP  T+T  TT   T+++ T       PT TP    TP T  + +TT 
Sbjct: 2644 PVASSEASTLSTTPVDTRTLVTTSTGTSSSPTTAEGSSMPTSTPGERSTPLTNILVSTTL 2703

Query: 3724 VTPTPTPTGTQTP--TTTPITTTTTVTPTP-----------TPTGTQTP------TTTPI 3764
            +  +   T + TP  T+TP+TT+   + +P           TP+   TP      +T P+
Sbjct: 2704 LANSEASTLSTTPVDTSTPVTTSAEASSSPTTAEGTSMRISTPSDGSTPLTSILVSTLPV 2763

Query: 3765 TTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTT------TPIT 3811
             ++   T + T   T  P TT       P T   T  PT TP+ T TP T      TP+ 
Sbjct: 2764 ASSEASTVSTTAVDTSIPVTTSTEASSSPTTAEVTSMPTSTPSETSTPLTSMPVNHTPVA 2823

Query: 3812 TTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQT------PTTTPITT 3858
            ++   T + TP  T TP TT       P T    V P  T +   T       +TTP+ +
Sbjct: 2824 SSEAGTLSTTPVDTSTPVTTSTKASSSPTTAEGIVVPISTASEGSTLLTSIPVSTTPVAS 2883

Query: 3859 TTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTV--- 3908
            +   T + TP  T  P TT       P T   T  P  TP+   TP T+ + +T  V   
Sbjct: 2884 SEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGTSMPISTPSEVSTPLTSILVSTVPVAGS 2943

Query: 3909 ---TPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3958
               T + TP  T+TP TT       P T   T  P  TP   +TP T+   +T  V  + 
Sbjct: 2944 EASTLSTTPVDTRTPVTTSAEASSSPTTAEGTSMPISTPGERRTPLTSMSVSTMPVASSE 3003

Query: 3959 TPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT-------- 4007
              T ++TP  T+TP+TT+T  + +PT   GT  P +TP   +T +T  P  T        
Sbjct: 3004 ASTLSRTPADTSTPVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTSIPVSTTPVAIPEA 3063

Query: 4008 ----GTQTPTTTPITTTTTVTPTPTPT-GTQTPT------TTPIT----TTTTVTPTPTP 4052
                 T   + +P+ T+T V+ +PTP  GT  P       +TP+T    +TT VT +   
Sbjct: 3064 STLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMPISTYSEGSTPLTGVPVSTTPVTSSAIS 3123

Query: 4053 TGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT---------- 4099
            T + TP  T+TP+TT+T    +PT + GT  PT+TP   +T +T  P  T          
Sbjct: 3124 TLSTTPVDTSTPVTTSTEAHSSPTTSEGTSMPTSTPSEGSTPLTYMPVSTMLVVSSEDST 3183

Query: 4100 --GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP---ITTTTTVTPTPTPTG-------- 4146
               T   T+TP+TT+T  T + T  GT  PT+TP   +T  T+V  + TP          
Sbjct: 3184 LSATPVDTSTPVTTSTEATSSTTAEGTSIPTSTPSEGMTPLTSVPVSNTPVASSEASILS 3243

Query: 4147 -TQTPTTTPITTTTTVTPT-PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHTSTA 4204
             T   + TP+TT+T  + + PT  GT  PT+TP   +T +T  P  T         T+ A
Sbjct: 3244 TTPVDSNTPLTTSTEASSSPPTAEGTSMPTSTPSEGSTPLTSMPVST---------TTVA 3294

Query: 4205 PIAELTTSNPPPESSTPQT--SRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTT 4262
                 T S  P ++STP T  S+++SSP     T + T   +   T     S  T P  +
Sbjct: 3295 SSETSTLSTTPADTSTPVTTYSQASSSPPIADGTSMPTSTYSEGSTPLTNMSFSTTPVVS 3354

Query: 4263 SGGHTLSPPPSTTTSPPGTPTRG----TTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPS 4318
            S   TLS  P  T++P  T T      TT   +S PT S  + TT  A  P  T     S
Sbjct: 3355 SEASTLSTTPVDTSTPVTTSTEASLSPTTAEGTSIPTSSPSEGTTPLASMPVSTTPVVSS 3414

Query: 4319 IIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTL--------- 4369
             + T    P  S+ L   V   T  +    +  GT   T      S   ++         
Sbjct: 3415 EVNTLSTTPVDSNTL---VTTSTEASSSPTIAEGTSLPTSTTSEGSTPLSIMPLSTTPVA 3471

Query: 4370 --EFYNWSC----PSTPSPTPTPSKSTPTPSKPSSTPSK-----PTPGTKPP 4410
              E    S      STP  T +P+ S+PT ++ +S P+       TP T  P
Sbjct: 3472 SSEASTLSTTPVDTSTPVTTSSPTNSSPTTAEVTSMPTSTAGEGSTPLTNMP 3523



 Score = 1080 bits (2793), Expect = 0.0
 Identities = 1014/3382 (29%), Positives = 1481/3382 (43%), Gaps = 691/3382 (20%)

Query: 1682 SSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPT 1741
            S  + T  +  T T TT +    P   ++ +T P  T+  S    T  TP  ++T   PT
Sbjct: 56   SQHVRTGSAANTATGTTSTNVVEPRMYLSCSTNPEMTSIESS--VTSDTPGVSSTRMTPT 113

Query: 1742 TTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHK 1801
             + TT   T+ S     T L PS T  T SP   TTP    VP+           P+   
Sbjct: 114  ESRTTSESTSDS-----TTLFPSSTEDTSSP---TTPEGTDVPM---------STPSEES 156

Query: 1802 PGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVI 1861
                   +     P + A  S    +    P+    Q      +       +     G  
Sbjct: 157  ISSTMAFVSTAPLPSFEAYTSLTYKVDMSTPLTTSTQASSSPTTPESTTIPKSTNSEGST 216

Query: 1862 PMAFCLNYEINVQCCECVTQPTT---------------MTTTTTENPTPPTTTPITTTTT 1906
            P+       + V   E +T  TT                + TT E P+   + P   +T 
Sbjct: 217  PLTSMPASTMKVASSEAITLLTTPVEISTPVTISAQASSSPTTAEGPSLSNSAPSGGSTP 276

Query: 1907 VTPTP------------TPTGTQTPTTTPITTTTTVTPTPT-------PTGTQTPTTTPI 1947
            +T  P            T + T   T  P+ T+T  + +PT       PT T T  +TP+
Sbjct: 277  LTRMPLSVMLVVSSEASTLSTTPAATNIPVITSTEASSSPTTAEGTSIPTSTYTEGSTPL 336

Query: 1948 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2007
            T+T   T     +   T + TP+ T+T VT +  P+   T        T+T++   TP  
Sbjct: 337  TSTPASTMPVATSEMSTLSITPVDTSTLVTTSTEPSSLPTTAEATSMLTSTLSEGSTPLT 396

Query: 2008 TQTPTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTP-TT 2059
                +T  + ++   T +  P  ++T  TT       P T   T   T TP+   TP T+
Sbjct: 397  NMPVSTILVASSEASTTSTIPVDSKTFVTTASEASSSPTTAEDTSIATSTPSEGSTPLTS 456

Query: 2060 TPITTT-------TTVTPTPTPTGTQTPTTT-----PITTTTTVTPTPTPTGTQTPTTTP 2107
             P++TT       + ++ TP  + TQ  T+T     P T      PT TP+   TP T+ 
Sbjct: 457  MPVSTTPVASSEASNLSTTPVDSKTQVTTSTEASSSPPTAEVNSMPTSTPSEGSTPLTSM 516

Query: 2108 ITTTTTVTPTPTPTGTQTP--TTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTP 2164
              +T  V  +   T + TP  T+TP+TT++   + + TP GT  PT+TP   +T +T  P
Sbjct: 517  SVSTMPVASSEASTLSTTPVDTSTPVTTSSEASSSSTTPEGTSIPTSTPSEGSTPLTNMP 576

Query: 2165 TPT------GTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTP--- 2208
              T         T +TTP  + T VT        + T  GT  PT+T     TT+T    
Sbjct: 577  VSTRLVVSSEASTTSTTPADSNTFVTTSSEASSSSTTAEGTSMPTSTYSERGTTITSMSV 636

Query: 2209 -------------TPTPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPITT---- 2248
                         + TP  + TP TT    T   TT   T  PT T T  +TP+T+    
Sbjct: 637  STTLVASSEASTLSTTPVDSNTPVTTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSMPVN 696

Query: 2249 TTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPT-------PTGTQTPTTTPIT----TT 2295
            TT V  +   T + TP  T+TP+TT+T  + +PT       PT T +  +TP+T    + 
Sbjct: 697  TTLVASSEASTLSTTPVDTSTPVTTSTEASSSPTTADGASMPTSTPSEGSTPLTSMPVSK 756

Query: 2296 TTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTP-------ITTTTTVT 2345
            T +T +   T + TP  T+T ITT+T  + +PT T GT  P +TP        +   ++T
Sbjct: 757  TLLTSSEASTLSTTPLDTSTHITTSTEASCSPTTTEGTSMPISTPSEGSPLLTSIPVSIT 816

Query: 2346 PTPTPTGTQTPTT-----TPITTTTTVTPTPTPT-GTQTPTTT-----------PITTTT 2388
            P  +P  +   TT     +P+TT+T V+ +PTP  GT  PT+T           P++TT 
Sbjct: 817  PVTSPEASTLSTTPVDSNSPVTTSTEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTL 876

Query: 2389 TVTP-----TPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2436
              T      + TP  T TP T       +P T+  T  PT TP    TP T+   +TT V
Sbjct: 877  VATSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPV 936

Query: 2437 TPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTP------- 2486
              +   T + TP  T+TP+TT+T  T +PT   GT  PT+TP   TT +T TP       
Sbjct: 937  VSSEARTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVA 996

Query: 2487 -----TPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPI----------TTTTTVTP 2530
                 T + T   + TP+TT+T   +P PT  GT  PT+TP            +TT V  
Sbjct: 997  NSEASTLSTTPVDSNTPLTTSTEASSPPPTAEGTSMPTSTPSEGSTPLTRMPVSTTMVAS 1056

Query: 2531 TPTPTGTQTP--TTTPITT-------TTTVTPTPTPTGTQTPTTTPIT----TTTTVTPT 2577
            + T T + TP  T+TP+TT       +TT   T  PT T +  +TP+T    +T  V  +
Sbjct: 1057 SETSTLSTTPADTSTPVTTYSQASSSSTTADGTSMPTSTYSEGSTPLTSVPVSTRLVVSS 1116

Query: 2578 PTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTT---------------- 2618
               T + TP  T+ P+TT+T  + +PT   GT  PT+ P   TT                
Sbjct: 1117 EASTLSTTPVDTSIPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVSTTLVVSSE 1176

Query: 2619 --TVTPTPTPTGTQTPTTT-----PITTTTTVTPTPTPTGTQTPTT------TPITTTTT 2665
              T++ TP  + TQ  T+T     P T   T  PT TP    TP T      TP+ ++  
Sbjct: 1177 ANTLSTTPVDSKTQVATSTEASSPPPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEA 1236

Query: 2666 VTPTPTPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPIT----TTTTVTPTPTP 2718
             T + +P  T TP TT   T+   TT   T  PT T +  +T +T    +TT VT     
Sbjct: 1237 STLSTSPVDTSTPVTTSAETSSSPTTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEAS 1296

Query: 2719 TGTQTPTTT--PITTTTTVTPTPTPT-GTQTPTTT-----------PITTTTTVTP---- 2760
            T   TP  T  P+ T+  V+ +PTP  GT  PT+T           P+ TT   +     
Sbjct: 1297 TLLTTPVDTKGPVVTSNEVSSSPTPAEGTSMPTSTYSEGRTPLTSIPVNTTLVASSAISI 1356

Query: 2761 -TPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTP------TTTPITTTTTVTP 2806
             + TP    TP TT       P T+  T  P   P+   TP      +TTP+ ++   T 
Sbjct: 1357 LSTTPVDNSTPVTTSTEACSSPTTSEGTSMPNSNPSEGTTPLTSIPVSTTPVVSSEASTL 1416

Query: 2807 TPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2859
            + TP  T TP TT    T++ T       PT TP+  +TP  +   + T V  +   T +
Sbjct: 1417 SATPVDTSTPGTTSAEATSSPTTAEGISIPTSTPSEGKTPLKSIPVSNTPVANSEASTLS 1476

Query: 2860 QTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT----------Q 2906
             TP  + +P+ T+T V+ +PTP  GT    +TP   +T +T  P  T T           
Sbjct: 1477 TTPVDSNSPVVTSTAVSSSPTPAEGTSIAISTPSEGSTALTSIPVSTTTVASSEINSLST 1536

Query: 2907 TP--TTTPITTTTTVTPTPT-------PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2957
            TP  T+TP+TT +  + +PT        T T +  +TP+T+    T     +   T +TT
Sbjct: 1537 TPAVTSTPVTTYSQASSSPTTADGTSMQTSTYSEGSTPLTSLPVSTMLVVSSEANTLSTT 1596

Query: 2958 PITTTTTVTPT----------------PTPT-GTQTPTTTPITTTTTVTP-TPTPTGTQT 2999
            PI + T VT +                 TP+ G+   T+ P++TT   +P   T + T  
Sbjct: 1597 PIDSKTQVTASTEASSSTTAEGSSMTISTPSEGSPLLTSIPVSTTPVASPEASTLSTTPV 1656

Query: 3000 PTTTPITTTTTVTPTPTPT-GTQTPTT------TPITT----TTTVTPTPTPTGTQTP-- 3046
             + +P+ T+T V+ +PTP  GT  PT+      TP+T+    TT V  +   T + TP  
Sbjct: 1657 DSNSPVITSTEVSSSPTPAEGTSMPTSTYTEGRTPLTSITVRTTPVASSAISTLSTTPVD 1716

Query: 3047 TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPT 3093
             +TP+TT+T    +PT + GT  P +TP   TT +T  P  T             T   T
Sbjct: 1717 NSTPVTTSTEARSSPTTSEGTSMPNSTPSEGTTPLTSIPVSTTPVLSSEASTLSATPIDT 1776

Query: 3094 TTPITTTTTVTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TT 3140
            +TP+TT+T  T +PT       PT T +   TP+T+T    T V  +   T + TP  + 
Sbjct: 1777 STPVTTSTEATSSPTTAEGTSIPTSTLSEGMTPLTSTPVSHTLVANSEASTLSTTPVDSN 1836

Query: 3141 TPITTTTTVTPTPTPT-GTQTPTTTPI----------TTTTTVTPTPTPTGTQTP--TTT 3187
            +P+ T+T V+ +PTP  GT   T+TP            +TTTV  + T T + TP  T+T
Sbjct: 1837 SPVVTSTAVSSSPTPAEGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLSTTPAVTST 1896

Query: 3188 PITTTTTVTPTPTPT-GTQTPTTT-----------PITTTTTV-----TPTPTPTGTQTP 3230
            P+TT   V+ +PT   G+  PT+T           P++TTT       T + T   T+TP
Sbjct: 1897 PVTTYAQVSSSPTTADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTP 1956

Query: 3231 TTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPI 3281
             TT       P T   T  PTP  +   TP T+   +TT V  +   T + TP  T+TP 
Sbjct: 1957 VTTYSQASSSPTTADGTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTTPVDTSTPA 2016

Query: 3282 TTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT------QTPTTTPITTTTTVT 3334
            TT+T  + +PT   GT   T+TP   TT +   P  T         T +TTP+ + T VT
Sbjct: 2017 TTSTEGSSSPTTAGGTSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVT 2076

Query: 3335 PTPTPTGTQTP-----------------TTTPITTTTTVTP-TPTPTGTQTPTTTPITTT 3376
             +   + + T                  T+ P++TT   +P   T + T   + +P+ T+
Sbjct: 2077 NSTEASSSATAEGSSMTISAPSEGSPLLTSIPLSTTPVASPEASTLSTTPVDSNSPVITS 2136

Query: 3377 TTVTPTPTPT-GT----------QTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTT 3423
            T V+ +P PT GT          +TP T+   +TT V  +   T + TP  T+TP+T +T
Sbjct: 2137 TEVSSSPIPTEGTSMQTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNST 2196

Query: 3424 TVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTT 3470
                +PT + GT  PT+TP   +T  T  P  T             T   T+TP+TT+T 
Sbjct: 2197 EARSSPTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTE 2256

Query: 3471 VTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTTPITTTTTV 3517
             T +PT       PT T +  TTP+T+     T V  +   T + TP  + TP TT+T  
Sbjct: 2257 ATSSPTTAEGTSIPTSTLSEGTTPLTSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEA 2316

Query: 3518 -TPTPTPTGTQTPTTT-----------PITTT-----TTVTPTPTPTGTQTPTTT----- 3555
             +P PT  GT  PT+T           P++TT      T T + TP  T TP TT     
Sbjct: 2317 SSPPPTAEGTSMPTSTSSEGNTPLTRMPVSTTMVASFETSTLSTTPADTSTPVTTYSQAG 2376

Query: 3556 --PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTP 3611
              P T   T  PT T +   TP T+   +T  V  +   T + TP  T+TP+TT+T  + 
Sbjct: 2377 SSPTTADDTSMPTSTYSEGSTPLTSVPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASS 2436

Query: 3612 TPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPT 3658
            +PT   GT  PT+ P   TT +   P  T             T   T+TP+TT+T  + +
Sbjct: 2437 SPTTAEGTSIPTSPPSEGTTPLASMPVSTTPVVSSEAGTLSTTPVDTSTPMTTSTEASSS 2496

Query: 3659 PTPT------------GTQTPTTTPITTTTTVTP-TPTPTGTQTPTTTPITTTTTVTPTP 3705
            PT              G+   T+ P++TT   +P   T + T   + +P+ T+T ++ + 
Sbjct: 2497 PTTAEDIVVPISTASEGSTLLTSIPVSTTPVASPEASTLSTTPVDSNSPVVTSTEISSSA 2556

Query: 3706 TPT-GTQTPTTT----------------PITTTTTVTPTPTPTGTQTPTTT-------PI 3741
            T   GT  PT+T                P+ ++   T + TP  T  P TT       P 
Sbjct: 2557 TSAEGTSMPTSTYSEGSTPLRSMPVSTKPLASSEASTLSTTPVDTSIPVTTSTETSSSPT 2616

Query: 3742 TTTTTVTPTPTPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT- 3794
            T   T  P  TP+   T       +T P+ ++   T + TP  T+T  TT   T+++ T 
Sbjct: 2617 TAKDTSMPISTPSEVSTSLTSILVSTMPVASSEASTLSTTPVDTRTLVTTSTGTSSSPTT 2676

Query: 3795 ------PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTP--- 3843
                  PT TP    TP T  + +TT +  +   T + TP  T+TP+TT+   + +P   
Sbjct: 2677 AEGSSMPTSTPGERSTPLTNILVSTTLLANSEASTLSTTPVDTSTPVTTSAEASSSPTTA 2736

Query: 3844 --------TPTGTQTP------TTTPITTTTTVTPTPTPTGTQTPTTT-------PITTT 3882
                    TP+   TP      +T P+ ++   T + T   T  P TT       P T  
Sbjct: 2737 EGTSMRISTPSDGSTPLTSILVSTLPVASSEASTVSTTAVDTSIPVTTSTEASSSPTTAE 2796

Query: 3883 TTVTPTPTPTGTQTPTT------TPITTTTTVTPTPTPTGTQTPTTT-------PITTTT 3929
             T  PT TP+ T TP T      TP+ ++   T + TP  T TP TT       P T   
Sbjct: 2797 VTSMPTSTPSETSTPLTSMPVNHTPVASSEAGTLSTTPVDTSTPVTTSTKASSSPTTAEG 2856

Query: 3930 TVTPTPTPTGTQT------PTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTT 3976
             V P  T +   T       +TTP+ ++   T + TP  T  P TT       P T   T
Sbjct: 2857 IVVPISTASEGSTLLTSIPVSTTPVASSEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGT 2916

Query: 3977 VTPTPTPTGTQTPTTTPITTTTTV------TPTPTPTGTQTPTTT-------PITTTTTV 4023
              P  TP+   TP T+ + +T  V      T + TP  T+TP TT       P T   T 
Sbjct: 2917 SMPISTPSEVSTPLTSILVSTVPVAGSEASTLSTTPVDTRTPVTTSAEASSSPTTAEGTS 2976

Query: 4024 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQT 4080
             P  TP   +TP T+   +T  V  +   T ++TP  T+TP+TT+T  + +PT   GT  
Sbjct: 2977 MPISTPGERRTPLTSMSVSTMPVASSEASTLSRTPADTSTPVTTSTEASSSPTTAEGTGI 3036

Query: 4081 PTTTPITTTTTVTPTPTPT------------GTQTPTTTPITTTTTVTPTPTPT-GTQTP 4127
            P +TP   +T +T  P  T             T   + +P+ T+T V+ +PTP  GT  P
Sbjct: 3037 PISTPSEGSTPLTSIPVSTTPVAIPEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMP 3096

Query: 4128 T------TTPIT----TTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPT 4174
                   +TP+T    +TT VT +   T + TP  T+TP+TT+T    +PT + GT  PT
Sbjct: 3097 ISTYSEGSTPLTGVPVSTTPVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSEGTSMPT 3156

Query: 4175 TTPITTTTTVTPTPTPT--------GTQTGPPTHTSTAPIAELTTSNPPPESSTPQ-TSR 4225
            +TP   +T +T  P  T         T +  P  TST     +TTS     S+T + TS 
Sbjct: 3157 STPSEGSTPLTYMPVSTMLVVSSEDSTLSATPVDTST----PVTTSTEATSSTTAEGTSI 3212

Query: 4226 STSSPLTESTTLLSTLP----PAIEMTSTAPPSTP---TAPTTTSGGHTLSPPPSTTTS- 4277
             TS+P +E  T L+++P    P     ++   +TP     P TTS   + SPP +  TS 
Sbjct: 3213 PTSTP-SEGMTPLTSVPVSNTPVASSEASILSTTPVDSNTPLTTSTEASSSPPTAEGTSM 3271

Query: 4278 PPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCV 4337
            P  TP+ G+T  +S   + +TV ++ TS  + TP   STP    +      P        
Sbjct: 3272 PTSTPSEGSTPLTSMPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSSPP-------- 3323

Query: 4338 LNDTYYAPGEEVYNGTYGD-TCYFVNCSLSCTLEFYNWSC--------PSTPSPTPTPSK 4388
                  A G  +   TY + +    N S S T    + +          STP  T T + 
Sbjct: 3324 -----IADGTSMPTSTYSEGSTPLTNMSFSTTPVVSSEASTLSTTPVDTSTPVTTSTEAS 3378

Query: 4389 STPTPSKPSSTP-SKPTPGTKP 4409
             +PT ++ +S P S P+ GT P
Sbjct: 3379 LSPTTAEGTSIPTSSPSEGTTP 3400



 Score =  926 bits (2394), Expect = 0.0
 Identities = 828/2733 (30%), Positives = 1214/2733 (44%), Gaps = 367/2733 (13%)

Query: 1263 STLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTP-KLCCLWSDWINEDHPSSGSDDG 1321
            S + T T ++   TP   T+   +T    ST L++ P     + S  IN    +      
Sbjct: 1484 SPVVTSTAVSSSPTPAEGTSIAISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTST 1543

Query: 1322 DRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCYD 1381
               T+     +P   +  S++    S E         VS   +  +E    N       D
Sbjct: 1544 PVTTYSQASSSPTTADGTSMQTSTYS-EGSTPLTSLPVSTMLVVSSE---ANTLSTTPID 1599

Query: 1382 YKIRVNCCWPMDKCITTPSPPTT--TPSPPPTSTTTLPPTTTP-SPPTTTTTTPPPTTTP 1438
             K +V          T      T  TPS      T++P +TTP + P  +T +  P  + 
Sbjct: 1600 SKTQVTASTEASSSTTAEGSSMTISTPSEGSPLLTSIPVSTTPVASPEASTLSTTPVDSN 1659

Query: 1439 SPPITTT---TTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPP 1495
            SP IT+T   ++P P    S P ST T      T     TTP       S  +T +TTP 
Sbjct: 1660 SPVITSTEVSSSPTPAEGTSMPTSTYTEGRTPLTSITVRTTP----VASSAISTLSTTPV 1715

Query: 1496 PTTTPSPPTTTP---ITPPASTTTLPPTTTPSPPTTTTTTPPPTTTP-----------SP 1541
              +T  P TT+     +P  S  T  P +TPS  TT  T+ P +TTP           +P
Sbjct: 1716 DNST--PVTTSTEARSSPTTSEGTSMPNSTPSEGTTPLTSIPVSTTPVLSSEASTLSATP 1773

Query: 1542 -PTTTPITPPTSTTTLPPTTTPSPPPTTTTT---PPPTTTPSPPTTTTPSPPTITTTTPP 1597
              T+TP+T  T  T+ P T   +  PT+T +    P T+TP   T    S  +  +TTP 
Sbjct: 1774 IDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGMTPLTSTPVSHTLVANSEASTLSTTPV 1833

Query: 1598 PTTTP-SPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTT---PSPPPTTTTTPPP 1653
             + +P    T  +++P P    S  T+TP    T+ T++P +TT    S   T +TTP  
Sbjct: 1834 DSNSPVVTSTAVSSSPTPAEGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLSTTPAV 1893

Query: 1654 TTTPSPPTTTTPSPPITTTTTPPPTTTPSS---PITTTPSPPTTTMTTPSPTTTPSSPIT 1710
            T+TP        S P T   +  PT+TP     P+T+   P +TT    S   T S+ + 
Sbjct: 1894 TSTPVTTYAQVSSSPTTADGSSMPTSTPREGRPPLTSI--PVSTTTVASSEINTLSTTLA 1951

Query: 1711 TTTTPSST--TTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTT------SSPLTTTPLP 1762
             T TP +T     S P T   T  PT   S  +T +T++P +TT      +S L+TTP+ 
Sbjct: 1952 DTRTPVTTYSQASSSPTTADGTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTTPVD 2011

Query: 1763 PSITPPTFSPFSTTTP----------------TTPCVPLCNWTGWLDSGKPNF------- 1799
             S TP T S   +++P                TTP   +   T  + S + N        
Sbjct: 2012 TS-TPATTSTEGSSSPTTAGGTSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTPVD 2070

Query: 1800 --HKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKP 1857
               +    TE        G +  IS  +   P +    L  T V       +        
Sbjct: 2071 SKTQVTNSTEASSSATAEGSSMTISAPSEGSPLLTSIPLSTTPVASPEASTLSTTPVDSN 2130

Query: 1858 GGVIPMAFCLNYEINVQCCECVTQPTTMTTTT-TENPTPPTTTPITTTTTV-----TPTP 1911
              VI           V      T+ T+M T+T ++  TP T+ P++TT        T + 
Sbjct: 2131 SPVIT-------STEVSSSPIPTEGTSMQTSTYSDRRTPLTSMPVSTTVVASSAISTLST 2183

Query: 1912 TPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTP-TTTPITTTTTVT-PTPTPTGT 1962
            TP  T TP T       +P T+  T  PT TP+   TP T+ P++T   VT    T + T
Sbjct: 2184 TPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSAT 2243

Query: 1963 QTPTTTPITTTTTVTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP 2011
               T+TP+TT+T  T +PT       PT T +  TTP+T+     T V  +   T + TP
Sbjct: 2244 PVDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGTTPLTSIPVSHTLVANSEVSTLSTTP 2303

Query: 2012 --TTTPITTTTTV-TPTPTPTGTQTPTTT-----------PITTT-----TTVTPTPTPT 2052
              + TP TT+T   +P PT  GT  PT+T           P++TT      T T + TP 
Sbjct: 2304 VDSNTPFTTSTEASSPPPTAEGTSMPTSTSSEGNTPLTRMPVSTTMVASFETSTLSTTPA 2363

Query: 2053 GTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-- 2103
             T TP TT       P T   T  PT T +   TP T+   +T  V  +   T + TP  
Sbjct: 2364 DTSTPVTTYSQAGSSPTTADDTSMPTSTYSEGSTPLTSVPVSTMPVVSSEASTHSTTPVD 2423

Query: 2104 TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2162
            T+TP+TT+T  + +PT   GT  PT+ P   TT +   P        +TTP+ ++   T 
Sbjct: 2424 TSTPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPV-------STTPVVSSEAGTL 2476

Query: 2163 TPTPTGTQTPTTT-------PITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTP-TPTPT 2213
            + TP  T TP TT       P T    V P  T + G+   T+ P++TT   +P   T +
Sbjct: 2477 STTPVDTSTPMTTSTEASSSPTTAEDIVVPISTASEGSTLLTSIPVSTTPVASPEASTLS 2536

Query: 2214 GTQTPTTTPITTTTTVTPTPTPT-GTQTPTTT----------------PITTTTTVTPTP 2256
             T   + +P+ T+T ++ + T   GT  PT+T                P+ ++   T + 
Sbjct: 2537 TTPVDSNSPVVTSTEISSSATSAEGTSMPTSTYSEGSTPLRSMPVSTKPLASSEASTLST 2596

Query: 2257 TPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2313
            TP  T  P TT   T+   TT   T  P  T +  +T +T+    T     +   T +TT
Sbjct: 2597 TPVDTSIPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILVSTMPVASSEASTLSTT 2656

Query: 2314 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2373
            P+ T T VT   T TGT   +++P T   +  PT TP    TP T  + +TT +  +   
Sbjct: 2657 PVDTRTLVT---TSTGT---SSSPTTAEGSSMPTSTPGERSTPLTNILVSTTLLANSEAS 2710

Query: 2374 TGTQTP--TTTPITTTTTVTPTP-----------TPTGTQTP------TTTPITTTTTVT 2414
            T + TP  T+TP+TT+   + +P           TP+   TP      +T P+ ++   T
Sbjct: 2711 TLSTTPVDTSTPVTTSAEASSSPTTAEGTSMRISTPSDGSTPLTSILVSTLPVASSEAST 2770

Query: 2415 PTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2467
             + T   T  P TT       P T   T  PT TP+ T TP T+     T V  +   T 
Sbjct: 2771 VSTTAVDTSIPVTTSTEASSSPTTAEVTSMPTSTPSETSTPLTSMPVNHTPVASSEAGTL 2830

Query: 2468 TQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2524
            + TP  T+TP+TT+T  + +PT   G   P +T    +T +T  P        +TTP+ +
Sbjct: 2831 STTPVDTSTPVTTSTKASSSPTTAEGIVVPISTASEGSTLLTSIPV-------STTPVAS 2883

Query: 2525 TTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTV--- 2574
            +   T + TP  T  P TT       P T   T  P  TP+   TP T+ + +T  V   
Sbjct: 2884 SEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGTSMPISTPSEVSTPLTSILVSTVPVAGS 2943

Query: 2575 ---TPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2624
               T + TP  T+TP TT       P T   T  P  TP   +TP T+   +T  V  + 
Sbjct: 2944 EASTLSTTPVDTRTPVTTSAEASSSPTTAEGTSMPISTPGERRTPLTSMSVSTMPVASSE 3003

Query: 2625 TPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2681
              T ++TP  T+TP+TT+T  + +PT   GT  P +TP   +T +T  P  T   TP   
Sbjct: 3004 ASTLSRTPADTSTPVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTSIPVST---TPVAI 3060

Query: 2682 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPT 2740
            P  +T + TP          + +P+ T+T V+ +PTP  GT  P +T    +T +T  P 
Sbjct: 3061 PEASTLSTTP--------VDSNSPVVTSTEVSSSPTPAEGTSMPISTYSEGSTPLTGVPV 3112

Query: 2741 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTP 2793
                   +TTP+T++   T + TP  T TP TT       P T+  T  PT TP+   TP
Sbjct: 3113 -------STTPVTSSAISTLSTTPVDTSTPVTTSTEAHSSPTTSEGTSMPTSTPSEGSTP 3165

Query: 2794 TTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPTGTQTPTTTP---ITTTT 2848
             T    +T  V  +   T + TP  T+TP+TT+T  T + T  GT  PT+TP   +T  T
Sbjct: 3166 LTYMPVSTMLVVSSEDSTLSATPVDTSTPVTTSTEATSSTTAEGTSIPTSTPSEGMTPLT 3225

Query: 2849 TVTPTPTPTG---------TQTPTTTPITTTTTVTPT-PTPTGTQTPTTTPITTTTTVTP 2898
            +V  + TP           T   + TP+TT+T  + + PT  GT  PT+TP   +T +T 
Sbjct: 3226 SVPVSNTPVASSEASILSTTPVDSNTPLTTSTEASSSPPTAEGTSMPTSTPSEGSTPLTS 3285

Query: 2899 TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2957
             P  T T  +  T+ ++TT   T TP  T +Q  ++ PI   T++ PT T +   TP T 
Sbjct: 3286 MPVSTTTVASSETSTLSTTPADTSTPVTTYSQASSSPPIADGTSM-PTSTYSEGSTPLTN 3344

Query: 2958 PITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPT 3014
               +TT V  +   T + TP  T+TP+TT+T  + +PT   GT  PT++P   TT +   
Sbjct: 3345 MSFSTTPVVSSEASTLSTTPVDTSTPVTTSTEASLSPTTAEGTSIPTSSPSEGTTPLASM 3404

Query: 3015 PTPT------GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3068
            P  T         T +TTP+ + T VT +   + + T        T+T +   TP     
Sbjct: 3405 PVSTTPVVSSEVNTLSTTPVDSNTLVTTSTEASSSPTIAEGTSLPTSTTSEGSTPLSIMP 3464

Query: 3069 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPITTTTT 3125
             +TTP+ ++   T + TP  T TP TT   T    TT   T  PT T    +TP+T    
Sbjct: 3465 LSTTPVASSEASTLSTTPVDTSTPVTTSSPTNSSPTTAEVTSMPTSTAGEGSTPLTNMPV 3524

Query: 3126 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3185
             T     +   T +TTP+ + T V  T +   + +P T  +TT    TP+    G+ + T
Sbjct: 3525 STTPVASSEASTLSTTPVDSNTFV--TSSSQASSSPATLQVTTMRMSTPS---EGSSSLT 3579

Query: 3186 TTPITTT-TTVTPTPTPTGTQTPTTTPITTTT--TVTPTP---------TPTGTQTPTTT 3233
            T  +++T  T +   TP+      +TP+TT+T    TPTP         TP+   TP T 
Sbjct: 3580 TMLLSSTYVTSSEASTPSTPSVDRSTPVTTSTQSNSTPTPPEVITLPMSTPSEVSTPLTI 3639

Query: 3234 PITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTP-TPTGTQTPTTTPITTTTTVTPT 3290
               +TT+VT +   T +  P  T+TP+ T+T V+ +P TP GT  P  TP   +T +T  
Sbjct: 3640 MPVSTTSVTISEAGTASTLPVDTSTPVITSTQVSSSPVTPEGTTMPIWTPSEGSTPLTTM 3699

Query: 3291 PTPTGTQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3349
            P  T   T +  + ++T + VT TP  T T+  +++    +TT++    P    T  TT 
Sbjct: 3700 PVSTTRVTSSEGSTLSTPSVVTSTPVTTSTEAISSSATLDSTTMS-VSMPMEISTLGTTI 3758

Query: 3350 ITTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTT-------TT 3401
            + +TT VT  P  +    P+  T ++ TT    + +PT  +  TT P++TT       TT
Sbjct: 3759 LVSTTPVTRFPESSTPSIPSVYTSMSMTTASEGSSSPTTLEGTTTMPMSTTSERSTLLTT 3818

Query: 3402 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 3461
            V  +P    + +  +T ++T    T TP  T T+  + +     TT+  + T +   TP 
Sbjct: 3819 VLISPISVMSPSEAST-LSTPPGDTSTPLLTSTKAGSFSIPAEVTTIRISIT-SERSTPL 3876

Query: 3462 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT------- 3514
            TT + +TT  T  P   G    +T P+ T+TT TP+   T T +  T P+ TT       
Sbjct: 3877 TTLLVSTTLPTSFP---GASIASTPPLDTSTTFTPS---TDTASTPTIPVATTISVSVIT 3930

Query: 3515 ------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3568
                  TT+    TP  + T    P TT    TP  T T   TP+T+  +TTT+ + T  
Sbjct: 3931 EGSTPGTTIFIPSTPVTSSTADVFPATTGAVSTPVITSTELNTPSTSSSSTTTSFSTTKE 3990

Query: 3569 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT- 3627
             T     T  P+T  T  T   TP  T    T   T+ +T++ T TP  + + TT P+T 
Sbjct: 3991 FTTPAMTTAAPLTYVTMSTAPSTPRTTSRGCT---TSASTLSATSTPHTSTSVTTRPVTP 4047

Query: 3628 ----------TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3677
                      T+ T+ PT  P  + TP TT  ++TT     P    T T  T P T TT+
Sbjct: 4048 SSESSRPSTITSHTIPPTFPPAHSSTPPTTSASSTTV---NPEAVTTMTTRTKPSTRTTS 4104

Query: 3678 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3710
                PT T T  PT T I +  T TPT   T T
Sbjct: 4105 F---PTVTTTAVPTNTTIKSNPTSTPTVPRTTT 4134



 Score =  890 bits (2301), Expect = 0.0
 Identities = 794/2605 (30%), Positives = 1183/2605 (45%), Gaps = 441/2605 (16%)

Query: 2213 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2272
            TG+   T T  T+T  V P    + +  P  T I ++ T         + TP  +    T
Sbjct: 61   TGSAANTATGTTSTNVVEPRMYLSCSTNPEMTSIESSVT---------SDTPGVSSTRMT 111

Query: 2273 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI-----TTTTTVTPTPTP 2327
             T + T + + + + T  P +T  T +PT TP GT  P +TP      +T   V+  P P
Sbjct: 112  PTESRTTSESTSDSTTLFPSSTEDTSSPT-TPEGTDVPMSTPSEESISSTMAFVSTAPLP 170

Query: 2328 TGT-------QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 2380
            +         +   +TP+TT+T  + +PT     TP +T I  +T  +   TP  +   +
Sbjct: 171  SFEAYTSLTYKVDMSTPLTTSTQASSSPT-----TPESTTIPKSTN-SEGSTPLTSMPAS 224

Query: 2381 TTPITTTTTVTPTPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPITTT 2433
            T  + ++  +T   TP    TP T       +P T          P+G  TP T    + 
Sbjct: 225  TMKVASSEAITLLTTPVEISTPVTISAQASSSPTTAEGPSLSNSAPSGGSTPLTRMPLSV 284

Query: 2434 TTVTPTPTPTGTQTPTTT--PITTTTTVTPTPT-------PTGTQTPTTTPITTTTTVTP 2484
              V  +   T + TP  T  P+ T+T  + +PT       PT T T  +TP+T+T   T 
Sbjct: 285  MLVVSSEASTLSTTPAATNIPVITSTEASSSPTTAEGTSIPTSTYTEGSTPLTSTPASTM 344

Query: 2485 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2544
                +   T + TP+ T+T VT +  P+   T        T+T++   TP      +T  
Sbjct: 345  PVATSEMSTLSITPVDTSTLVTTSTEPSSLPTTAEATSMLTSTLSEGSTPLTNMPVSTIL 404

Query: 2545 ITTTTTVTPTPTPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTP-TTTPITTT-- 2594
            + ++   T +  P  ++T  TT       P T   T   T TP+   TP T+ P++TT  
Sbjct: 405  VASSEASTTSTIPVDSKTFVTTASEASSSPTTAEDTSIATSTPSEGSTPLTSMPVSTTPV 464

Query: 2595 -----TTVTPTPTPTGTQTPTTT-----PITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2644
                 + ++ TP  + TQ  T+T     P T      PT TP+   TP T+   +T  V 
Sbjct: 465  ASSEASNLSTTPVDSKTQVTTSTEASSSPPTAEVNSMPTSTPSEGSTPLTSMSVSTMPVA 524

Query: 2645 PTPTPTGTQTP--TTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTPT----- 2696
             +   T + TP  T+TP+TT++   + + TP GT  PT+TP   +T +T  P  T     
Sbjct: 525  SSEASTLSTTPVDTSTPVTTSSEASSSSTTPEGTSIPTSTPSEGSTPLTNMPVSTRLVVS 584

Query: 2697 -GTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTP----------- 2737
                T +TTP  + T VT        + T  GT  PT+T     TT+T            
Sbjct: 585  SEASTTSTTPADSNTFVTTSSEASSSSTTAEGTSMPTSTYSERGTTITSMSVSTTLVASS 644

Query: 2738 -----TPTPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPITT----TTTVTPTP 2785
                 + TP  + TP TT    T   TT   T  PT T T  +TP+T+    TT V  + 
Sbjct: 645  EASTLSTTPVDSNTPVTTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSMPVNTTLVASSE 704

Query: 2786 TPTGTQTP--TTTPITTTTTVTPTPT-------PTGTQTPTTTPIT----TTTTVTPTPT 2832
              T + TP  T+TP+TT+T  + +PT       PT T +  +TP+T    + T +T +  
Sbjct: 705  ASTLSTTPVDTSTPVTTSTEASSSPTTADGASMPTSTPSEGSTPLTSMPVSKTLLTSSEA 764

Query: 2833 PTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTP-------ITTTTTVTPTPTPTGT 2882
             T + TP  T+T ITT+T  + +PT T GT  P +TP        +   ++TP  +P  +
Sbjct: 765  STLSTTPLDTSTHITTSTEASCSPTTTEGTSMPISTPSEGSPLLTSIPVSITPVTSPEAS 824

Query: 2883 QTPTT-----TPITTTTTVTPTPTPT-GTQTPTTT-----------PITTTTTVTP---- 2921
               TT     +P+TT+T V+ +PTP  GT  PT+T           P++TT   T     
Sbjct: 825  TLSTTPVDSNSPVTTSTEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTLVATSAIST 884

Query: 2922 -TPTPTGTQTPTT-------TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2973
             + TP  T TP T       +P T+  T  PT TP    TP T+   +TT V  +   T 
Sbjct: 885  LSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTL 944

Query: 2974 TQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTP------------TPT 3018
            + TP  T+TP+TT+T  T +PT   GT  PT+TP   TT +T TP            T +
Sbjct: 945  SATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEASTLS 1004

Query: 3019 GTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3077
             T   + TP+TT+T   +P PT  GT  PT+TP   +T +T  P        +TT + ++
Sbjct: 1005 TTPVDSNTPLTTSTEASSPPPTAEGTSMPTSTPSEGSTPLTRMPV-------STTMVASS 1057

Query: 3078 TTVTPTPTPTGTQTPTTT---PITTTTTVTPTPTPTGTQTPTTTPIT----TTTTVTPTP 3130
             T T + TP  T TP TT     +++TT   T  PT T +  +TP+T    +T  V  + 
Sbjct: 1058 ETSTLSTTPADTSTPVTTYSQASSSSTTADGTSMPTSTYSEGSTPLTSVPVSTRLVVSSE 1117

Query: 3131 TPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTT----------------- 3170
              T + TP  T+ P+TT+T  + +PT   GT  PT+ P   TT                 
Sbjct: 1118 ASTLSTTPVDTSIPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVSTTLVVSSEA 1177

Query: 3171 -TVTPTPTPTGTQTPTTT-----PITTTTTVTPTPTPTGTQTPTT------TPITTTTTV 3218
             T++ TP  + TQ  T+T     P T   T  PT TP    TP T      TP+ ++   
Sbjct: 1178 NTLSTTPVDSKTQVATSTEASSPPPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEAS 1237

Query: 3219 TPTPTPTGTQTPTTTPITTT---TTVTPTPTPTGTQTPTTTPIT----TTTTVTPTPTPT 3271
            T + +P  T TP TT   T+   TT   T  PT T +  +T +T    +TT VT     T
Sbjct: 1238 TLSTSPVDTSTPVTTSAETSSSPTTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEAST 1297

Query: 3272 GTQTPTTT--PITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT----------- 3317
               TP  T  P+ T+  V+ +PTP  GT  PT+T     T +T  P  T           
Sbjct: 1298 LLTTPVDTKGPVVTSNEVSSSPTPAEGTSMPTSTYSEGRTPLTSIPVNTTLVASSAISIL 1357

Query: 3318 -GTQTPTTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3375
              T    +TP+TT+T    +PT + GT  P + P   TT +T  P        +TTP+ +
Sbjct: 1358 STTPVDNSTPVTTSTEACSSPTTSEGTSMPNSNPSEGTTPLTSIPV-------STTPVVS 1410

Query: 3376 TTTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTPT 3428
            +   T + TP  T TP TT    T++ T       PT TP+  +TP  +   + T V  +
Sbjct: 1411 SEASTLSATPVDTSTPGTTSAEATSSPTTAEGISIPTSTPSEGKTPLKSIPVSNTPVANS 1470

Query: 3429 PTPTGTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT-QTPT 3484
               T + TP  + +P+ T+T V+ +PTP  GT    +TP   +T +T  P  T T  +  
Sbjct: 1471 EASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSIAISTPSEGSTALTSIPVSTTTVASSE 1530

Query: 3485 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITT------- 3536
               ++TT  VT TP  T +Q  +++P T   T   T T +   TP T+ P++T       
Sbjct: 1531 INSLSTTPAVTSTPVTTYSQA-SSSPTTADGTSMQTSTYSEGSTPLTSLPVSTMLVVSSE 1589

Query: 3537 TTTVTPTPTPTGTQTPTTTPITTTTT-----VTPTPTPTGTQTPTTTPITTTTTVTP-TP 3590
              T++ TP  + TQ   +T  +++TT     +T +    G+   T+ P++TT   +P   
Sbjct: 1590 ANTLSTTPIDSKTQVTASTEASSSTTAEGSSMTISTPSEGSPLLTSIPVSTTPVASPEAS 1649

Query: 3591 TPTGTQTPTTTPITTTTTVTPTPTPT-GTQTPTT------TPITT----TTTVTPTPTPT 3639
            T + T   + +P+ T+T V+ +PTP  GT  PT+      TP+T+    TT V  +   T
Sbjct: 1650 TLSTTPVDSNSPVITSTEVSSSPTPAEGTSMPTSTYTEGRTPLTSITVRTTPVASSAIST 1709

Query: 3640 GTQTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT----------- 3685
             + TP   +TP+TT+T    +PT + GT  P +TP   TT +T  P  T           
Sbjct: 1710 LSTTPVDNSTPVTTSTEARSSPTTSEGTSMPNSTPSEGTTPLTSIPVSTTPVLSSEASTL 1769

Query: 3686 -GTQTPTTTPITTTTTVTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGT 3733
              T   T+TP+TT+T  T +PT       PT T +   TP+T+T    T V  +   T +
Sbjct: 1770 SATPIDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGMTPLTSTPVSHTLVANSEASTLS 1829

Query: 3734 QTP--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT-QTPTTTPITT 3789
             TP  + +P+ T+T V+ +PTP  GT   T+TP   +T +T  P  T T  +  T  ++T
Sbjct: 1830 TTPVDSNSPVVTSTAVSSSPTPAEGTSIATSTPSEGSTALTSIPVSTTTVASSETNTLST 1889

Query: 3790 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTV-----TPTP 3843
            T  VT TP  T  Q  +++P T   +  PT TP   + P T+ P++TTT       T + 
Sbjct: 1890 TPAVTSTPVTTYAQV-SSSPTTADGSSMPTSTPREGRPPLTSIPVSTTTVASSEINTLST 1948

Query: 3844 TPTGTQTPTTT-------PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3896
            T   T+TP TT       P T   T  PTP  +   TP T+   +TT V  +   T + T
Sbjct: 1949 TLADTRTPVTTYSQASSSPTTADGTSMPTPAYSEGSTPLTSMPLSTTLVVSSEASTLSTT 2008

Query: 3897 P--TTTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPTGT------QTPTTTP 3947
            P  T+TP TT+T  + +PT   GT   T+TP   TT +   P  T         T +TTP
Sbjct: 2009 PVDTSTPATTSTEGSSSPTTAGGTSIQTSTPSERTTPLAGMPVSTTLVVSSEGNTLSTTP 2068

Query: 3948 ITTTTTVTPTPTPTGTQTP-----------------TTTPITTTTTVTP-TPTPTGTQTP 3989
            + + T VT +   + + T                  T+ P++TT   +P   T + T   
Sbjct: 2069 VDSKTQVTNSTEASSSATAEGSSMTISAPSEGSPLLTSIPLSTTPVASPEASTLSTTPVD 2128

Query: 3990 TTTPITTTTTVTPTPTPT-GT----------QTPTTTPITTTTTVTPTPTPTGTQTP--T 4036
            + +P+ T+T V+ +P PT GT          +TP T+   +TT V  +   T + TP  T
Sbjct: 2129 SNSPVITSTEVSSSPIPTEGTSMQTSTYSDRRTPLTSMPVSTTVVASSAISTLSTTPVDT 2188

Query: 4037 TTPITTTTTVTPTPTPT-GTQTPTTTPITTTTTVTPTPTPT------------GTQTPTT 4083
            +TP+T +T    +PT + GT  PT+TP   +T  T  P  T             T   T+
Sbjct: 2189 STPVTNSTEARSSPTTSEGTSMPTSTPSEGSTPFTSMPVSTMPVVTSEASTLSATPVDTS 2248

Query: 4084 TPITTTTTVTPTPT-------PTGTQTPTTTPITTT----TTVTPTPTPTGTQTP--TTT 4130
            TP+TT+T  T +PT       PT T +  TTP+T+     T V  +   T + TP  + T
Sbjct: 2249 TPVTTSTEATSSPTTAEGTSIPTSTLSEGTTPLTSIPVSHTLVANSEVSTLSTTPVDSNT 2308

Query: 4131 PITTTTTV-TPTPTPTGTQTPTT------TPIT----TTTTVTPTPTPTGTQTP--TTTP 4177
            P TT+T   +P PT  GT  PT+      TP+T    +TT V    T T + TP  T+TP
Sbjct: 2309 PFTTSTEASSPPPTAEGTSMPTSTSSEGNTPLTRMPVSTTMVASFETSTLSTTPADTSTP 2368

Query: 4178 ITT-------TTTVTPTPTPTGTQTGPPTHTSTAPIAEL--------TTSNPPPESSTPQ 4222
            +TT        TT   T  PT T +   T  ++ P++ +        T S  P ++STP 
Sbjct: 2369 VTTYSQAGSSPTTADDTSMPTSTYSEGSTPLTSVPVSTMPVVSSEASTHSTTPVDTSTPV 2428

Query: 4223 T--SRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPG 4280
            T  + ++SSP T   T + T PP+   T  A     T P  +S   TLS  P  T++P  
Sbjct: 2429 TTSTEASSSPTTAEGTSIPTSPPSEGTTPLASMPVSTTPVVSSEAGTLSTTPVDTSTPMT 2488

Query: 4281 TPTRGTTTGS---------SSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSS 4331
            T T  +++ +         S+A   ST+ T+   + TP  +P    S + TT +      
Sbjct: 2489 TSTEASSSPTTAEDIVVPISTASEGSTLLTSIPVSTTPVASP--EASTLSTTPVDSNSPV 2546

Query: 4332 VLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSK--- 4388
            V    + +    A G  +   TY +    +  S+  + +    S  ST S TP  +    
Sbjct: 2547 VTSTEISSSATSAEGTSMPTSTYSEGSTPLR-SMPVSTKPLASSEASTLSTTPVDTSIPV 2605

Query: 4389 --STPTPSKPSSTPSKPTPGTKPPE 4411
              ST T S P++      P + P E
Sbjct: 2606 TTSTETSSSPTTAKDTSMPISTPSE 2630



 Score =  161 bits (407), Expect = 2e-38
 Identities = 161/521 (30%), Positives = 220/521 (42%), Gaps = 101/521 (19%)

Query: 1402 PTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTT-------------- 1447
            P  TPS   T  TT+P +TT    +  +T   P+   S P+TT+T               
Sbjct: 3685 PIWTPSEGSTPLTTMPVSTTRVTSSEGSTLSTPSVVTSTPVTTSTEAISSSATLDSTTMS 3744

Query: 1448 ---PPPTTTPSPPISTTTTP----PPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP 1500
               P   +T    I  +TTP    P ++TPS P+   S   TT S  +++ TT   TTT 
Sbjct: 3745 VSMPMEISTLGTTILVSTTPVTRFPESSTPSIPSVYTSMSMTTASEGSSSPTTLEGTTTM 3804

Query: 1501 SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTT---------------- 1544
               TT+  +   +T  + P +  SP   +T + PP  T +P  T                
Sbjct: 3805 PMSTTSERSTLLTTVLISPISVMSPSEASTLSTPPGDTSTPLLTSTKAGSFSIPAEVTTI 3864

Query: 1545 ---------TPITPPTSTTTLPPT-----TTPSPPPTTTTTPPPTT----TPSPPTTTTP 1586
                     TP+T    +TTLP +        +PP  T+TT  P+T    TP+ P  TT 
Sbjct: 3865 RISITSERSTPLTTLLVSTTLPTSFPGASIASTPPLDTSTTFTPSTDTASTPTIPVATTI 3924

Query: 1587 SPPTITTTTPPPTTT--PSPPTTTTTTP--PPTT----TP---SPPTTTPITPPTSTTTL 1635
            S   IT  + P TT   PS P T++T    P TT    TP   S    TP T  +STTT 
Sbjct: 3925 SVSVITEGSTPGTTIFIPSTPVTSSTADVFPATTGAVSTPVITSTELNTPSTSSSSTTTS 3984

Query: 1636 PPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTT 1695
              TT     P  TT  P T        T  + P T  TT    TT +S ++ T +P T+T
Sbjct: 3985 FSTTKEFTTPAMTTAAPLT------YVTMSTAPSTPRTTSRGCTTSASTLSATSTPHTST 4038

Query: 1696 MTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPT------TTMT--TL 1747
              T  P T  S     +T  S T  P+ PP   +TP PTT+ S  T      TTMT  T 
Sbjct: 4039 SVTTRPVTPSSESSRPSTITSHTIPPTFPPAHSSTP-PTTSASSTTVNPEAVTTMTTRTK 4097

Query: 1748 PPT-TTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDT 1806
            P T TTS P  TT   P+ T    +P  T+TPT P    C   G  ++   +  K GG  
Sbjct: 4098 PSTRTTSFPTVTTTAVPTNTTIKSNP--TSTPTVPRTTTCFGDGCQNTA--SRCKNGGTW 4153

Query: 1807 ELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVG 1847
            +             + C+    P++  G+L + VV  + +G
Sbjct: 4154 D------------GLKCQC---PNLYYGELCEEVVSSIDIG 4179



 Score = 41.6 bits (96), Expect = 0.021
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 21/113 (18%)

Query: 1257 SITTRPSTLTTFTTITLPTTPTT-FTTTTTTTTPTSSTVLS------TTPKLCCLWSDWI 1309
            S T  P  +TT TT T P+T TT F T TTT  PT++T+ S      T P+    + D  
Sbjct: 4081 STTVNPEAVTTMTTRTKPSTRTTSFPTVTTTAVPTNTTIKSNPTSTPTVPRTTTCFGDGC 4140

Query: 1310 NEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVG 1362
                 ++ S   +  T+DG       ++C+    P+L   +L ++V   + +G
Sbjct: 4141 Q----NTASRCKNGGTWDG-------LKCQC---PNLYYGELCEEVVSSIDIG 4179


>gi|151301154 mucin 6, gastric [Homo sapiens]
          Length = 2439

 Score = 1191 bits (3080), Expect = 0.0
 Identities = 847/2482 (34%), Positives = 1197/2482 (48%), Gaps = 284/2482 (11%)

Query: 37   CSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVE--SI 94
            CSTWG  H+ TFD  V+ F G C+Y FA+ C+ ++  F+V L+RGP  + +   VE  + 
Sbjct: 45   CSTWGAGHFSTFDHHVYDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSISRIIVELGAS 104

Query: 95   LLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRA---GLTLMWNRED 151
            ++T+ +  I      +V +  V+S P+ S GL I       ++ ++     L ++W  + 
Sbjct: 105  VVTVSEAII------SVKDIGVISLPYTSNGLQITPFGQSVRLVAKQLELELEVVWGPDS 158

Query: 152  ALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSD-GVLFSPLEFGNMQKINQPDVVCEDPE 210
             LM+ ++ K+    CGLCG+++G  + +EF+S+ G    P +F  +QK++ P  +C   +
Sbjct: 159  HLMVLVERKYMGQMCGLCGNFDGKVT-NEFVSEEGKFLEPHKFAALQKLDDPGEICTFQD 217

Query: 211  EEVAPASCSEHRAECERLLTAEAFADCQDLVPLEPYLRACQQDRCRCP--GGDTCVCSTV 268
                    ++H   C +LLT  A  +C   V  EP++ +CQ D    P  G     C+T+
Sbjct: 218  IPSTHVRQAQHARICTQLLTLVA-PECS--VSKEPFVLSCQADVAAAPQPGPQNSSCATL 274

Query: 269  AEFSRQCSHAGGRPGNWRTATLCPK-TCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMD 327
            +E+SRQCS  G     WR+  LC    CP N VY E GS C+ TCS+ + S  C      
Sbjct: 275  SEYSRQCSMVGQPVRRWRSPGLCSVGQCPANQVYQECGSACVKTCSNPQHS--CSSSCTF 332

Query: 328  GCFCPEGTVYDDIGDSG-CVPVSQCHCRLHGHLYTPGQEITNDCEQCVCNAGRWVCKDLP 386
            GCFCPEGTV +D+ ++  CVPV+QC C LHG +Y PG+     C+ C C  GRWVC + P
Sbjct: 333  GCFCPEGTVLNDLSNNHTCVPVTQCPCVLHGAMYAPGEVTIAACQTCRCTLGRWVCTERP 392

Query: 387  CPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKGDH-NDSYALLGELAPCGSTDKQTCLK 445
            CPG C+LEGGS +TTFD + Y FHG C Y+L +     +  AL+      G +  +T L 
Sbjct: 393  CPGHCSLEGGSFVTTFDARPYRFHGTCTYILLQSPQLPEDGALMAVYDKSGVSHSETSLV 452

Query: 446  TVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQ 505
             VV L+ + K  +V   D  V  N     LP+ T + +VFR +S H+ ++ + G+ L VQ
Sbjct: 453  AVVYLSRQDK--IVISQDEVVTNNGEAKWLPYKTRNITVFRQTSTHLQMATSFGLELVVQ 510

Query: 506  LAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHD 565
            L P+ Q +VT+    +GQ +GLCGNFNG   DDF T+ G+ E T + F ++W+A  +C  
Sbjct: 511  LRPIFQAYVTVGPQFRGQTRGLCGNFNGDTTDDFTTSMGIAEGTASLFVDSWRA-GNCPA 569

Query: 566  KLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNE 625
             L+   DPCS++  +   AE  CS+L +T T F RCH+ V+PA +YKRC Y  CN +   
Sbjct: 570  ALERETDPCSMSQLNKVCAETHCSMLLRTGTVFERCHATVNPAPFYKRCVYQACNYEETF 629

Query: 626  DCLCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEAD 685
              +CAAL  Y  AC+ +GV+LWGWR  V N  +  C  +  F YN   C++TC SLS+  
Sbjct: 630  PHICAALGDYVHACSLRGVLLWGWRSSVDNCTI-PCTGNTTFSYNSQACERTCLSLSDRA 688

Query: 686  SHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGL-YLEAGDVVVRQEERCVCRD 744
            + C     PVDGC CPD T+L++KG CV  A+C C   G  ++ A    V     C C +
Sbjct: 689  TECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCILEGYKFILAEQSTVINGITCHCIN 748

Query: 745  GRLHCRQI-RLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGY--YHTECVSGCV 801
            GRL C Q  ++   SC APK    CS  +        A +CQ LA G     T+C  GCV
Sbjct: 749  GRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACAPTCQMLATGVACVPTKCEPGCV 808

Query: 802  CPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAV-CHGTC 860
            C +GL ++  G CV  +ECPC  +   Y  GA++  DC TC+C RGRW C Q   C  TC
Sbjct: 809  CAEGLYENADGQCVPPEECPCEFSGVSYPGGAELHTDCRTCSCSRGRWACQQGTHCPSTC 868

Query: 861  SIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAI 920
            ++YG GH ITFDG+ + FDG+C Y+   D CG N S  +F I+TENV CG +GVTCS+AI
Sbjct: 869  TLYGEGHVITFDGQRFVFDGNCEYILATDVCGVNDSQPTFKILTENVICGNSGVTCSRAI 928

Query: 921  KIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESST----GIIVIWDKRTTV 976
            KIF+G   + L D++  V    E  HV          LVV+ S      + +IW++  T+
Sbjct: 929  KIFLGGLSVVLADRNYTVT--GEEPHVQLGVTPGALSLVVDISIPGRYNLTLIWNRHMTI 986

Query: 977  FIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEP 1036
             I++A + +  +CGLCGNF+    +DF TR   V SSEL+  NSWKE+P C DVS   +P
Sbjct: 987  LIRIARASQDPLCGLCGNFNGNMKDDFETRSRYVASSELELVNSWKESPLCGDVSFVTDP 1046

Query: 1037 CSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVA 1096
            CSLN  RRSWAE++CS++ S  F+ CHSKV   P+YEACV D+C CD+GGDCEC C AVA
Sbjct: 1047 CSLNAFRRSWAERKCSVINSQTFATCHSKVYHLPYYEACVRDACGCDSGGDCECLCDAVA 1106

Query: 1097 SYAQECTKEGACVFWRTPDLCPIFCDYYNPPHE-------------CEWHYEPCGNRSFE 1143
            +YAQ C  +G CV WRTP  CPI+C +YN   +             C WHY+PC      
Sbjct: 1107 AYAQACLDKGVCVDWRTPAFCPIYCGFYNTHTQDGHGEYQYTQEANCTWHYQPC------ 1160

Query: 1144 TCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVP 1203
                      ++  S +EGCY  C +D   ++ +   CV      C    T  PP  + P
Sbjct: 1161 ---LCPSQPQSVPGSNIEGCY-NCSQDE-YFDHEEGVCVP-----CMPPTTPQPP--TTP 1208

Query: 1204 TEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITTRPS 1263
               T  S           RP +              W + G + T+     + S +T PS
Sbjct: 1209 QLPTTGS-----------RPTQ-------------VWPMTGTSTTI----GLLS-STGPS 1239

Query: 1264 TLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDDGDR 1323
              +  T  + PT       T T++ PT+S+     P              P + S     
Sbjct: 1240 PSSNHTPAS-PTQTPLLPATLTSSKPTASSGEPPRPTTAVT---------PQATSGLPPT 1289

Query: 1324 ETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCYDYK 1383
             T       P   +  +      +        Q               G  P        
Sbjct: 1290 ATLRSTATKPTVTQATTRATASTASPATTSTAQSTTRTTMTLPTPATSGTSP-----TLP 1344

Query: 1384 IRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPIT 1443
               N   P      T  P  T  S   T+  T P    P+ PT T TT   TTT      
Sbjct: 1345 KSTNQELPGTTATQTTGPRPTPAS---TTGPTTPQPGQPTRPTATETTQTRTTT-----E 1396

Query: 1444 TTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPT-TTPSPPTTTTTTPPP---TTT 1499
             TT   P TT SPP  T  +P P+T P   T+  +  T  TPS P TT  T  P   T+ 
Sbjct: 1397 YTTPQTPHTTHSPP--TAGSPVPSTGPVTATSFHATTTYPTPSHPETTLPTHVPPFSTSL 1454

Query: 1500 PSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTT---TPSPPTTTPITPPTSTTTL 1556
             +P T T ITP   T     T+  +    T T PPPTT   T S  T  PITP TS T+ 
Sbjct: 1455 VTPSTHTVITP---THAQMATSASNHSAPTGTIPPPTTLKATGSTHTAPPITPTTSGTSQ 1511

Query: 1557 PPTT-TPSPPPT-----TTTTPPPTTTPSPPTTTTPSPPTITTTT-------------PP 1597
              ++ + +  PT     T++T  P  TP+  TT TP+P +  T T             PP
Sbjct: 1512 AHSSFSTNKTPTSLHSHTSSTHHPEVTPTSTTTITPNPTSTRTRTPVAHTNSATSSRPPP 1571

Query: 1598 PTTTPSPPTTT---TTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPT 1654
            P TT SPPT +   ++T P T T    TTT  TP    TTLP   T  PP +T+   P T
Sbjct: 1572 PFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSHPQTTLP---THVPPFSTSLVTPST 1628

Query: 1655 TTPSPPT-----TTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPI 1709
             T   PT     T+     + T T PPPTT  ++  T T   PT T+TT   +   SS  
Sbjct: 1629 HTVITPTHAQMATSASIHSMPTGTIPPPTTLKATGSTHT--APTMTLTTSGTSQALSSLN 1686

Query: 1710 TTTTTPS-----STTTPSPPPTTMT---TPSPTTTPSPP---TTTMTTLPPTTTSSPLTT 1758
            T  T+ S     S+T  +   +T T   TP+PT+T +PP   TT+ T+   ++ S+  T+
Sbjct: 1687 TAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVTTSGTSQSRSSFSTAKTS 1746

Query: 1759 TPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWA 1818
            T L  S T  T  P  T+T TT             S  PN    G  T +         A
Sbjct: 1747 TSL-HSHTSSTHHPEVTSTSTT-------------SITPNHTSTGTRTPV---------A 1783

Query: 1819 ANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCEC 1878
               S  ++  P         T    +S            G V   +F             
Sbjct: 1784 HTTSATSSRLPTPFTTHSPPTGTTPIS----------STGPVTATSFQTTTTYPTPSHPH 1833

Query: 1879 VTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPT-----PTGTQTPTTTPITTTTTVTP- 1932
             T PT + + +T   TP T T I  T T   T       PTGT  P TT   T +T T  
Sbjct: 1834 TTLPTHVPSFSTSLVTPSTHTVIIPTHTQMATSASIHSMPTGTIPPPTTIKATGSTHTAP 1893

Query: 1933 --TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 1989
              TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T TGT+TP 
Sbjct: 1894 PMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTSTGTRTPV 1951

Query: 1990 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2049
                TT+ + +  PTP  T +P T             +P  +  P T     TTT  PTP
Sbjct: 1952 AH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQTTTTYPTP 1998

Query: 2050 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTPTGTQTPT 2104
            +   T  PT  P  +T+ VTP+         T T I TT T   T      TPTGT  P 
Sbjct: 1999 SHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTPTGTVPPP 2049

Query: 2105 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2164
            TT   T +T T  P      T TT+  + T +   T T + +   +++ +   ++  P  
Sbjct: 2050 TTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSSRPPS 2104

Query: 2165 TPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQT 2217
            +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P+   + +
Sbjct: 2105 SPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVGTSSS 2164

Query: 2218 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2277
              + P+ +TT  + + +   T  PTT  + + + + P+     T    T P T ++  T 
Sbjct: 2165 FVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHTISSPFTL 2222

Query: 2278 T---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 2334
            +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T   T   T+ PT
Sbjct: 2223 SALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPT 2282

Query: 2335 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2394
            +  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +T++ T   + 
Sbjct: 2283 SGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFLTSSLTAHGS- 2328

Query: 2395 TPTGTQTPTTTPITTTTTVTPT 2416
                  TP + P+++  T TPT
Sbjct: 2329 ------TPASAPVSSLGTPTPT 2344



 Score =  455 bits (1170), Expect = e-127
 Identities = 392/1229 (31%), Positives = 567/1229 (46%), Gaps = 133/1229 (10%)

Query: 2047 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2105
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2106 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2162
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2163 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2217
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2218 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2272
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2273 -TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2331
             TT  PTP+   T  PT  P  +T+ VTP+ T T   TPT   + T+ +    PT T   
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPS-THT-VITPTHAQMATSASNHSAPTGT-IP 1485

Query: 2332 TPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2389
             PTT   T +T   P  TPT +GT    ++  T  T  +     + T  P  TP T+TTT
Sbjct: 1486 PPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTT 1544

Query: 2390 VTPTPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQT-PTTTPITTTT--TVTPTPT 2441
            +TP PT T T+TP     + T++  P P      PTG+    +T P+T T+  T T  PT
Sbjct: 1545 ITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPT 1604

Query: 2442 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2501
            P+  QT   T +   +T   TP+     TPT   + T+ ++   PT T    PTT   T 
Sbjct: 1605 PSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGT-IPPPTTLKATG 1663

Query: 2502 TTTVTPTPTPTGTQT-PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2560
            +T   PT T T + T    + + T  T T   + T +        T+TT +TP PT TG 
Sbjct: 1664 STHTAPTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTG- 1722

Query: 2561 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2620
                T P+T TT+ T     + +   T+T + + T+ T  P  T T         +TT++
Sbjct: 1723 ----TPPMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTST---------STTSI 1769

Query: 2621 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTP 2670
            TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP
Sbjct: 1770 TPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTP 1829

Query: 2671 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2730
            +   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT   T
Sbjct: 1830 SHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTIKAT 1886

Query: 2731 TTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2787
             +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T 
Sbjct: 1887 GSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTS 1944

Query: 2788 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2847
            TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T     T
Sbjct: 1945 TGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQT 1991

Query: 2848 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTP 2902
            TT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T      TP
Sbjct: 1992 TTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTP 2042

Query: 2903 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2962
            TGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +   
Sbjct: 2043 TGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

Query: 2963 TTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTP 3015
            ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P
Sbjct: 2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSP 2157

Query: 3016 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3075
            +   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T P T
Sbjct: 2158 SVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHT 2215

Query: 3076 TTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3132
             ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T   T 
Sbjct: 2216 ISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTS 2275

Query: 3133 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3192
              T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +T++
Sbjct: 2276 LTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFLTSS 2322

Query: 3193 TTVTPTPTPTGTQTPTTTPITTTTTVTPT 3221
             T   +       TP + P+++  T TPT
Sbjct: 2323 LTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  455 bits (1170), Expect = e-127
 Identities = 392/1229 (31%), Positives = 567/1229 (46%), Gaps = 133/1229 (10%)

Query: 2277 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2335
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2336 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2392
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2393 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2447
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2448 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2502
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2503 -TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2561
             TT  PTP+   T  PT  P  +T+ VTP+ T T   TPT   + T+ +    PT T   
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPS-THT-VITPTHAQMATSASNHSAPTGT-IP 1485

Query: 2562 TPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2619
             PTT   T +T   P  TPT +GT    ++  T  T  +     + T  P  TP T+TTT
Sbjct: 1486 PPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTT 1544

Query: 2620 VTPTPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQT-PTTTPITTTT--TVTPTPT 2671
            +TP PT T T+TP     + T++  P P      PTG+    +T P+T T+  T T  PT
Sbjct: 1545 ITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPT 1604

Query: 2672 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2731
            P+  QT   T +   +T   TP+     TPT   + T+ ++   PT T    PTT   T 
Sbjct: 1605 PSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGT-IPPPTTLKATG 1663

Query: 2732 TTTVTPTPTPTGTQT-PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2790
            +T   PT T T + T    + + T  T T   + T +        T+TT +TP PT TG 
Sbjct: 1664 STHTAPTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTG- 1722

Query: 2791 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2850
                T P+T TT+ T     + +   T+T + + T+ T  P  T T         +TT++
Sbjct: 1723 ----TPPMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTST---------STTSI 1769

Query: 2851 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTP 2900
            TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP
Sbjct: 1770 TPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTP 1829

Query: 2901 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2960
            +   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT   T
Sbjct: 1830 SHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTIKAT 1886

Query: 2961 TTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3017
             +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T 
Sbjct: 1887 GSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTS 1944

Query: 3018 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3077
            TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T     T
Sbjct: 1945 TGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQT 1991

Query: 3078 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTP 3132
            TT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T      TP
Sbjct: 1992 TTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTP 2042

Query: 3133 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3192
            TGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +   
Sbjct: 2043 TGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

Query: 3193 TTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTP 3245
            ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P
Sbjct: 2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSP 2157

Query: 3246 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3305
            +   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T P T
Sbjct: 2158 SVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHT 2215

Query: 3306 TTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3362
             ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T   T 
Sbjct: 2216 ISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTS 2275

Query: 3363 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3422
              T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +T++
Sbjct: 2276 LTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFLTSS 2322

Query: 3423 TTVTPTPTPTGTQTPTTTPITTTTTVTPT 3451
             T   +       TP + P+++  T TPT
Sbjct: 2323 LTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  455 bits (1170), Expect = e-127
 Identities = 392/1229 (31%), Positives = 567/1229 (46%), Gaps = 133/1229 (10%)

Query: 2507 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2565
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2566 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2622
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2623 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2677
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2678 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2732
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2733 -TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2791
             TT  PTP+   T  PT  P  +T+ VTP+ T T   TPT   + T+ +    PT T   
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPS-THT-VITPTHAQMATSASNHSAPTGT-IP 1485

Query: 2792 TPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2849
             PTT   T +T   P  TPT +GT    ++  T  T  +     + T  P  TP T+TTT
Sbjct: 1486 PPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTT 1544

Query: 2850 VTPTPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQT-PTTTPITTTT--TVTPTPT 2901
            +TP PT T T+TP     + T++  P P      PTG+    +T P+T T+  T T  PT
Sbjct: 1545 ITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPT 1604

Query: 2902 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2961
            P+  QT   T +   +T   TP+     TPT   + T+ ++   PT T    PTT   T 
Sbjct: 1605 PSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGT-IPPPTTLKATG 1663

Query: 2962 TTTVTPTPTPTGTQT-PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3020
            +T   PT T T + T    + + T  T T   + T +        T+TT +TP PT TG 
Sbjct: 1664 STHTAPTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTG- 1722

Query: 3021 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3080
                T P+T TT+ T     + +   T+T + + T+ T  P  T T         +TT++
Sbjct: 1723 ----TPPMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTST---------STTSI 1769

Query: 3081 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTP 3130
            TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP
Sbjct: 1770 TPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTP 1829

Query: 3131 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3190
            +   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT   T
Sbjct: 1830 SHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTIKAT 1886

Query: 3191 TTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3247
             +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T 
Sbjct: 1887 GSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTS 1944

Query: 3248 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3307
            TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T     T
Sbjct: 1945 TGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQT 1991

Query: 3308 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTP 3362
            TT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T      TP
Sbjct: 1992 TTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTP 2042

Query: 3363 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3422
            TGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +   
Sbjct: 2043 TGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

Query: 3423 TTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTP 3475
            ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P
Sbjct: 2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSP 2157

Query: 3476 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3535
            +   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T P T
Sbjct: 2158 SVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHT 2215

Query: 3536 TTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3592
             ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T   T 
Sbjct: 2216 ISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTS 2275

Query: 3593 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3652
              T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +T++
Sbjct: 2276 LTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFLTSS 2322

Query: 3653 TTVTPTPTPTGTQTPTTTPITTTTTVTPT 3681
             T   +       TP + P+++  T TPT
Sbjct: 2323 LTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  455 bits (1170), Expect = e-127
 Identities = 392/1229 (31%), Positives = 567/1229 (46%), Gaps = 133/1229 (10%)

Query: 2737 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2795
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2796 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2852
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2853 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2907
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2908 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2962
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2963 -TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3021
             TT  PTP+   T  PT  P  +T+ VTP+ T T   TPT   + T+ +    PT T   
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPS-THT-VITPTHAQMATSASNHSAPTGT-IP 1485

Query: 3022 TPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3079
             PTT   T +T   P  TPT +GT    ++  T  T  +     + T  P  TP T+TTT
Sbjct: 1486 PPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTT 1544

Query: 3080 VTPTPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQT-PTTTPITTTT--TVTPTPT 3131
            +TP PT T T+TP     + T++  P P      PTG+    +T P+T T+  T T  PT
Sbjct: 1545 ITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPT 1604

Query: 3132 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3191
            P+  QT   T +   +T   TP+     TPT   + T+ ++   PT T    PTT   T 
Sbjct: 1605 PSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGT-IPPPTTLKATG 1663

Query: 3192 TTTVTPTPTPTGTQT-PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3250
            +T   PT T T + T    + + T  T T   + T +        T+TT +TP PT TG 
Sbjct: 1664 STHTAPTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTG- 1722

Query: 3251 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3310
                T P+T TT+ T     + +   T+T + + T+ T  P  T T         +TT++
Sbjct: 1723 ----TPPMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTST---------STTSI 1769

Query: 3311 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTP 3360
            TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP
Sbjct: 1770 TPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTP 1829

Query: 3361 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3420
            +   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT   T
Sbjct: 1830 SHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTIKAT 1886

Query: 3421 TTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3477
             +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T 
Sbjct: 1887 GSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTS 1944

Query: 3478 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3537
            TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T     T
Sbjct: 1945 TGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQT 1991

Query: 3538 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTP 3592
            TT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T      TP
Sbjct: 1992 TTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTP 2042

Query: 3593 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3652
            TGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +   
Sbjct: 2043 TGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

Query: 3653 TTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTP 3705
            ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P
Sbjct: 2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSP 2157

Query: 3706 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3765
            +   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T P T
Sbjct: 2158 SVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHT 2215

Query: 3766 TTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3822
             ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T   T 
Sbjct: 2216 ISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTS 2275

Query: 3823 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3882
              T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +T++
Sbjct: 2276 LTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFLTSS 2322

Query: 3883 TTVTPTPTPTGTQTPTTTPITTTTTVTPT 3911
             T   +       TP + P+++  T TPT
Sbjct: 2323 LTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  455 bits (1170), Expect = e-127
 Identities = 392/1229 (31%), Positives = 567/1229 (46%), Gaps = 133/1229 (10%)

Query: 2967 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 3025
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 3026 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3082
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 3083 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 3137
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 3138 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 3192
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 3193 -TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3251
             TT  PTP+   T  PT  P  +T+ VTP+ T T   TPT   + T+ +    PT T   
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPS-THT-VITPTHAQMATSASNHSAPTGT-IP 1485

Query: 3252 TPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3309
             PTT   T +T   P  TPT +GT    ++  T  T  +     + T  P  TP T+TTT
Sbjct: 1486 PPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTT 1544

Query: 3310 VTPTPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQT-PTTTPITTTT--TVTPTPT 3361
            +TP PT T T+TP     + T++  P P      PTG+    +T P+T T+  T T  PT
Sbjct: 1545 ITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPT 1604

Query: 3362 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3421
            P+  QT   T +   +T   TP+     TPT   + T+ ++   PT T    PTT   T 
Sbjct: 1605 PSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGT-IPPPTTLKATG 1663

Query: 3422 TTTVTPTPTPTGTQT-PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3480
            +T   PT T T + T    + + T  T T   + T +        T+TT +TP PT TG 
Sbjct: 1664 STHTAPTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTG- 1722

Query: 3481 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3540
                T P+T TT+ T     + +   T+T + + T+ T  P  T T         +TT++
Sbjct: 1723 ----TPPMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTST---------STTSI 1769

Query: 3541 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTP 3590
            TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP
Sbjct: 1770 TPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTP 1829

Query: 3591 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3650
            +   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT   T
Sbjct: 1830 SHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTIKAT 1886

Query: 3651 TTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3707
             +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T 
Sbjct: 1887 GSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTS 1944

Query: 3708 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3767
            TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T     T
Sbjct: 1945 TGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQT 1991

Query: 3768 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTP 3822
            TT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T      TP
Sbjct: 1992 TTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTP 2042

Query: 3823 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3882
            TGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +   
Sbjct: 2043 TGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

Query: 3883 TTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTP 3935
            ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P
Sbjct: 2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSP 2157

Query: 3936 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3995
            +   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T P T
Sbjct: 2158 SVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHT 2215

Query: 3996 TTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 4052
             ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T   T 
Sbjct: 2216 ISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTS 2275

Query: 4053 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4112
              T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +T++
Sbjct: 2276 LTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFLTSS 2322

Query: 4113 TTVTPTPTPTGTQTPTTTPITTTTTVTPT 4141
             T   +       TP + P+++  T TPT
Sbjct: 2323 LTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  450 bits (1157), Expect = e-125
 Identities = 396/1232 (32%), Positives = 567/1232 (46%), Gaps = 162/1232 (13%)

Query: 1955 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2013
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2014 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2070
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2071 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2125
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2126 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2180
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2181 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 2220
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 2221 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2277
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 2278 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 2327
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 2328 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2383
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 2384 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 2442
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 2443 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2502
            T T TP   P+T TT+ T     + +   T+T + + T+ T  P  T          T+T
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTS---------TST 1766

Query: 2503 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVT 2552
            T++TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  
Sbjct: 1767 TSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTY 1826

Query: 2553 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2612
            PTP+   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT 
Sbjct: 1827 PTPSHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTI 1883

Query: 2613 PITTTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2669
              T +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP 
Sbjct: 1884 KATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPK 1941

Query: 2670 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2729
             T TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T   
Sbjct: 1942 HTSTGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATS 1988

Query: 2730 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT----- 2784
              TTT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T     
Sbjct: 1989 FQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIH 2039

Query: 2785 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2844
             TPTGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +
Sbjct: 2040 STPTGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWL 2094

Query: 2845 TTTTTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVT 2897
               ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T
Sbjct: 2095 PQNSSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQT 2154

Query: 2898 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2957
             +P+   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T 
Sbjct: 2155 SSPSVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATL 2212

Query: 2958 PITTTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3014
            P T ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T  
Sbjct: 2213 PHTISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSR 2272

Query: 3015 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3074
             T   T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +
Sbjct: 2273 STSLTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFL 2319

Query: 3075 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3106
            T++ T   +       TP + P+++  T TPT
Sbjct: 2320 TSSLTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  450 bits (1157), Expect = e-125
 Identities = 396/1232 (32%), Positives = 567/1232 (46%), Gaps = 162/1232 (13%)

Query: 2162 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2220
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2221 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2277
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2278 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2332
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2333 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2387
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2388 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 2427
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 2428 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2484
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 2485 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 2534
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 2535 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2590
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 2591 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 2649
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 2650 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2709
            T T TP   P+T TT+ T     + +   T+T + + T+ T  P  T          T+T
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTS---------TST 1766

Query: 2710 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVT 2759
            T++TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  
Sbjct: 1767 TSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTY 1826

Query: 2760 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2819
            PTP+   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT 
Sbjct: 1827 PTPSHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTI 1883

Query: 2820 PITTTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2876
              T +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP 
Sbjct: 1884 KATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPK 1941

Query: 2877 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 2936
             T TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T   
Sbjct: 1942 HTSTGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATS 1988

Query: 2937 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT----- 2991
              TTT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T     
Sbjct: 1989 FQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIH 2039

Query: 2992 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3051
             TPTGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +
Sbjct: 2040 STPTGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWL 2094

Query: 3052 TTTTTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVT 3104
               ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T
Sbjct: 2095 PQNSSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQT 2154

Query: 3105 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3164
             +P+   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T 
Sbjct: 2155 SSPSVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATL 2212

Query: 3165 PITTTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3221
            P T ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T  
Sbjct: 2213 PHTISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSR 2272

Query: 3222 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3281
             T   T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +
Sbjct: 2273 STSLTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFL 2319

Query: 3282 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3313
            T++ T   +       TP + P+++  T TPT
Sbjct: 2320 TSSLTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  450 bits (1157), Expect = e-125
 Identities = 396/1232 (32%), Positives = 567/1232 (46%), Gaps = 162/1232 (13%)

Query: 2392 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2450
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2451 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2507
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2508 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2562
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2563 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2617
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2618 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 2657
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 2658 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2714
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 2715 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 2764
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 2765 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2820
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 2821 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 2879
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 2880 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2939
            T T TP   P+T TT+ T     + +   T+T + + T+ T  P  T          T+T
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTS---------TST 1766

Query: 2940 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVT 2989
            T++TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  
Sbjct: 1767 TSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTY 1826

Query: 2990 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3049
            PTP+   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT 
Sbjct: 1827 PTPSHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTI 1883

Query: 3050 PITTTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3106
              T +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP 
Sbjct: 1884 KATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPK 1941

Query: 3107 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3166
             T TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T   
Sbjct: 1942 HTSTGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATS 1988

Query: 3167 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT----- 3221
              TTT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T     
Sbjct: 1989 FQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIH 2039

Query: 3222 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3281
             TPTGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +
Sbjct: 2040 STPTGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWL 2094

Query: 3282 TTTTTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVT 3334
               ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T
Sbjct: 2095 PQNSSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQT 2154

Query: 3335 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3394
             +P+   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T 
Sbjct: 2155 SSPSVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATL 2212

Query: 3395 PITTTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3451
            P T ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T  
Sbjct: 2213 PHTISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSR 2272

Query: 3452 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3511
             T   T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +
Sbjct: 2273 STSLTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFL 2319

Query: 3512 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3543
            T++ T   +       TP + P+++  T TPT
Sbjct: 2320 TSSLTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  450 bits (1157), Expect = e-125
 Identities = 396/1232 (32%), Positives = 567/1232 (46%), Gaps = 162/1232 (13%)

Query: 2622 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2680
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2681 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2737
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2738 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 2792
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 2793 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 2847
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 2848 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 2887
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 2888 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2944
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 2945 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 2994
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 2995 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3050
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 3051 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 3109
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 3110 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3169
            T T TP   P+T TT+ T     + +   T+T + + T+ T  P  T          T+T
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTS---------TST 1766

Query: 3170 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVT 3219
            T++TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  
Sbjct: 1767 TSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTY 1826

Query: 3220 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3279
            PTP+   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT 
Sbjct: 1827 PTPSHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTI 1883

Query: 3280 PITTTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3336
              T +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP 
Sbjct: 1884 KATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPK 1941

Query: 3337 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3396
             T TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T   
Sbjct: 1942 HTSTGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATS 1988

Query: 3397 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT----- 3451
              TTT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T     
Sbjct: 1989 FQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIH 2039

Query: 3452 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3511
             TPTGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +
Sbjct: 2040 STPTGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWL 2094

Query: 3512 TTTTTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVT 3564
               ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T
Sbjct: 2095 PQNSSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQT 2154

Query: 3565 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3624
             +P+   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T 
Sbjct: 2155 SSPSVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATL 2212

Query: 3625 PITTTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3681
            P T ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T  
Sbjct: 2213 PHTISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSR 2272

Query: 3682 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3741
             T   T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +
Sbjct: 2273 STSLTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFL 2319

Query: 3742 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3773
            T++ T   +       TP + P+++  T TPT
Sbjct: 2320 TSSLTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  450 bits (1157), Expect = e-125
 Identities = 396/1232 (32%), Positives = 567/1232 (46%), Gaps = 162/1232 (13%)

Query: 2852 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 2910
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 2911 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 2967
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 2968 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 3022
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 3023 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 3077
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 3078 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 3117
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 3118 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3174
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 3175 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 3224
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 3225 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3280
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 3281 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 3339
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 3340 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3399
            T T TP   P+T TT+ T     + +   T+T + + T+ T  P  T          T+T
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTS---------TST 1766

Query: 3400 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVT 3449
            T++TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  
Sbjct: 1767 TSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTY 1826

Query: 3450 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3509
            PTP+   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT 
Sbjct: 1827 PTPSHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTI 1883

Query: 3510 PITTTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3566
              T +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP 
Sbjct: 1884 KATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPK 1941

Query: 3567 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3626
             T TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T   
Sbjct: 1942 HTSTGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATS 1988

Query: 3627 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT----- 3681
              TTT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T     
Sbjct: 1989 FQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIH 2039

Query: 3682 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3741
             TPTGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +
Sbjct: 2040 STPTGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWL 2094

Query: 3742 TTTTTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVT 3794
               ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T
Sbjct: 2095 PQNSSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQT 2154

Query: 3795 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3854
             +P+   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T 
Sbjct: 2155 SSPSVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATL 2212

Query: 3855 PITTTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3911
            P T ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T  
Sbjct: 2213 PHTISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSR 2272

Query: 3912 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3971
             T   T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +
Sbjct: 2273 STSLTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFL 2319

Query: 3972 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 4003
            T++ T   +       TP + P+++  T TPT
Sbjct: 2320 TSSLTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  447 bits (1150), Expect = e-124
 Identities = 390/1205 (32%), Positives = 559/1205 (46%), Gaps = 138/1205 (11%)

Query: 3082 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 3140
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 3141 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3197
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 3198 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 3252
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 3253 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 3307
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 3308 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 3347
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 3348 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3404
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 3405 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 3454
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 3455 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3510
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 3511 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 3569
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 3570 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3629
            T T TP   P+T TT+ T     + +   T+T + + T+ T  P  T          T+T
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTS---------TST 1766

Query: 3630 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVT 3679
            T++TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  
Sbjct: 1767 TSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTY 1826

Query: 3680 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 3739
            PTP+   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT 
Sbjct: 1827 PTPSHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTI 1883

Query: 3740 PITTTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3796
              T +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP 
Sbjct: 1884 KATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPK 1941

Query: 3797 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3856
             T TGT+TP     + +++  PTP  T +    ++P ++T  +T T   T T  PT +  
Sbjct: 1942 HTSTGTRTPVAHTTSASSSRLPTPFTTHSPPTGSSPFSSTGPMTATSFQTTTTYPTPSHP 2001

Query: 3857 TTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPT-----PTPTGTQTPTTTPITTTTTVTP 3910
             TT      P  T   TP+T T I TT T   T      TPTGT  P TT   T +T T 
Sbjct: 2002 QTTLPTHVPPFSTSLVTPSTHTVIITTHTQMATSASIHSTPTGTVPPPTTLKATGSTHTA 2061

Query: 3911 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP---- 3966
             P      T TT+  + T +   T T + +   +++ +   ++  P  +P  TQ P    
Sbjct: 2062 PP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSSRPPSSPITTQLPHLSS 2116

Query: 3967 TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4023
             TTP++TT  ++   +P+P+   T ++  P + ++  T +P+   + +  + P+ +TT  
Sbjct: 2117 ATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVGTSSSFVSAPVHSTTLS 2176

Query: 4024 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT---PTPTGTQT 4080
            + + +   T  PTT  + + + + P+     T    T P T ++  T +   P  T T +
Sbjct: 2177 SGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHTISSPFTLSALLPISTVTVS 2234

Query: 4081 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 4140
            PT +    ++T+    TP  T +  T P  ++ + T   T   T+ PT+  ++ T+ VT 
Sbjct: 2235 PTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPTSGFVSLTSGVTG 2294

Query: 4141 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV---TPTPTPTGTQTGP 4197
             P         T+P+T  TT  P P    T +PTT  +T++ T    TP   P  +  G 
Sbjct: 2295 IP---------TSPVTNLTTRHPGP----TLSPTTRFLTSSLTAHGSTPASAPV-SSLGT 2340

Query: 4198 PTHTS 4202
            PT TS
Sbjct: 2341 PTPTS 2345



 Score =  445 bits (1144), Expect = e-124
 Identities = 391/1249 (31%), Positives = 560/1249 (44%), Gaps = 170/1249 (13%)

Query: 1874 QCCECVTQPTTMTTTTTEN------------------PTPPTTTPITTTTTVTPT----P 1911
            Q C C +QP ++  +  E                   P  P TTP   TT   PT    P
Sbjct: 1158 QPCLCPSQPQSVPGSNIEGCYNCSQDEYFDHEEGVCVPCMPPTTPQPPTTPQLPTTGSRP 1217

Query: 1912 TPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTTTPITTTTTVTPTPTPTGTQTPTTTPI 1970
            T     T T+T I   ++  P+P+   T  +PT TP+   T  +  PT +  + P  T  
Sbjct: 1218 TQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQTPLLPATLTSSKPTASSGEPPRPTTA 1277

Query: 1971 TT---TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2027
             T   T+ + PT T   T T  T    TT     T +P  T T  +T  TT T  TP  +
Sbjct: 1278 VTPQATSGLPPTATLRSTATKPTVTQATTRATASTASPATTSTAQSTTRTTMTLPTPATS 1337

Query: 2028 PTGTQTPTTT----PITTTTTVT-PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2082
             T    P +T    P TT T  T P PTP  T  PTT      T  T T T   TQT TT
Sbjct: 1338 GTSPTLPKSTNQELPGTTATQTTGPRPTPASTTGPTTPQPGQPTRPTATET---TQTRTT 1394

Query: 2083 TPITTTTT--VTPTPTPTGTQTPTTTPITTT----TTVTPTPTPTGTQTPTTTPITTTTT 2136
            T  TT  T   T +P   G+  P+T P+T T    TT  PTP+   T  PT  P  +T+ 
Sbjct: 1395 TEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFHATTTYPTPSHPETTLPTHVPPFSTSL 1454

Query: 2137 VTP------TPT-------------PTGTQTPTTTPITTTTTVTP---TPTPTGTQTPTT 2174
            VTP      TPT             PTGT  P TT   T +T T    TPT +GT    +
Sbjct: 1455 VTPSTHTVITPTHAQMATSASNHSAPTGTIPPPTTLKATGSTHTAPPITPTTSGTSQAHS 1514

Query: 2175 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP- 2233
            +  T  T  +     + T  P  TP T+TTT+TP PT T T+TP     + T++  P P 
Sbjct: 1515 SFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITPNPTSTRTRTPVAHTNSATSSRPPPPF 1573

Query: 2234 ----TPTGTQTPTTT-PITTTT--TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2286
                 PTG+   ++T P+T T+  T T  PTP+  QT   T +   +T   TP+     T
Sbjct: 1574 TTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVIT 1633

Query: 2287 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT-TPITTTTTVT 2345
            PT   + T+ ++   PT T    PTT   T +T   PT T T + T    + + T  T T
Sbjct: 1634 PTHAQMATSASIHSMPTGT-IPPPTTLKATGSTHTAPTMTLTTSGTSQALSSLNTAKTST 1692

Query: 2346 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP---------ITTTTTVTPTPTP 2396
               + T +        T+TT +TP PT TGT   T T           +T  T T   + 
Sbjct: 1693 SLHSHTSSTHHAEATSTSTTNITPNPTSTGTPPMTVTTSGTSQSRSSFSTAKTSTSLHSH 1752

Query: 2397 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2456
            T +        T+TT++TP  T TGT+TP     + T++  PTP  T +    TTPI++T
Sbjct: 1753 TSSTHHPEVTSTSTTSITPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISST 1812

Query: 2457 ----------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT---PTTTPITTTT 2503
                      TT  PTP+   T  PT  P  +T+ VTP+     T T   PT T + T+ 
Sbjct: 1813 GPVTATSFQTTTTYPTPSHPHTTLPTHVPSFSTSLVTPS-----THTVIIPTHTQMATSA 1867

Query: 2504 TVTPTPTPTGTQTPTTTPITTTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGT 2560
            ++   PT T    PTT   T +T   P  TPT +GT Q+P++     T+T  P  T + T
Sbjct: 1868 SIHSMPTGT-IPPPTTIKATGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SST 1925

Query: 2561 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2620
              P  TP T+TT +TP  T TGT+TP     TT+ + +  PTP  T +P T         
Sbjct: 1926 HHPEVTP-TSTTNITPKHTSTGTRTPVAH--TTSASSSRLPTPFTTHSPPT--------- 1973

Query: 2621 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2680
                +P  +  P T     TTT  PTP+   T  PT  P  +T+ VTP+         T 
Sbjct: 1974 --GSSPFSSTGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------TH 2022

Query: 2681 TPITTTTTVTPT-----PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2735
            T I TT T   T      TPTGT  P TT   T +T T  P      T TT+  + T + 
Sbjct: 2023 TVIITTHTQMATSASIHSTPTGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSS 2077

Query: 2736 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTG 2789
              T T + +   +++ +   ++  P  +P  TQ P     TTP++TT  ++   +P+P+ 
Sbjct: 2078 FSTATASSSFISSSSWLPQNSSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSA 2137

Query: 2790 TQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2848
              T ++  P + ++  T +P+   + +  + P+ +TT  + + +   T  PTT  + + +
Sbjct: 2138 PSTVSSYVPSSHSSPQTSSPSVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SAS 2195

Query: 2849 TVTPTPTPTGTQTPTTTPITTTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGT 2905
             + P+     T    T P T ++  T +   P  T T +PT +    ++T+    TP  T
Sbjct: 2196 PLFPSSPAASTTIRATLPHTISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTT 2255

Query: 2906 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2965
             +  T P  ++ + T   T   T+ PT+  ++ T+ VT  P         T+P+T  TT 
Sbjct: 2256 ASTHTAPAFSSQSTTSRSTSLTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTR 2306

Query: 2966 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3014
             P P    T +PTT  +T++ T   +       TP + P+++  T TPT
Sbjct: 2307 HPGP----TLSPTTRFLTSSLTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  445 bits (1144), Expect = e-124
 Identities = 401/1251 (32%), Positives = 568/1251 (45%), Gaps = 150/1251 (11%)

Query: 3197 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 3255
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 3256 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3312
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 3313 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 3367
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 3368 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 3422
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 3423 -TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3481
             TT  PTP+   T  PT  P  +T+ VTP+ T T   TPT   + T+ +    PT T   
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPS-THT-VITPTHAQMATSASNHSAPTGT-IP 1485

Query: 3482 TPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 3539
             PTT   T +T   P  TPT +GT    ++  T  T  +     + T  P  TP T+TTT
Sbjct: 1486 PPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTT 1544

Query: 3540 VTPTPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQT-PTTTPITTTT--TVTPTPT 3591
            +TP PT T T+TP     + T++  P P      PTG+    +T P+T T+  T T  PT
Sbjct: 1545 ITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPT 1604

Query: 3592 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3651
            P+  QT   T +   +T   TP+     TPT   + T+ ++   PT T    PTT   T 
Sbjct: 1605 PSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGT-IPPPTTLKATG 1663

Query: 3652 TTTVTPTPTPTGTQT-PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3710
            +T   PT T T + T    + + T  T T   + T +        T+TT +TP PT TG 
Sbjct: 1664 STHTAPTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNPTSTG- 1722

Query: 3711 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3770
                T P+T TT+ T     + +   T+T + + T+ T  P  T T         +TT++
Sbjct: 1723 ----TPPMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTST---------STTSI 1769

Query: 3771 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTP 3820
            TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP
Sbjct: 1770 TPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTP 1829

Query: 3821 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3880
            +   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT   T
Sbjct: 1830 SHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTIKAT 1886

Query: 3881 TTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3937
             +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T 
Sbjct: 1887 GSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTS 1944

Query: 3938 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3997
            TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T     T
Sbjct: 1945 TGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQT 1991

Query: 3998 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTP 4052
            TT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T      TP
Sbjct: 1992 TTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTP 2042

Query: 4053 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4112
            TGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +   
Sbjct: 2043 TGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

Query: 4113 TTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTP 4165
            ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P
Sbjct: 2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSP 2157

Query: 4166 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSR 4225
            +   + +  + P+ +TT        +G+ +   TH +TA +           S++P    
Sbjct: 2158 SVGTSSSFVSAPVHSTT------LSSGSHSSLSTHPTTASV-----------SASPLFPS 2200

Query: 4226 STSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRG 4285
            S ++  T   TL  T+     +++  P ST T   T S     S   S+T + P TP   
Sbjct: 2201 SPAASTTIRATLPHTISSPFTLSALLPISTVTVSPTPS-----SHLASSTIAFPSTPR-- 2253

Query: 4286 TTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAP 4345
            TT  + +AP  S+  TT+ S    T  P S   +  T+G+   P+S     V N T   P
Sbjct: 2254 TTASTHTAPAFSSQSTTSRSTSLTTRVPTS-GFVSLTSGVTGIPTSP----VTNLTTRHP 2308

Query: 4346 GEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKP 4396
            G      T   T  F+  SL+        +  STP+  P  S  TPTP+ P
Sbjct: 2309 GP-----TLSPTTRFLTSSLT--------AHGSTPASAPVSSLGTPTPTSP 2346



 Score =  407 bits (1045), Expect = e-112
 Identities = 378/1229 (30%), Positives = 545/1229 (44%), Gaps = 170/1229 (13%)

Query: 1598 PTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTP 1657
            P TTP PPTT      PTT   P    P+T  ++T  L  +T PSP  +  T   PT TP
Sbjct: 1198 PPTTPQPPTTPQL---PTTGSRPTQVWPMTGTSTTIGLLSSTGPSPS-SNHTPASPTQTP 1253

Query: 1658 SPPTTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTM--TTPSPTTTPSSPITTTTTP 1715
              P T T S P  ++  PP  TT  +P  T+  PPT T+  T   PT T ++   T +T 
Sbjct: 1254 LLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATASTA 1313

Query: 1716 SSTTT---PSPPPTTMTTPSPT---TTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPT 1769
            S  TT    S   TTMT P+P    T+P+ P +T   LP TT +      P P S T PT
Sbjct: 1314 SPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTGPT 1373

Query: 1770 F-SPFSTTTPT-TPCVPLCNWTGWLDSGKPN-FHKP---GGDTELIGDVCGPGWAANISC 1823
               P   T PT T        T +     P+  H P   G      G V    + A  + 
Sbjct: 1374 TPQPGQPTRPTATETTQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFHATTTY 1433

Query: 1824 RATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPT 1883
                +P+  +     T V   S  L           V P    +    + Q     +  +
Sbjct: 1434 PTPSHPETTL----PTHVPPFSTSL-----------VTPSTHTVITPTHAQMATSASNHS 1478

Query: 1884 TMTTTTTENPTPPTTTPITTTTTVTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 1941
              T T      PPTT   T +T   P  TPT +GT    ++  T  T  +     + T  
Sbjct: 1479 APTGTI----PPPTTLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHH 1534

Query: 1942 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQT-----PTTT 1991
            P  TP T+TTT+TP PT T T+TP     + T++  P P      PTG+       P T 
Sbjct: 1535 PEVTP-TSTTTITPNPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTA 1593

Query: 1992 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQ 2032
                TTT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT 
Sbjct: 1594 TSFKTTTTYPTPSHPQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSMPTGTI 1653

Query: 2033 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTV 2091
             P TT   T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T 
Sbjct: 1654 PPPTTLKATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTT 1712

Query: 2092 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI--------------TTTTTV 2137
              TP PT T TP   P+T TT+ T     + +   T+T +              T+TT++
Sbjct: 1713 NITPNPTSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTSTSTTSI 1769

Query: 2138 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTP 2187
            TP  T TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP
Sbjct: 1770 TPNHTSTGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTP 1829

Query: 2188 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2247
            +   T  PT  P  +T+ VTP+ T T    PT T + T+ ++   PT T    PTT   T
Sbjct: 1830 SHPHTTLPTHVPSFSTSLVTPS-THT-VIIPTHTQMATSASIHSMPTGT-IPPPTTIKAT 1886

Query: 2248 TTTTVTP--TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2304
             +T   P  TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T 
Sbjct: 1887 GSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTS 1944

Query: 2305 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2364
            TGT+TP     TT+ + +  PTP  T +P T             +P  +  P T     T
Sbjct: 1945 TGTRTPVAH--TTSASSSRLPTPFTTHSPPT-----------GSSPFSSTGPMTATSFQT 1991

Query: 2365 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-----PTP 2419
            TT  PTP+   T  PT  P  +T+ VTP+         T T I TT T   T      TP
Sbjct: 1992 TTTYPTPSHPQTTLPTHVPPFSTSLVTPS---------THTVIITTHTQMATSASIHSTP 2042

Query: 2420 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2479
            TGT  P TT   T +T T  P      T TT+  + T +   T T + +   +++ +   
Sbjct: 2043 TGTVPPPTTLKATGSTHTAPP-----MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQN 2097

Query: 2480 TTVTPTPTPTGTQTP----TTTPITTTTTVTP--TPTPTGTQTPTT-TPITTTTTVTPTP 2532
            ++  P  +P  TQ P     TTP++TT  ++   +P+P+   T ++  P + ++  T +P
Sbjct: 2098 SSSRPPSSPITTQLPHLSSATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSP 2157

Query: 2533 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2592
            +   + +  + P+ +TT  + + +   T  PTT  + + + + P+     T    T P T
Sbjct: 2158 SVGTSSSFVSAPVHSTTLSSGSHSSLSTH-PTTASV-SASPLFPSSPAASTTIRATLPHT 2215

Query: 2593 TTTTVTPT---PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2649
             ++  T +   P  T T +PT +    ++T+    TP  T +  T P  ++ + T   T 
Sbjct: 2216 ISSPFTLSALLPISTVTVSPTPSSHLASSTIAFPSTPRTTASTHTAPAFSSQSTTSRSTS 2275

Query: 2650 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2709
              T+ PT+  ++ T+ VT  P         T+P+T  TT  P P    T +PTT  +T++
Sbjct: 2276 LTTRVPTSGFVSLTSGVTGIP---------TSPVTNLTTRHPGP----TLSPTTRFLTSS 2322

Query: 2710 TTVTPTPTPTGTQTPTTTPITTTTTVTPT 2738
             T   +       TP + P+++  T TPT
Sbjct: 2323 LTAHGS-------TPASAPVSSLGTPTPT 2344



 Score =  373 bits (958), Expect = e-102
 Identities = 342/1055 (32%), Positives = 471/1055 (44%), Gaps = 172/1055 (16%)

Query: 3473 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 3531
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 3532 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3588
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 3589 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 3643
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 3644 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 3698
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 3699 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 3738
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 3739 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3795
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 3796 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 3845
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 3846 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3901
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 3902 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 3960
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 3961 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI--------------TTTTTVTPTPTP 4006
            T T TP   P+T TT+ T     + +   T+T +              T+TT++TP  T 
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTSTSTTSITPNHTS 1775

Query: 4007 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTPTPTGTQ 4056
            TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP+   T 
Sbjct: 1776 TGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTT 1835

Query: 4057 TPTTTPITTTTTVTPT------PT-------------PTGTQTPTTTPITTTTTVTP--- 4094
             PT  P  +T+ VTP+      PT             PTGT  P TT   T +T T    
Sbjct: 1836 LPTHVPSFSTSLVTPSTHTVIIPTHTQMATSASIHSMPTGTIPPPTTIKATGSTHTAPPM 1895

Query: 4095 TPTPTGT-QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 4153
            TPT +GT Q+P++     T+T  P  T + T  P  TP T+TT +TP  T TGT+TP   
Sbjct: 1896 TPTTSGTSQSPSSFSTAKTSTSLPYHT-SSTHHPEVTP-TSTTNITPKHTSTGTRTPVAH 1953

Query: 4154 PITTTTTVTPTP-----TPTGTQT-PTTTPITTTT--TVTPTPTPTGTQTGPPTHTSTAP 4205
              + +++  PTP      PTG+    +T P+T T+  T T  PTP+  QT  PTH     
Sbjct: 1954 TTSASSSRLPTPFTTHSPPTGSSPFSSTGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFS 2013

Query: 4206 IAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPP-----AIEMTSTAPPSTPTAPT 4260
               L T +      T  T  +TS+ +  + T   T+PP     A   T TAPP T T   
Sbjct: 2014 -TSLVTPSTHTVIITTHTQMATSASIHSTPT--GTVPPPTTLKATGSTHTAPPMTVTTSG 2070

Query: 4261 TTSGGHTLSP--------------PPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSA 4306
            T+    + S               P ++++ PP +P        SSA TP +     +S+
Sbjct: 2071 TSQTHSSFSTATASSSFISSSSWLPQNSSSRPPSSPITTQLPHLSSATTPVSTTNQLSSS 2130

Query: 4307 WTPTPT-PLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSL 4365
            ++P+P+ P +  S + ++   P  SS  +                    G +  FV+  +
Sbjct: 2131 FSPSPSAPSTVSSYVPSSHSSPQTSSPSV--------------------GTSSSFVSAPV 2170

Query: 4366 -SCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSST 4399
             S TL   + S  ST   T + S S   PS P+++
Sbjct: 2171 HSTTLSSGSHSSLSTHPTTASVSASPLFPSSPAAS 2205



 Score =  342 bits (877), Expect = 6e-93
 Identities = 321/980 (32%), Positives = 428/980 (43%), Gaps = 151/980 (15%)

Query: 3542 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 3600
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 3601 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3657
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 3658 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 3712
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 3713 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 3767
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 3768 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 3807
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 3808 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3864
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 3865 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 3914
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 3915 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 3970
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 3971 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 4029
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 4030 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI--------------TTTTTVTPTPTP 4075
            T T TP   P+T TT+ T     + +   T+T +              T+TT++TP  T 
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTSTSTTSITPNHTS 1775

Query: 4076 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT----------TTTVTPTPTPTGTQ 4125
            TGT+TP     + T++  PTP  T +    TTPI++          TTT  PTP+   T 
Sbjct: 1776 TGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTT 1835

Query: 4126 TPTTTPITTTTTVTPT------PT-------------PTGTQTPTTTPITTTTTVTP--- 4163
             PT  P  +T+ VTP+      PT             PTGT  P TT   T +T T    
Sbjct: 1836 LPTHVPSFSTSLVTPSTHTVIIPTHTQMATSASIHSMPTGTIPPPTTIKATGSTHTAPPM 1895

Query: 4164 TPTPTGT----------QTPTTTPITTTTTVTPTPTPTGTQTGPPTHTST---APIAELT 4210
            TPT +GT          +T T+ P  T++T  P  TPT T    P HTST    P+A  T
Sbjct: 1896 TPTTSGTSQSPSSFSTAKTSTSLPYHTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAHTT 1955

Query: 4211 TSNPPPESSTPQTSRSTSSPLTESTTLLSTLP-PAIEMTSTAPPSTPTAPTTTSGGHTLS 4269
            +++    SS   T  +T SP T S+   ST P  A    +T    TP+ P TT   H   
Sbjct: 1956 SAS----SSRLPTPFTTHSPPTGSSPFSSTGPMTATSFQTTTTYPTPSHPQTTLPTHV-- 2009

Query: 4270 PPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPT------PTPLSTPSIIRTT 4323
            PP ST+   P T T   TT +  A + S   T T +   PT       T  + P  + T+
Sbjct: 2010 PPFSTSLVTPSTHTVIITTHTQMATSASIHSTPTGTVPPPTTLKATGSTHTAPPMTVTTS 2069

Query: 4324 GLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPT 4383
            G     SS       +    +      N +          S   T +  + S  +TP  T
Sbjct: 2070 GTSQTHSSFSTATASSSFISSSSWLPQNSSSRPP------SSPITTQLPHLSSATTPVST 2123

Query: 4384 PT--PSKSTPTPSKPSSTPS 4401
                 S  +P+PS PS+  S
Sbjct: 2124 TNQLSSSFSPSPSAPSTVSS 2143



 Score =  296 bits (758), Expect = 4e-79
 Identities = 285/876 (32%), Positives = 380/876 (43%), Gaps = 121/876 (13%)

Query: 3634 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 3692
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 3693 TPITTTTTVTPTPTPTGTQTPTTTPITT---TTTVTPTPTPTGTQTPTTTPITTTTTVTP 3749
            TP+   T  +  PT +  + P  T   T   T+ + PT T   T T  T    TT     
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKPTVTQATTRATAS 1311

Query: 3750 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT----PITTTTTVT-PTPTPTGTQT 3804
            T +P  T T  +T  TT T  TP  + T    P +T    P TT T  T P PTP  T  
Sbjct: 1312 TASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTTATQTTGPRPTPASTTG 1371

Query: 3805 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--VTPTPTPTGTQTPTTTPITTT--- 3859
            PTT      T  T T T   TQT TTT  TT  T   T +P   G+  P+T P+T T   
Sbjct: 1372 PTTPQPGQPTRPTATET---TQTRTTTEYTTPQTPHTTHSPPTAGSPVPSTGPVTATSFH 1428

Query: 3860 -TTVTPTPTPTGTQTPTTTPITTTTTVTP------TPT-------------PTGTQTPTT 3899
             TT  PTP+   T  PT  P  +T+ VTP      TPT             PTGT  P T
Sbjct: 1429 ATTTYPTPSHPETTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASNHSAPTGTIPPPT 1488

Query: 3900 TPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 3956
            T   T +T T    TPT +GT    ++  T  T  +     + T  P  TP T+TTT+TP
Sbjct: 1489 TLKATGSTHTAPPITPTTSGTSQAHSSFSTNKTPTSLHSHTSSTHHPEVTP-TSTTTITP 1547

Query: 3957 TPTPTGTQTPTTTPITTTTTVTPTP-----TPTGTQTPTTT-PITTT----TTVTPTPTP 4006
             PT T T+TP     + T++  P P      PTG+   ++T P+T T    TT  PTP+ 
Sbjct: 1548 NPTSTRTRTPVAHTNSATSSRPPPPFTTHSPPTGSSPFSSTGPMTATSFKTTTTYPTPSH 1607

Query: 4007 TGTQTPTTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 4062
              T  PT  P  +T+ VTP+     TPT  Q  T+  I +         PTGT  P TT 
Sbjct: 1608 PQTTLPTHVPPFSTSLVTPSTHTVITPTHAQMATSASIHSM--------PTGTIPPPTTL 1659

Query: 4063 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-TPTPTPTGTQTPTTTPITTTTTVTPTPTP 4121
              T +T T  PT T T + T+  +++  T  T T   + T +      T+T+T   TP P
Sbjct: 1660 KATGSTHT-APTMTLTTSGTSQALSSLNTAKTSTSLHSHTSSTHHAEATSTSTTNITPNP 1718

Query: 4122 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI--------------TTTTTVTPTPTP 4167
            T T TP   P+T TT+ T     + +   T+T +              T+TT++TP  T 
Sbjct: 1719 TSTGTP---PMTVTTSGTSQSRSSFSTAKTSTSLHSHTSSTHHPEVTSTSTTSITPNHTS 1775

Query: 4168 TGTQTPTTTPITTTTTVTPTP-----TPTGTQTGPPTHTSTAPIAELTTSNPP---PESS 4219
            TGT+TP     + T++  PTP      PTGT     T   TA   + TT+ P    P ++
Sbjct: 1776 TGTRTPVAHTTSATSSRLPTPFTTHSPPTGTTPISSTGPVTATSFQTTTTYPTPSHPHTT 1835

Query: 4220 TPQTSRSTSSPLTESTTLLSTLPPAIEM-TSTAPPSTPTAPTTTSGGHTLSPPPSTTTSP 4278
             P    S S+ L   +T    +P   +M TS +  S PT   T     T+    ST T+P
Sbjct: 1836 LPTHVPSFSTSLVTPSTHTVIIPTHTQMATSASIHSMPTG--TIPPPTTIKATGSTHTAP 1893

Query: 4279 PGTPTRGTTTGS----SSAPTPSTVQTTTTSAWTPTPTPLSTPSII---RTTGLRPYPSS 4331
            P TPT   T+ S    S+A T +++   T+S   P  TP ST +I     +TG R   + 
Sbjct: 1894 PMTPTTSGTSQSPSSFSTAKTSTSLPYHTSSTHHPEVTPTSTTNITPKHTSTGTRTPVAH 1953

Query: 4332 VLICCV--LNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTP--S 4387
                    L   +        +  +  T      S   T  +   S P T  PT  P  S
Sbjct: 1954 TTSASSSRLPTPFTTHSPPTGSSPFSSTGPMTATSFQTTTTYPTPSHPQTTLPTHVPPFS 2013

Query: 4388 KSTPTPS-------------KPSSTPSKPTPGTKPP 4410
             S  TPS               +S  S PT GT PP
Sbjct: 2014 TSLVTPSTHTVIITTHTQMATSASIHSTPT-GTVPP 2048



 Score =  148 bits (373), Expect = 2e-34
 Identities = 145/468 (30%), Positives = 210/468 (44%), Gaps = 81/468 (17%)

Query: 1398 TPSPPTTTPSPPPTSTTTLPPT------TTPSPPTTTTTTPPPTTTPSPPITTTTTPPPT 1451
            T S  T  P  P TS T+  P+      T+ S P  T++T  P  TP+   TT  TP  T
Sbjct: 1886 TGSTHTAPPMTPTTSGTSQSPSSFSTAKTSTSLPYHTSSTHHPEVTPTS--TTNITPKHT 1943

Query: 1452 TTPS-PPISTTTT------PPPTTTPSPPT-----TTPSPPTTTPSPPTTTTTTP--PPT 1497
            +T +  P++ TT+      P P TT SPPT     ++  P T T    TTT  TP  P T
Sbjct: 1944 STGTRTPVAHTTSASSSRLPTPFTTHSPPTGSSPFSSTGPMTATSFQTTTTYPTPSHPQT 2003

Query: 1498 TTPS--PPTTTPITPPASTTTLPPT-----TTPSPPTTTTTTPPPTTTPSPPTTTPITPP 1550
            T P+  PP +T +  P++ T +  T     T+ S  +T T T PP TT     +T   PP
Sbjct: 2004 TLPTHVPPFSTSLVTPSTHTVIITTHTQMATSASIHSTPTGTVPPPTTLKATGSTHTAPP 2063

Query: 1551 TSTTTLPPTTTPSPPPTTTTTP---------PPTTTPSPPTT--TTPSPPTITTTTPPPT 1599
             + TT   + T S   T T +          P  ++  PP++  TT  P   + TTP  T
Sbjct: 2064 MTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSSRPPSSPITTQLPHLSSATTPVST 2123

Query: 1600 T---------TPSPPTTTTT------TPPPTTTPSPPTTTP-ITPPTSTTTLP------- 1636
            T         +PS P+T ++      + P T++PS  T++  ++ P  +TTL        
Sbjct: 2124 TNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVGTSSSFVSAPVHSTTLSSGSHSSL 2183

Query: 1637 ---PTTT--------PSPPPTTTTTPP--PTTTPSPPTTTTPSPPITTTTTPPPTTTPSS 1683
               PTT         PS P  +TT     P T  SP T +   P  T T +P P++  +S
Sbjct: 2184 STHPTTASVSASPLFPSSPAASTTIRATLPHTISSPFTLSALLPISTVTVSPTPSSHLAS 2243

Query: 1684 PITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTT 1743
                 PS P TT +T +     S   T+ +T  +T  P+    ++T+   T  P+ P T 
Sbjct: 2244 STIAFPSTPRTTASTHTAPAFSSQSTTSRSTSLTTRVPTSGFVSLTS-GVTGIPTSPVTN 2302

Query: 1744 MTTLPPTTTSSPLT---TTPLPPSITPPTFSPFSTT-TPTTPCVPLCN 1787
            +TT  P  T SP T   T+ L    + P  +P S+  TPT     +C+
Sbjct: 2303 LTTRHPGPTLSPTTRFLTSSLTAHGSTPASAPVSSLGTPTPTSPGVCS 2350



 Score =  127 bits (319), Expect = 3e-28
 Identities = 127/429 (29%), Positives = 178/429 (41%), Gaps = 56/429 (13%)

Query: 4002 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ-TPTT 4060
            P   PT  Q PTT  + TT +    PT     T T+T I   ++  P+P+   T  +PT 
Sbjct: 1195 PCMPPTTPQPPTTPQLPTTGS---RPTQVWPMTGTSTTIGLLSSTGPSPSSNHTPASPTQ 1251

Query: 4061 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 4120
            TP+   T  +  PT +  + P  T     T VTP  T   +  P T  + +T T      
Sbjct: 1252 TPLLPATLTSSKPTASSGEPPRPT-----TAVTPQAT---SGLPPTATLRSTAT-----K 1298

Query: 4121 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT-PTPTGTQTPTTTPIT 4179
            PT TQ  T    +T +  T +   + T+T  T P   T+  +PT P  T  + P TT  T
Sbjct: 1299 PTVTQATTRATASTASPATTSTAQSTTRTTMTLPTPATSGTSPTLPKSTNQELPGTT-AT 1357

Query: 4180 TTTTVTPTPTPTGTQTGPPTHTSTAPIA-ELTTSNPPPESSTPQTSRSTSSPLTESTTLL 4238
             TT   PTP  T   T P     T P A E T +    E +TPQT  +T SP T  + + 
Sbjct: 1358 QTTGPRPTPASTTGPTTPQPGQPTRPTATETTQTRTTTEYTTPQTPHTTHSPPTAGSPVP 1417

Query: 4239 STLP-PAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPS 4297
            ST P  A    +T    TP+ P TT   H   PP ST+   P T T  T       PT +
Sbjct: 1418 STGPVTATSFHATTTYPTPSHPETTLPTHV--PPFSTSLVTPSTHTVIT-------PTHA 1468

Query: 4298 TVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDT 4357
             + T+ ++   PT T +  P+ ++ TG                T+ AP   +   T G +
Sbjct: 1469 QMATSASNHSAPTGT-IPPPTTLKATG---------------STHTAP--PITPTTSGTS 1510

Query: 4358 CYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSK--------PTPGTKP 4409
                + S + T    +    ST  P  TP+ +T     P+ST ++         T    P
Sbjct: 1511 QAHSSFSTNKTPTSLHSHTSSTHHPEVTPTSTTTITPNPTSTRTRTPVAHTNSATSSRPP 1570

Query: 4410 PECPDFDPP 4418
            P      PP
Sbjct: 1571 PPFTTHSPP 1579



 Score =  120 bits (302), Expect = 3e-26
 Identities = 106/357 (29%), Positives = 164/357 (45%), Gaps = 34/357 (9%)

Query: 1391 PMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPPP 1450
            P    + TPS  T        +T T   T+     T T T PPPTT  +   T T     
Sbjct: 2011 PFSTSLVTPSTHTVI-----ITTHTQMATSASIHSTPTGTVPPPTTLKATGSTHT----- 2060

Query: 1451 TTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSP--PTTTTTTPP--PTTTPSPPTTT 1506
                +PP++ TT+    T  S  T T S    + S   P  +++ PP  P TT  P  ++
Sbjct: 2061 ----APPMTVTTSGTSQTHSSFSTATASSSFISSSSWLPQNSSSRPPSSPITTQLPHLSS 2116

Query: 1507 PITPPASTTTLPPTTTPSPPT-TTTTTPPPTTTPSPPTTTPITPPTSTTTLPP--TTTPS 1563
              TP ++T  L  + +PSP   +T ++  P++  SP T++P    +S+    P  +TT S
Sbjct: 2117 ATTPVSTTNQLSSSFSPSPSAPSTVSSYVPSSHSSPQTSSPSVGTSSSFVSAPVHSTTLS 2176

Query: 1564 PPPTTTTTPPPTTTPSPPTTTTPSPPTITTT--TPPPTTTPSPPTTTTTTPPPTTTPSPP 1621
                ++ +  PTT     +   PS P  +TT     P T  SP T +   P  T T SP 
Sbjct: 2177 SGSHSSLSTHPTTASVSASPLFPSSPAASTTIRATLPHTISSPFTLSALLPISTVTVSP- 2235

Query: 1622 TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTP 1681
              TP +   S+T   P+T     P TT +       S  +TT+ S  +TT        + 
Sbjct: 2236 --TPSSHLASSTIAFPST-----PRTTASTHTAPAFSSQSTTSRSTSLTTRVPTSGFVSL 2288

Query: 1682 SSPITTTPSPPTTTMTT--PSPTTTPSSP-ITTTTTPSSTTTPSPPPTTMTTPSPTT 1735
            +S +T  P+ P T +TT  P PT +P++  +T++ T   +T  S P +++ TP+PT+
Sbjct: 2289 TSGVTGIPTSPVTNLTTRHPGPTLSPTTRFLTSSLTAHGSTPASAPVSSLGTPTPTS 2345



 Score =  107 bits (267), Expect = 3e-22
 Identities = 102/385 (26%), Positives = 164/385 (42%), Gaps = 53/385 (13%)

Query: 386 PCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAK--GDHNDSYALLGELAPCGSTDKQTC 443
           P  G C+  G  H +TFD   Y F G C Y+ A    D   ++++     P GS      
Sbjct: 40  PDKGQCSTWGAGHFSTFDHHVYDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSIS---- 95

Query: 444 LKTVVLLADKKKNVVVFKSDGSVLLNELQV-NLPHVTASFSVFRPSSYHIMVSMAIGVRL 502
            + +V L       VV  S+  + + ++ V +LP+ +    +        +V+  + + L
Sbjct: 96  -RIIVELGAS----VVTVSEAIISVKDIGVISLPYTSNGLQITPFGQSVRLVAKQLELEL 150

Query: 503 QVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSS 562
           +V   P   L V +++   GQ+ GLCGNF+G   ++F +  G        F    K  + 
Sbjct: 151 EVVWGPDSHLMVLVERKYMGQMCGLCGNFDGKVTNEFVSEEG-------KFLEPHKFAA- 202

Query: 563 CHDKLDWLDDP---C------SLNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKR 613
               L  LDDP   C      S ++  A +A   C+ L     P   C  + +P  +   
Sbjct: 203 ----LQKLDDPGEICTFQDIPSTHVRQAQHA-RICTQLLTLVAP--ECSVSKEP--FVLS 253

Query: 614 CKYDTCNC--QNNEDCLCAALSSYARACTAKGVMLWGWRE-HVCNKDVGSCPNSQVFLYN 670
           C+ D         ++  CA LS Y+R C+  G  +  WR   +C+  VG CP +QV+   
Sbjct: 254 CQADVAAAPQPGPQNSSCATLSEYSRQCSMVGQPVRRWRSPGLCS--VGQCPANQVYQEC 311

Query: 671 LTTCQQTCRSLSEA-DSHCLEGFAPVDGCGCPDHTFLDEKGR---CVPLAKCSCYHRGLY 726
            + C +TC +   +  S C        GC CP+ T L++      CVP+ +C C   G  
Sbjct: 312 GSACVKTCSNPQHSCSSSC------TFGCFCPEGTVLNDLSNNHTCVPVTQCPCVLHGAM 365

Query: 727 LEAGDVVVRQEERCVCRDGRLHCRQ 751
              G+V +   + C C  GR  C +
Sbjct: 366 YAPGEVTIAACQTCRCTLGRWVCTE 390



 Score =  104 bits (260), Expect = 2e-21
 Identities = 120/507 (23%), Positives = 183/507 (36%), Gaps = 70/507 (13%)

Query: 4472 CWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPND 4531
            C    C  +C+  G     TFD   Y + G CTY+L++  SP +   G  +  Y      
Sbjct: 388  CTERPCPGHCSLEGGSFVTTFDARPYRFHGTCTYILLQ--SPQLPEDGALMAVYDKSGVS 445

Query: 4532 KVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDI 4591
                    +V    Q+ ++     +     V  N +A  LPYK   + V++    ++   
Sbjct: 446  HSETSLVAVVYLSRQDKIV-----ISQDEVVTNNGEAKWLPYKTRNITVFRQTSTHLQMA 500

Query: 4592 PELG--VLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAAD 4649
               G  ++V    +  +      +F   T+G CG     T+DD     G          D
Sbjct: 501  TSFGLELVVQLRPIFQAYVTVGPQFRGQTRGLCGNFNGDTTDDFTTSMGIAEGTASLFVD 560

Query: 4650 QWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIK-DSLFAQCHALV 4708
             W        +CP +      P         +  +K C  +    L++  ++F +CHA V
Sbjct: 561  SWRAG-----NCPAALERETDPC------SMSQLNKVCAETHCSMLLRTGTVFERCHATV 609

Query: 4709 PPQHYYDACVFDSC-FMPGSSLECASLQAYAALCAQQNICL-DWRNHTHGACLVECPSHR 4766
             P  +Y  CV+ +C +       CA+L  Y   C+ + + L  WR+     C + C  + 
Sbjct: 610  NPAPFYKRCVYQACNYEETFPHICAALGDYVHACSLRGVLLWGWRSSVDN-CTIPCTGNT 668

Query: 4767 EYQACGPAEEPTCKSSSSQ----QNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGCV--GP 4820
             +     A E TC S S +     ++ V V+GC CP+GT     G  V    C C+  G 
Sbjct: 669  TFSYNSQACERTCLSLSDRATECHHSAVPVDGCNCPDGTYLNQKGECVRKAQCPCILEGY 728

Query: 4821 DNVPREFGEHFEFDCKNCVCLEGGSGIICQP-------------KRCSQ----KPVTHCV 4863
              +  E  +    +   C C+ G      +P             K CSQ    K    C 
Sbjct: 729  KFILAE--QSTVINGITCHCINGRLSCPQRPQMFLASCQAPKTFKSCSQSSENKFGAACA 786

Query: 4864 EDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESK 4923
                 LAT V    T C    C C   L +     C          VP   CP   CE  
Sbjct: 787  PTCQMLATGVACVPTKCE-PGCVCAEGLYENADGQC----------VPPEECP---CEFS 832

Query: 4924 GVCVHGNAEYQPGSPVYSSKCQDCVCT 4950
            GV   G AE         + C+ C C+
Sbjct: 833  GVSYPGGAELH-------TDCRTCSCS 852



 Score =  104 bits (259), Expect = 3e-21
 Identities = 104/373 (27%), Positives = 159/373 (42%), Gaps = 49/373 (13%)

Query: 858  GTCSIYGSGHYITFDGKYYDFDGHCSYV-------AVQDYCGQNSSLGSFSIITENVPCG 910
            G CS +G+GH+ TFD   YDF G C+Y+       A   +  Q       SI    V  G
Sbjct: 43   GQCSTWGAGHFSTFDHHVYDFSGTCNYIFAATCKDAFPTFSVQLRRGPDGSISRIIVELG 102

Query: 911  TTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIW 970
             + VT S+AI        + L      +     G  V    R V + L +E    + V+W
Sbjct: 103  ASVVTVSEAIISVKDIGVISLPYTSNGLQITPFGQSV----RLVAKQLELE----LEVVW 154

Query: 971  DKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDV 1030
               + + + +   Y G +CGLCGNFD +  N+F       VS E  F    K A     +
Sbjct: 155  GPDSHLMVLVERKYMGQMCGLCGNFDGKVTNEF-------VSEEGKFLEPHKFA-ALQKL 206

Query: 1031 STNPEPCSL----NPH-RRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTG 1085
                E C+     + H R++   + C+ L + V   C   V  +PF  +C  D  +    
Sbjct: 207  DDPGEICTFQDIPSTHVRQAQHARICTQLLTLVAPEC--SVSKEPFVLSCQADVAAAPQP 264

Query: 1086 GDCECFCSAVASYAQECTKEGACV-FWRTPDLCPIFCDYYNPPHECEWH--YEPCGNRSF 1142
            G     C+ ++ Y+++C+  G  V  WR+P LC +         +C  +  Y+ CG+   
Sbjct: 265  GPQNSSCATLSEYSRQCSMVGQPVRRWRSPGLCSV--------GQCPANQVYQECGSACV 316

Query: 1143 ETCRTINGIHSNISVSYLEGCYPRCPKDRPIYE-EDLKKCVTADKCGCYVEDTHYPPGAS 1201
            +TC   N  HS  S S   GC+  CP+   + +  +   CV   +C C +    Y PG  
Sbjct: 317  KTCS--NPQHS-CSSSCTFGCF--CPEGTVLNDLSNNHTCVPVTQCPCVLHGAMYAPGE- 370

Query: 1202 VPTEETCKSCVCT 1214
              T   C++C CT
Sbjct: 371  -VTIAACQTCRCT 382



 Score =  101 bits (252), Expect = 2e-20
 Identities = 99/374 (26%), Positives = 150/374 (40%), Gaps = 53/374 (14%)

Query: 15   LSLAGGSELQTEGRTRN------------HGHNVCSTWGNFHYKTFDGDVFRFPGLCDYN 62
            +S  GG+EL T+ RT +            H  + C+ +G  H  TFDG  F F G C+Y 
Sbjct: 834  VSYPGGAELHTDCRTCSCSRGRWACQQGTHCPSTCTLYGEGHVITFDGQRFVFDGNCEYI 893

Query: 63   FASDCRG------SYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAV 116
             A+D  G      ++K    ++  G         ++  L  +    +   R+  V     
Sbjct: 894  LATDVCGVNDSQPTFKILTENVICGNSGVTCSRAIKIFLGGL--SVVLADRNYTVTGEEP 951

Query: 117  VSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNG-L 175
                  +PG L    D    +  R  LTL+WNR   +++ +    ++  CGLCG++NG +
Sbjct: 952  HVQLGVTPGALSLVVD--ISIPGRYNLTLIWNRHMTILIRIARASQDPLCGLCGNFNGNM 1009

Query: 176  QSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSE-HRAECER---LLTA 231
            +   E  S  V  S LE  N  K      +C D      P S +   R+  ER   ++ +
Sbjct: 1010 KDDFETRSRYVASSELELVNSWK---ESPLCGDVSFVTDPCSLNAFRRSWAERKCSVINS 1066

Query: 232  EAFADCQDLVPLEPYLRACQQDRCRC-PGGD-TCVCSTVAEFSRQCSHAGGRPGNWRTAT 289
            + FA C   V   PY  AC +D C C  GGD  C+C  VA +++ C   G    +WRT  
Sbjct: 1067 QTFATCHSKVYHLPYYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCV-DWRTPA 1125

Query: 290  LCPKTCPGNLVYLESG----------------SPCMDTCSHLEVSSLCEEHRMDGCFCPE 333
             CP  C     + + G                 PC+       V        ++GC+   
Sbjct: 1126 FCPIYCGFYNTHTQDGHGEYQYTQEANCTWHYQPCLCPSQPQSVPG----SNIEGCYNCS 1181

Query: 334  GTVYDDIGDSGCVP 347
               Y D  +  CVP
Sbjct: 1182 QDEYFDHEEGVCVP 1195



 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 112/490 (22%), Positives = 177/490 (36%), Gaps = 72/490 (14%)

Query: 4360 FVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPR 4419
            F +CS S   +F   +C  T     T     PT  +P    ++        +C    PP 
Sbjct: 770  FKSCSQSSENKF-GAACAPTCQMLATGVACVPTKCEPGCVCAEGLYENADGQCV---PPE 825

Query: 4420 QENETWWLCDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDC 4479
            +       C C  +   Y    E+   +C      +CS G           C     C  
Sbjct: 826  E-------CPCEFSGVSYPGGAEL-HTDCRTC---SCSRGRW--------ACQQGTHCPS 866

Query: 4480 YCTGWGDPHYVTFDGLYYSYQGNCTYVLVEE---ISPSVDNFGVYIDNYHCDPNDKVSCP 4536
             CT +G+ H +TFDG  + + GNC Y+L  +   ++ S   F +  +N  C  N  V+C 
Sbjct: 867  TCTLYGEGHVITFDGQRFVFDGNCEYILATDVCGVNDSQPTFKILTENVICG-NSGVTCS 925

Query: 4537 RTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELG- 4595
            R +             + +  + V +      V        L V    ++ VVDI   G 
Sbjct: 926  RAI------------KIFLGGLSVVLADRNYTVTGEEPHVQLGVTPGALSLVVDISIPGR 973

Query: 4596 ---VLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWL 4652
                L+    ++  +R+      +   G CG       DD    S  + S+     + W 
Sbjct: 974  YNLTLIWNRHMTILIRIA-RASQDPLCGLCGNFNGNMKDDFETRSRYVASSELELVNSW- 1031

Query: 4653 VNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPSPLCQLIKDSLFAQCHALVPPQH 4712
                  P C   S  T   ++           +       C +I    FA CH+ V    
Sbjct: 1032 ---KESPLCGDVSFVTDPCSLNA--------FRRSWAERKCSVINSQTFATCHSKVYHLP 1080

Query: 4713 YYDACVFDSCFM-PGSSLECA--SLQAYAALCAQQNICLDWRNHTHGACLVECPSHREYQ 4769
            YY+ACV D+C    G   EC   ++ AYA  C  + +C+DWR  T   C + C  +  + 
Sbjct: 1081 YYEACVRDACGCDSGGDCECLCDAVAAYAQACLDKGVCVDWR--TPAFCPIYCGFYNTHT 1138

Query: 4770 ACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGE 4829
              G  E       + + N T   + C CP    +  PG +  ++ C     D    E+ +
Sbjct: 1139 QDGHGE----YQYTQEANCTWHYQPCLCPSQPQS-VPGSN--IEGCYNCSQD----EYFD 1187

Query: 4830 HFEFDCKNCV 4839
            H E  C  C+
Sbjct: 1188 HEEGVCVPCM 1197



 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 104/409 (25%), Positives = 162/409 (39%), Gaps = 64/409 (15%)

Query: 4481 CTGWGDPHYVTFDGLYYSYQGNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLI 4540
            C+ WG  H+ TFD   Y + G C Y+       +   F V +      P+  +S    +I
Sbjct: 45   CSTWGAGHFSTFDHHVYDFSGTCNYIFAATCKDAFPTFSVQLRR---GPDGSIS---RII 98

Query: 4541 VRHETQEVLIKTVHMMPMQVQVQVNRQAVALPYKKYGLEV--YQSGINYVVDIPELGVLV 4598
            V      V +    +    + V      ++LPY   GL++  +   +  V    EL + V
Sbjct: 99   VELGASVVTVSEAIISVKDIGV------ISLPYTSNGLQITPFGQSVRLVAKQLELELEV 152

Query: 4599 SYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSK 4658
             +   S  + L   ++     G CG      +++ +   G+ +   + AA Q L +DP +
Sbjct: 153  VWGPDSHLMVLVERKYMGQMCGLCGNFDGKVTNEFVSEEGKFLEPHKFAALQKL-DDPGE 211

Query: 4659 PHCPHSS--STTKRPAVTVPGGGKTTPHKDCTP-----SPLCQLIKDSLFAQCHALVPPQ 4711
              C      ST  R A            + CT      +P C + K+     C A V   
Sbjct: 212  -ICTFQDIPSTHVRQAQHA---------RICTQLLTLVAPECSVSKEPFVLSCQADVA-- 259

Query: 4712 HYYDACVFDSCFMPG-SSLECASLQAYAALCAQQNICL-DWRNHTHGACLV-ECPSHREY 4768
                     +   PG  +  CA+L  Y+  C+     +  WR  + G C V +CP+++ Y
Sbjct: 260  ---------AAPQPGPQNSSCATLSEYSRQCSMVGQPVRRWR--SPGLCSVGQCPANQVY 308

Query: 4769 QACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGT-MNYAPGFDVCVKT--CGCV--GPDNV 4823
            Q CG A   TC S+     ++    GCFCPEGT +N       CV    C CV  G    
Sbjct: 309  QECGSACVKTC-SNPQHSCSSSCTFGCFCPEGTVLNDLSNNHTCVPVTQCPCVLHGAMYA 367

Query: 4824 PREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHC-VEDGTYLAT 4871
            P   GE     C+ C C  G    +C  + C      HC +E G+++ T
Sbjct: 368  P---GEVTIAACQTCRCTLG--RWVCTERPCP----GHCSLEGGSFVTT 407



 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 70/253 (27%), Positives = 98/253 (38%), Gaps = 45/253 (17%)

Query: 4173 PTTTPITTTTTVTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLT 4232
            P TTP   TT   PT     TQ  P T TST  I  L+++ P P S+    S  T +PL 
Sbjct: 1198 PPTTPQPPTTPQLPTTGSRPTQVWPMTGTSTT-IGLLSSTGPSPSSNHTPAS-PTQTPLL 1255

Query: 4233 ESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSS 4292
             +T  L++  P         P+T   P  TSG    +   ST T P  T T+ TT  ++S
Sbjct: 1256 PAT--LTSSKPTASSGEPPRPTTAVTPQATSGLPPTATLRSTATKP--TVTQATTRATAS 1311

Query: 4293 APTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRP-YPSSVLICCVLNDTYYAPGEEVYN 4351
              +P+T  T+T  + T T   L TP+   T+G  P  P S               +E+  
Sbjct: 1312 TASPAT--TSTAQSTTRTTMTLPTPA---TSGTSPTLPKST-------------NQELPG 1353

Query: 4352 GTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPE 4411
             T   T                    + P PTP  +    TP     T    T  T+   
Sbjct: 1354 TTATQT--------------------TGPRPTPASTTGPTTPQPGQPTRPTATETTQTRT 1393

Query: 4412 CPDFDPPRQENET 4424
              ++  P+  + T
Sbjct: 1394 TTEYTTPQTPHTT 1406



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 4/99 (4%)

Query: 5066 TPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEE 5125
            TP   +   CS      E+++ GC   V +  C G+C +   ++   Q +D  CSCC+  
Sbjct: 2340 TPTPTSPGVCSVREQQEEITFKGCMANVTVTRCEGACISAASFNIITQQVDARCSCCRPL 2399

Query: 5126 KTSQREVVLSCPN----GGSLTHTYTHIESCQCQDTVCG 5160
             + ++++ L CP+    G  L  T      C C    CG
Sbjct: 2400 HSYEQQLELPCPDPSTPGRRLVLTLQVFSHCVCSSVACG 2438


>gi|167736355 mucin 4 isoform a [Homo sapiens]
          Length = 5284

 Score =  832 bits (2148), Expect = 0.0
 Identities = 938/3345 (28%), Positives = 1377/3345 (41%), Gaps = 415/3345 (12%)

Query: 1397 TTPSPPTTTPSP--------PPTST-------TTLPPTTTPSPPTTTTTTPPPTTTPSPP 1441
            TTP P T T S         P T T       TT    T  S  +T   TP P T+ S  
Sbjct: 1118 TTPLPVTDTSSASTGHATSLPVTDTSSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSV 1177

Query: 1442 ITTTTTPPPTTTPS--------PPISTTT--------TPPPTTTPSPPTT--TPSPPTTT 1483
             T  TTP P T+PS        P + T T        TP P T  S  +T    S P T 
Sbjct: 1178 STGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVSTDHATSLPVTI 1237

Query: 1484 PSPPTTTTTTPPPTTTPSPPTTTPITPPASTTTLPPT---TTPSPPTTTTT------TPP 1534
            PS  +T  TTP P T  S  +T   T    T T   +   TTP P T+T++      TP 
Sbjct: 1238 PSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVTSTSSASTGHVTPL 1297

Query: 1535 PTTTPSPPTTTPITPPTSTT--------TLP-PTTTPSPPPTTTTTPPPTTTPSPPTT-- 1583
              T+PS  +T   TP   T+        T+P P T+PS   T  TTP P T  S  +T  
Sbjct: 1298 HVTSPSSASTGHATPLPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVSTGH 1357

Query: 1584 TTP------SPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITP--------- 1628
            TTP      S  +    TP P T+ S  +T  TTP P T+PS  +T   TP         
Sbjct: 1358 TTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSA 1417

Query: 1629 PTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTPSSPITTT 1688
             T   T  P T  S   T   T  P T PS  +T   +P   T T+   T   +S + T 
Sbjct: 1418 STGHATPLPVTDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTD 1477

Query: 1689 PSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMT-TL 1747
             S  +T  TTP P T+ SS  T   TP   T+PS   T   TP P T+ S  +T  T  L
Sbjct: 1478 TSSVSTGDTTPLPVTSTSSASTGHVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTMPL 1537

Query: 1748 PPTTTSSPLT--TTPLPPS---------ITP-PTFSPFSTTTPTTPCVPLCNWTGWLDSG 1795
            P T+ SS  T  TTPLP +          TP P  SP S +T  T  +P+ + +      
Sbjct: 1538 PVTSPSSASTGDTTPLPVTDASSVSTGHTTPLPVTSPSSASTGHTTPLPVTDTSS----- 1592

Query: 1796 KPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQ 1855
                    GDT  +  V  P  A+          D      G T    V+          
Sbjct: 1593 -----ASKGDTTPL-PVTSPSSASTGHTTPLPVTDTSSASTGDTTPLPVT-----NASSL 1641

Query: 1856 KPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTG 1915
              G   P+               VT P++  +T    P P T+T   +T   TP P  TG
Sbjct: 1642 STGHATPLH--------------VTSPSS-ASTGHATPLPVTSTSSASTGHATPLPV-TG 1685

Query: 1916 TQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 1974
              + TT   T       +   TG  TP   T +++ +T   TP P  + +  +T   +  
Sbjct: 1686 LSSATTDDTTRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHASPL 1745

Query: 1975 TVT-PTPTPTGTQTPTTTPITTTTTVT---PTPTP-TGTQTPTTTPIT--TTTTVTPTPT 2027
             VT  +   TG  TP   P+T T++V+    TP P TG  + +T   T    T V+   T
Sbjct: 1746 LVTDASSASTGQATP--LPVTDTSSVSTAHATPLPVTGLSSASTDDTTRLPVTDVSSAST 1803

Query: 2028 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2087
                  P T+P + +T  T TP P    +  +T  TT+  VT  P+   +   T+ P+T 
Sbjct: 1804 GQAIPLPVTSPSSASTGDT-TPLPVTDASSASTGDTTSLPVT-IPSSASSGHTTSLPVTD 1861

Query: 2088 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2147
             ++V+     +   T  ++  T  TT  P        T  TTP+   T  +   T   T 
Sbjct: 1862 ASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNSASTGDTTPL-HVTDASSVSTGHATS 1920

Query: 2148 TPTT---TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 2204
             P T   +  T  TT  P  +P+   +  TTP+   T  +  PT   T  P T   + +T
Sbjct: 1921 LPVTSLSSASTGDTTPLPVTSPSSASSGHTTPL-PVTDASSVPTGHATSLPVTDASSVST 1979

Query: 2205 -TVTPTP----TPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTP 2256
               TP P    +   T   T  P+T T++V+    TP P  + +  +T  TT   VT T 
Sbjct: 1980 GHATPLPVTDASSVSTGHATPLPVTDTSSVSTGQATPLPVTSLSSASTGDTTPLPVTDTS 2039

Query: 2257 T-PTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2314
            +  TG  TP   T +++ +T   TP P  + +  +T   T   VT   +   T   T+  
Sbjct: 2040 SASTGQDTPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDA-SSVSTGHATSLL 2098

Query: 2315 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2374
            +T  ++V+         T  ++  T  TT  P  +P+   T  TTP+  T T     +  
Sbjct: 2099 VTDASSVSTGHATALHVTDASSLSTGDTTPLPVTSPSSASTGDTTPLPVTDT-----SSV 2153

Query: 2375 GTQTPTTTPITTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQTPTTTPITTT 2433
             T   T+ P+T T++ +   T   T  P T T   +T   TP P  T T + +T   T  
Sbjct: 2154 STGHATSLPVTDTSSAS---TGHATSLPVTDTSSASTGHATPLPV-TDTSSASTGQATPL 2209

Query: 2434 TTVTPTPTPTGTQTP---TTTPITTTTTVTPTPTP--TGTQTPTTTPITTT--------- 2479
               +P+   TG   P   T T   +T   TP P    +   T  TTP+  T         
Sbjct: 2210 PVTSPSSASTGHAIPLLVTDTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSVSTGH 2269

Query: 2480 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQ 2538
             T  P  + +   T  TTP+  T   +P+   TG  TP   T  ++ +T   TP P  + 
Sbjct: 2270 ATSLPVTSLSSVSTGDTTPLPVT---SPSSASTGHATPLHVTDASSASTGHATPLPVTSL 2326

Query: 2539 TPTTTPITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2596
            +  +T  TT   VT P+   TG  TP   T  ++ +T   TP P    T +++  +  TT
Sbjct: 2327 SSASTGDTTPLPVTSPSSASTGHATPLHVTDASSVSTGDTTPLPV---TSSSSASSGHTT 2383

Query: 2597 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT---TPITTTTTVTPTPTPTGTQ 2653
              P    +   T  TTP+  T T +   T   T  P T   +  T  TT  P    +   
Sbjct: 2384 PLPVTDASSASTGDTTPLPVTDT-SSASTGHATHLPVTGLSSASTGDTTRLPVTNVSSAS 2442

Query: 2654 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2713
            T   TP+  T+T   +   TG  TP   P T T++V+   T     T  ++  T  TT  
Sbjct: 2443 TGHATPLPVTST---SSASTGDTTP--LPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRL 2497

Query: 2714 PTPTPTGTQTPTTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2768
            P  +P+   T  TTP+  T T +      TP P    +  +T   T+  VT +P+   T 
Sbjct: 2498 PVTSPSSASTGHTTPLPVTDTPSASTGDTTPLPVTNASSLSTRHATSLHVT-SPSSASTG 2556

Query: 2769 TPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPT-PTPTGTQTPTTTPITTT 2824
              T+ P+T T+  +    TP P  + +  +T  TT   VT T    TG  TP   P+T T
Sbjct: 2557 HATSLPVTDTSAASTGHATPLPVTSTSSASTGDTTPLPVTDTYSASTGQATP--LPVTDT 2614

Query: 2825 TTVTPTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2881
            ++ +     TG  TP   T T   +T   TP P  T T + +T   T     +P+   TG
Sbjct: 2615 SSAS-----TGDTTPLPVTDTSSASTGHATPLPV-TNTSSVSTGHATPLHVTSPSSASTG 2668

Query: 2882 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 2941
              TP   P+T  ++V+     +   T  ++  T   T  P   P+   +  TTP+  T  
Sbjct: 2669 HTTP--LPVTDASSVSTGHATSLPVTDASSVFTGHATSLPVTIPSSASSGHTTPLPVTDA 2726

Query: 2942 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTVTPTPTPTGTQTP 3000
                 +   T   T+ P+T  ++V+     TG  TP   T  ++ +T   TP P  + + 
Sbjct: 2727 -----SSVSTGHATSLPVTDASSVS-----TGHATPLPVTDASSVSTGHATPLPLTSLSS 2776

Query: 3001 TTTPITTTTTVTPTPT-PTGTQTP-TTTPITTTTTVTPTPTP------TGTQTPTTTPIT 3052
             +T  TT   VT T +  TG  TP   T +++ +T   TP P        T   T+ P+T
Sbjct: 2777 VSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDTSSASTGHATSLPVT 2836

Query: 3053 TTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 3109
             T++ +    TP P    +  +T   T   VT T +       T+ P+T T++++     
Sbjct: 2837 DTSSASTGHATPLPDTDTSSASTGHATLLPVTDT-SSASIGHATSLPVTDTSSIS----- 2890

Query: 3110 TGTQTP--TTTPITTTT-TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3166
            TG  TP   T+P + +T   TP P  T T + +T         +P+   TG  TP   P+
Sbjct: 2891 TGHATPLHVTSPSSASTGHATPLPV-TDTSSASTGHANPLHVTSPSSASTGHATP--LPV 2947

Query: 3167 TTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3223
            T T++ +    TP P    T  ++  T  TT  P  +P+   T  TTP+  T T     +
Sbjct: 2948 TDTSSASTGHATPLPV---TSLSSVSTGDTTPLPVTSPSSASTGHTTPLPVTDT-----S 2999

Query: 3224 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3283
               T   T  P+T+T++ +   T     T T++  T   T  P  + +   T  TTP+  
Sbjct: 3000 SASTGQATALPVTSTSSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPV 3059

Query: 3284 TTTVTPTPTPTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 3342
            T   +P+   TG  TP   T  ++ +T   TP P  + +  +T  TT   VT +P+   T
Sbjct: 3060 T---SPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVT-SPSSAST 3115

Query: 3343 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3402
               T+ P+T T++ +   T +   T T++  T  TT  P    + + T  TTP+  T T 
Sbjct: 3116 GHATSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVTET- 3174

Query: 3403 TPTPTPTGTQTP-TTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTT-------VTP 3450
              +   TG  TP   T  ++ +T   TP    +P+   T  TTP+  T T        TP
Sbjct: 3175 --SSVSTGHATPLLVTDASSASTGHATPLHVTSPSSASTGDTTPVPVTDTSSVSTGHATP 3232

Query: 3451 TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGT 3503
             P  TG  + +T   T       +   TG  TP   P+T T++V+       P  +P+  
Sbjct: 3233 LPV-TGLSSASTGDTTRLPVTDISSASTGQATP--LPVTNTSSVSTGDTMPLPVTSPSSA 3289

Query: 3504 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3563
             T   TP+  T+T   +   TG  TP   P+T+T++ +   T     T T++  T  TT 
Sbjct: 3290 STGHATPLPVTST---SSASTGHATP--VPVTSTSSASTGHTTPLPVTDTSSASTGDTTP 3344

Query: 3564 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTG-TQTPTTTPITTTTTVTPTPTPTGTQTPT 3622
             P  +P+   T  TTP+  T    P+   TG T T   T  ++ +T   TP P    T T
Sbjct: 3345 LPVTSPSSASTGHTTPLHVT---IPSSASTGDTSTLPVTGASSASTGHATPLPV---TDT 3398

Query: 3623 TTPITTTTTVTPTPTPTGTQTPTTTPITTT-----TTVTPTPTPTGTQTPTTTPITTTTT 3677
            ++  T   T  P  + +   T  TTP+  T     +T   TP P  + +  +T  TT   
Sbjct: 3399 SSVSTGHATPLPVTSLSSVSTGDTTPLPVTDASSASTGQATPLPVTSLSSVSTGDTTPLL 3458

Query: 3678 VT-PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3736
            VT  +   TG  TP   P+T T++ +   T     T T++  T   T  P  + +   T 
Sbjct: 3459 VTDASSVSTGHATP--LPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTSLSSVSTG 3516

Query: 3737 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3796
             TTP+  T     +   TG  TP   P+T T++ +   T     T T++  T   T  P 
Sbjct: 3517 DTTPLLVTDA---SSVSTGHATP--LPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPV 3571

Query: 3797 PTPTGTQTPTTTPITTTTT-------VTP--TPTPTGTQTPTTTPITTTTTVTPTPTPTG 3847
              P+ + +  TTP+  T+T       VTP    +P+   T   TP+  T+T   +   TG
Sbjct: 3572 TIPSSSSSGHTTPLPVTSTSSVSTGHVTPLHVTSPSSASTGHVTPLPVTST---SSASTG 3628

Query: 3848 TQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPTTTPITTT 3905
              TP   T  ++ +T   TP P    +  +T  TT   VT T +  TG  TP   P+T+ 
Sbjct: 3629 HATPLLVTDASSVSTGHATPLPVTDASSASTGDTTPLPVTDTSSASTGQATP--LPVTSL 3686

Query: 3906 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3965
            ++V+   T     T  ++  T   T  P   P+   T  T P+  T   +P+   TG  T
Sbjct: 3687 SSVSTGDTTPLPVTDASSASTGHATPLPVTIPSSVSTGDTMPLPVT---SPSSASTGHAT 3743

Query: 3966 P-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 4024
            P   T +++ +T   TP P      T T   +T   TP P  T T + +T   T      
Sbjct: 3744 PLPVTGLSSASTGDTTPLPV-----TDTSSASTRHATPLPV-TDTSSASTDDTTRLPVTD 3797

Query: 4025 PTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 4081
             +   TG  TP   T+T   +T   TP P  T T + +T   T+    + +   TG  TP
Sbjct: 3798 VSSASTGHATPLPVTSTSSASTGDTTPLPV-TDTSSVSTGHATSLPVTSRSSASTGHATP 3856

Query: 4082 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT---TV 4138
               P+T T++V+     TG  TP   P+T+T++V+   T   T  P T+P + +T   T 
Sbjct: 3857 --LPVTDTSSVS-----TGHATP--LPVTSTSSVS---TGHATPLPVTSPSSASTGHATP 3904

Query: 4139 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTTTVTPTPTPTGTQTG 4196
             P  + +   T  TTP+  T     +   TG  TP   T+P + +   T T   T   + 
Sbjct: 3905 VPVTSTSSASTGDTTPLPVTNA---SSLSTGHATPLHVTSPSSASRGDTSTLPVTDASSA 3961

Query: 4197 PPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTP 4256
               H +  P+  L  S+     +TP     TSS  T   T L     +   T    P   
Sbjct: 3962 STGHATPLPLTSL--SSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPV 4019

Query: 4257 TAPTTTSGGHTLSPP---PSTTTSPPGTPTRGTTTGSSS----APTPSTVQTTTTSAWTP 4309
            T P++ S GHT S P    S+ ++  GTP   T+T S+S     P P T  T++ S    
Sbjct: 4020 TIPSSASSGHTTSLPVTDASSVSTGHGTPLPVTSTSSASTGDTTPLPVT-DTSSASTGHA 4078

Query: 4310 TPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTL 4369
            TP P++  S   T    P P + L       T +A    V + T   T   V+      +
Sbjct: 4079 TPLPVTDTSSASTGHATPLPVTSLSSV---STGHATPLAVSSATSAST---VSSDSPLKM 4132

Query: 4370 EFYNWSCPS---------TPSPTPTPSKS--TPTPSKPSSTPSKPTPGTKPPE------- 4411
            E    + PS           SP PT S++  +  PS    T S   P    PE       
Sbjct: 4133 ETPGMTTPSLKTDGGRRTATSPPPTTSQTIISTIPSTAMHTRSTAAPIPILPERGVSLFP 4192

Query: 4412 -------------CPDFDPPRQENETWW-LCDCFMATCKYNNTVEIVKVECE------PP 4451
                           DF  P  +  T + L      +  + +  +I+  E +      P 
Sbjct: 4193 YGAGAGDLEFVRRTVDFTSPLFKPATGFPLGSSLRDSLYFTDNGQIIFPESDYQIFSYPN 4252

Query: 4452 PMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLY 4496
            P+PT   G  PV +  P      W+   + TG G   Y  ++  Y
Sbjct: 4253 PLPTGFTGRDPVALVAP-----FWDDADFSTGRGTTFYQEYETFY 4292



 Score =  796 bits (2057), Expect = 0.0
 Identities = 981/3628 (27%), Positives = 1436/3628 (39%), Gaps = 539/3628 (14%)

Query: 1183 TADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEI 1242
            TA    C V +T       + T  T       N  +    P  G ++  T      +   
Sbjct: 245  TATSSLCSVTNTSMMTSEKI-TVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALVTF--- 300

Query: 1243 CGPNGTVEKHFNICSITTRPSTLTTFTTITLPTTPTTFTTTTTTTTP-TSSTVLSTTPKL 1301
              P G     F+  S     +      T ++ TT  +   T  T TP T+STVLS+    
Sbjct: 301  -DPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSS---- 355

Query: 1302 CCLWSDWINEDHPSSGSDDG--DRETFDGVCGAPEDIECRSVKDPHLSLEQLGQK-VQCD 1358
                        PS  +  G   +ETF    G        SV +  L   ++ +     D
Sbjct: 356  ------------PSGFNPSGTVSQETFPS--GETTTSSPSSVSNTFLVTSKVFRMPTSRD 401

Query: 1359 VSVGFICKNEDQFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPP 1418
             ++G    N ++      G       +V+  W  D   T  SP +    PP  ST     
Sbjct: 402  STLG----NTEETSLSVSGTISAITSKVSTIWWSDTLSTALSPSSL---PPKISTAF--- 451

Query: 1419 TTTPSPPTTTTTTPPPTTTPSPPIT--------TTTTPPP------TTTPSPPISTTTTP 1464
             T  S    TT  P   ++ SP ++        TTT P        TT     + +T+T 
Sbjct: 452  HTQQSEGAETTGRPHERSSFSPGVSQEIFTLHETTTWPSSFSSKGHTTWSQTELPSTSTG 511

Query: 1465 PPT--TTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPAS--------T 1514
              T   T +P T T       PS  +       PTT  S  TT P T  A         T
Sbjct: 512  AATRLVTGNPSTGTAGTIPRVPSKVSAIGEPGEPTTYSSHSTTLPKTTGAGAQTQWTQET 571

Query: 1515 TTLPPTTTPSPPTTTTTTPPPTTTPSPP------TTTPIT--PPTSTTTLPPTTT-PSPP 1565
             T       SP  + T      T+PS        T+  IT  P T+ +T+  T+T P   
Sbjct: 572  GTTGEALLSSPSYSVTQMIKTATSPSSSPMLDRHTSQQITTAPSTNHSTIHSTSTSPQES 631

Query: 1566 PTTTT---TPPPTTTPSPPTTTTPSPPTIT-TTTPP---------------PTTTPSPPT 1606
            P  +    T  P TT    TT + SP T T T T P               P   P+   
Sbjct: 632  PAVSQRGHTQAPQTTQESQTTRSVSPMTDTKTVTTPGSSFTASGHSPSEIVPQDAPTISA 691

Query: 1607 TTTTTPPPT----TTPSPPTTTPITPPTSTTTLPPT--TTPSPPPTTTTTPPPTTTPSPP 1660
             TT  P PT    TT +P T     P +   TL P+  T+ S     T      +TP  P
Sbjct: 692  ATTFAPAPTGDGHTTQAPTTALQAAPSSHDATLGPSGGTSLSKTGALTLANSVVSTPGGP 751

Query: 1661 --------TTTTPSPPITTTTTPPPTTTPSSPITTTPSPPTT-TMTTPSPTTTPSSPITT 1711
                     +T+P      T T    +T +S  T T  P ++ + TT + T TPSS   +
Sbjct: 752  EGQWTSASASTSPDTAAAMTHTHQAESTEASGQTQTSEPASSGSRTTSAGTATPSSSGAS 811

Query: 1712 TTTPSSTTTPSPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPL--TTTPLPPSITPPT 1769
             TTPS +   S    T    S  +  S  T + T L   + S      +T +  SI P T
Sbjct: 812  GTTPSGSEGISTSGETTRFSSNPSRDSHTTQSTTELLSASASHGAIPVSTGMASSIVPGT 871

Query: 1770 FSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYP 1829
            F P  +   T              +G+P                  G ++  S  A+   
Sbjct: 872  FHPTLSEAST--------------AGRPT-----------------GQSSPTSPSASPQE 900

Query: 1830 DVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTT 1889
               I ++ QT     S G             I +A               +Q T   T +
Sbjct: 901  TAAISRMAQTQRTRTSRG----------SDTISLA---------------SQATD--TFS 933

Query: 1890 TENPTPP--TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 1947
            T  PTPP  T+T +T+  T T T +P+G+    TT + +  T  P    +   T  TTP+
Sbjct: 934  TVPPTPPSITSTGLTSPQTETHTLSPSGSGKTFTTALISNATPLPVTYASSASTGHTTPL 993

Query: 1948 TTT---------TTVTPTPTPTGTQTPTTTPITTTTT-------VTPTPTP------TGT 1985
              T          T  P  +P+   T  TTP+  T T       VTP P        TG 
Sbjct: 994  HVTDASSVSTGHATPLPVTSPSSVSTGHTTPLPVTDTSSESTGHVTPLPVTSFSSASTGD 1053

Query: 1986 QTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 2042
             TP   P+T T++ +    TP P  + +  +T  TT   VT T + + T   T+ P+T T
Sbjct: 1054 STPL--PVTDTSSASTGHVTPLPVTSLSSASTGDTTPLPVTDTSSAS-TGHATSLPVTDT 1110

Query: 2043 TTVTP---TPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT-TTPITTTTTVTPTPTP 2097
            ++V+    TP P    +  +T   T+  VT T +  TG  TP   T  ++ +T   TP P
Sbjct: 1111 SSVSTGHTTPLPVTDTSSASTGHATSLPVTDTSSVSTGHTTPLHVTDASSASTGQATPLP 1170

Query: 2098 TGTQTPTTTPITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPIT 2155
              + +  +T  TT   VT P+   TG  TP   T  ++ +T   TP P    T  ++  T
Sbjct: 1171 VTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPV---TDASSVST 1227

Query: 2156 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2215
               T  P   P+   T  TTP+  T T + +     +   T T   +T   TP P  T T
Sbjct: 1228 DHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPV-TST 1286

Query: 2216 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTP 2268
             + +T  +T     +P+   TG  TP   P+T+ ++ +       P  +P+   T  TTP
Sbjct: 1287 SSASTGHVTPLHVTSPSSASTGHATPL--PVTSLSSASTGDTMPLPVTSPSSASTGDTTP 1344

Query: 2269 ITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPT 2326
            +  T     +   TG  TP   T  ++ +T   TP P  + +  +T  TT   VT P+  
Sbjct: 1345 LPVTDA---SSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSA 1401

Query: 2327 PTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2385
             TG  TP   T  ++ +T   TP P    T  ++  T   T  P   P+   T  TTP+ 
Sbjct: 1402 STGHATPLLVTDTSSASTGHATPLPV---TDASSVSTDHATSLPVTIPSAASTGHTTPLP 1458

Query: 2386 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2445
             T T + +     +   T T   +T   TP P  T T + +T  +T     +P+   TG 
Sbjct: 1459 VTDTSSASTGQATSLLVTDTSSVSTGDTTPLPV-TSTSSASTGHVTPLHVTSPSSASTGH 1517

Query: 2446 QTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTT---------TTVTPTPTPT 2489
             TP   P+T+ ++ +       P  +P+   T  TTP+  T         TT  P  +P+
Sbjct: 1518 ATPL--PVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVSTGHTTPLPVTSPS 1575

Query: 2490 GTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTTPITTTTTVTP-----TPTPT 2535
               T  TTP+  T         TT  P  +P+   T  TTP+  T T +      TP P 
Sbjct: 1576 SASTGHTTPLPVTDTSSASKGDTTPLPVTSPSSASTGHTTPLPVTDTSSASTGDTTPLPV 1635

Query: 2536 GTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPI 2591
               +  +T   T   VT P+   TG  TP   T+T   +T   TP P  TG  + TT   
Sbjct: 1636 TNASSLSTGHATPLHVTSPSSASTGHATPLPVTSTSSASTGHATPLPV-TGLSSATTDDT 1694

Query: 2592 TTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP- 2649
            T       +   TG  TP   T +++ +T   TP P  + +  +T   +   VT   +  
Sbjct: 1695 TRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHASPLLVTDASSAS 1754

Query: 2650 TGTQTP---TTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTTVT-------PTPTP 2695
            TG  TP   T T   +T   TP P    +   T   T  P+T  ++ +       P  +P
Sbjct: 1755 TGQATPLPVTDTSSVSTAHATPLPVTGLSSASTDDTTRLPVTDVSSASTGQAIPLPVTSP 1814

Query: 2696 TGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGT 2744
            +   T  TTP+  T         TT  P   P+   +  TT  P+T  ++V+     +  
Sbjct: 1815 SSASTGDTTPLPVTDASSASTGDTTSLPVTIPSSASSGHTTSLPVTDASSVSTGHATSLL 1874

Query: 2745 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT---PITTT 2801
             T  ++  T  TT  P        T  TTP+  T   +   T   T  P T+     T  
Sbjct: 1875 VTDASSVSTGDTTPLPVTDTNSASTGDTTPLHVTDA-SSVSTGHATSLPVTSLSSASTGD 1933

Query: 2802 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT-VTPTPTP---- 2856
            TT  P  +P+   +  TTP+  T   +  PT   T  P T   + +T   TP P      
Sbjct: 1934 TTPLPVTSPSSASSGHTTPLPVTDA-SSVPTGHATSLPVTDASSVSTGHATPLPVTDASS 1992

Query: 2857 --TGTQTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTPT- 2909
              TG  TP   P+T T++V+    TP P  + +  +T  TT   VT T +  TG  TP  
Sbjct: 1993 VSTGHATPL--PVTDTSSVSTGQATPLPVTSLSSASTGDTTPLPVTDTSSASTGQDTPLP 2050

Query: 2910 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2969
             T +++ +T   TP P  + +  +T   T   VT   +   T   T+  +T  ++V+   
Sbjct: 2051 VTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASS-VSTGHATSLLVTDASSVSTGH 2109

Query: 2970 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT------------VTPTPTP 3017
                  T  ++  T  TT  P  +P+   T  TTP+  T T            VT T + 
Sbjct: 2110 ATALHVTDASSLSTGDTTPLPVTSPSSASTGDTTPLPVTDTSSVSTGHATSLPVTDTSSA 2169

Query: 3018 TGTQTPTTTPITTTTTVTP---TPTP-TGTQTPTTTPITTTTTVTPTPTPTGTQTP---T 3070
            + T   T+ P+T T++ +    TP P T T + +T   T     +P+   TG   P   T
Sbjct: 2170 S-TGHATSLPVTDTSSASTGHATPLPVTDTSSASTGQATPLPVTSPSSASTGHAIPLLVT 2228

Query: 3071 TTPITTTTTVTPTPTPT--GTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTTP 3119
             T   +T   TP P  +     T  TTP+  T          T  P  + +   T  TTP
Sbjct: 2229 DTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSVSTGHATSLPVTSLSSVSTGDTTP 2288

Query: 3120 ITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPT 3177
            +  T+   P+   TG  TP   T  ++ +T   TP P  + +  +T  TT   VT P+  
Sbjct: 2289 LPVTS---PSSASTGHATPLHVTDASSASTGHATPLPVTSLSSASTGDTTPLPVTSPSSA 2345

Query: 3178 PTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTP---TT 3232
             TG  TP   T  ++ +T   TP P  + +  ++  TT   VT   +  TG  TP   T 
Sbjct: 2346 STGHATPLHVTDASSVSTGDTTPLPVTSSSSASSGHTTPLPVTDASSASTGDTTPLPVTD 2405

Query: 3233 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP---TTTPITTTTTVTP 3289
            T   +T   T  P  TG  + +T   T       +   TG  TP   T+T   +T   TP
Sbjct: 2406 TSSASTGHATHLPV-TGLSSASTGDTTRLPVTNVSSASTGHATPLPVTSTSSASTGDTTP 2464

Query: 3290 TP--TPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTTPITTTTTVTP--- 3335
             P    +   T  TTP+  T         TT  P  +P+   T  TTP+  T T +    
Sbjct: 2465 LPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRLPVTSPSSASTGHTTPLPVTDTPSASTG 2524

Query: 3336 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP---TPTPTGTQT 3390
              TP P    +  +T   T+  VT +P+   T   T+ P+T T+  +    TP P  + +
Sbjct: 2525 DTTPLPVTNASSLSTRHATSLHVT-SPSSASTGHATSLPVTDTSAASTGHATPLPVTSTS 2583

Query: 3391 PTTTPITTTTTVTPT-PTPTGTQTP---TTTPITTTTTVTPTPTP------TGTQTPTTT 3440
              +T  TT   VT T    TG  TP   T T   +T   TP P        TG  TP   
Sbjct: 2584 SASTGDTTPLPVTDTYSASTGQATPLPVTDTSSASTGDTTPLPVTDTSSASTGHATPL-- 2641

Query: 3441 PITTTTTV-----TP----TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3491
            P+T T++V     TP    +P+   T   T  P+T  ++V+     +   T  ++  T  
Sbjct: 2642 PVTNTSSVSTGHATPLHVTSPSSASTGHTTPLPVTDASSVSTGHATSLPVTDASSVFTGH 2701

Query: 3492 TTVTPTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTTPITTT----- 3537
             T  P   P+   +  TTP+  T          T  P    +   T   TP+  T     
Sbjct: 2702 ATSLPVTIPSSASSGHTTPLPVTDASSVSTGHATSLPVTDASSVSTGHATPLPVTDASSV 2761

Query: 3538 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTPT-TTPITTTTTVTPTPTPTGT 3595
            +T   TP P  + +  +T  TT   VT T +  TG  TP   T +++ +T   TP P   
Sbjct: 2762 STGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTD 2821

Query: 3596 QTPTTTPITTTTTVTPTPTP-TGTQTP---TTTPITTTTTVTPTP-TPTGTQT---PTTT 3647
             +  +T   T+  VT T +  TG  TP   T T   +T   T  P T T + +    T+ 
Sbjct: 2822 TSSASTGHATSLPVTDTSSASTGHATPLPDTDTSSASTGHATLLPVTDTSSASIGHATSL 2881

Query: 3648 PITTTTTVTP---TP----TPTGTQTPTTTPITTTTT-------------VTPTPTPTGT 3687
            P+T T++++    TP    +P+   T   TP+  T T              +P+   TG 
Sbjct: 2882 PVTDTSSISTGHATPLHVTSPSSASTGHATPLPVTDTSSASTGHANPLHVTSPSSASTGH 2941

Query: 3688 QTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP-----TT 3738
             TP   P+T T++ +    TP P  + +  +T  TT   VT P+   TG  TP     T+
Sbjct: 2942 ATPL--PVTDTSSASTGHATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHTTPLPVTDTS 2999

Query: 3739 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTV 3793
            +  T   T  P  + +   T  TTP+  T T +      TP P  + +  +T  TT   V
Sbjct: 3000 SASTGQATALPVTSTSSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPV 3059

Query: 3794 T-PTPTPTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3851
            T P+   TG  TP   T  ++ +T   TP P  + +  +T  TT   VT +P+   T   
Sbjct: 3060 TSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVT-SPSSASTGHA 3118

Query: 3852 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 3911
            T+ P+T T++ +   T +   T T++  T  TT  P    + + T  TTP+  T T   +
Sbjct: 3119 TSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSSTGDTTPLLVTET---S 3175

Query: 3912 PTPTGTQTP-TTTPITTTTTVTPTP----TPTGTQTPTTTPITTTTT-------VTPTPT 3959
               TG  TP   T  ++ +T   TP    +P+   T  TTP+  T T        TP P 
Sbjct: 3176 SVSTGHATPLLVTDASSASTGHATPLHVTSPSSASTGDTTPVPVTDTSSVSTGHATPLPV 3235

Query: 3960 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTP 4012
             TG  + +T   T       +   TG  TP   P+T T++V+       P  +P+   T 
Sbjct: 3236 -TGLSSASTGDTTRLPVTDISSASTGQATP--LPVTNTSSVSTGDTMPLPVTSPSSASTG 3292

Query: 4013 TTTPITTTTTVTPTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4069
              TP+  T+T   +   TG  TP   T+T   +T   TP P  T T + +T   T     
Sbjct: 3293 HATPLPVTST---SSASTGHATPVPVTSTSSASTGHTTPLPV-TDTSSASTGDTTPLPVT 3348

Query: 4070 TPTPTPTGTQTP--TTTPITTTTTVTPTPTPTGTQTPTT-----TPITTTTTVT---PTP 4119
            +P+   TG  TP   T P + +T  T T   TG  + +T      P+T T++V+    TP
Sbjct: 3349 SPSSASTGHTTPLHVTIPSSASTGDTSTLPVTGASSASTGHATPLPVTDTSSVSTGHATP 3408

Query: 4120 TP----TGTQTPTTTPITTT-----TTVTPTPTP----TGTQTPTTTPITTT-----TTV 4161
             P    +   T  TTP+  T     +T   TP P    +   T  TTP+  T     +T 
Sbjct: 3409 LPVTSLSSVSTGDTTPLPVTDASSASTGQATPLPVTSLSSVSTGDTTPLLVTDASSVSTG 3468

Query: 4162 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTHTS--------TAPIAELTTSN 4213
              TP P    +  +T  TT   VT T + +  Q  P   TS        T P+     S+
Sbjct: 3469 HATPLPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLLVTDASS 3528

Query: 4214 PPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPS 4273
                 +TP     TSS  T  TT L     +   T  A P   T P+++S GHT +P P 
Sbjct: 3529 VSTGHATPLPVTDTSSASTGDTTRLPVTDTSSASTGQATPLPVTIPSSSSSGHT-TPLPV 3587

Query: 4274 TTTSPPG----TPTRGTTTGSSSA--PTPSTVQTTTTSAWTPTPTPL--STPSIIRTTGL 4325
            T+TS       TP   T+  S+S    TP  V T+T+SA T   TPL  +  S + T   
Sbjct: 3588 TSTSSVSTGHVTPLHVTSPSSASTGHVTPLPV-TSTSSASTGHATPLLVTDASSVSTGHA 3646

Query: 4326 RPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPT 4385
             P P +        DT   P  +  + + G        SLS          P T + + +
Sbjct: 3647 TPLPVTDASSASTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDASSAS 3706

Query: 4386 PSKSTP----TPSKPSSTPSKPTPGTKP 4409
               +TP     PS  S+  + P P T P
Sbjct: 3707 TGHATPLPVTIPSSVSTGDTMPLPVTSP 3734



 Score =  772 bits (1994), Expect = 0.0
 Identities = 925/3488 (26%), Positives = 1382/3488 (39%), Gaps = 453/3488 (12%)

Query: 1254 NICSITTRPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPK----LCCLWSDWI 1309
            N   +T++  T+TT T  TL  T  T T  T ++TP +S V  T  +        W   I
Sbjct: 129  NTLMMTSKTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSRTTSWRTSI 188

Query: 1310 NEDHPSSGSDDGDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNED 1369
             +D  +S  +   R T          +  R+   P  S       V   VS     K   
Sbjct: 189  -QDTSASSQNHWTRSTQTTRESQTSTLTHRTTSTPSFSPSV--HNVTGTVSQ----KTSP 241

Query: 1370 QFGNGPFGLCYDYKIRVNCCWPMDKCITTPSPPTTTPSPPPTS----TTTLPPTTTP--- 1422
                    LC    +        +K   T S  +T  +P  TS    T +L P T+    
Sbjct: 242  SGETATSSLC---SVTNTSMMTSEKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALV 298

Query: 1423 -------SPPTTTTTTPPPTTTPSP----------------------PITTTT--TPPPT 1451
                   SP T + T+   TT  S                       P+TT+T  + P  
Sbjct: 299  TFDPEGQSPATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSSPSG 358

Query: 1452 TTPSPPISTTTTPPPTTTPSPPTTTPSPPTTT------PSPPTTTTTTPPPTTTPSPPTT 1505
              PS  +S  T P   TT S P++  +    T      P+   +T      T+     T 
Sbjct: 359  FNPSGTVSQETFPSGETTTSSPSSVSNTFLVTSKVFRMPTSRDSTLGNTEETSLSVSGTI 418

Query: 1506 TPITPPAST--------TTLPPTTTPSPPTT-----------TTTTPPPTTTPSPPTTTP 1546
            + IT   ST        T L P++ P   +T           TT  P   ++ SP  +  
Sbjct: 419  SAITSKVSTIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGVSQE 478

Query: 1547 ITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTT-TTPSPPTITTTTPPPTTTPSPP 1605
            I     TTT P + +     T + T  P+T+    T   T +P T T  T P    PS  
Sbjct: 479  IFTLHETTTWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPSTGTAGTIP--RVPSKV 536

Query: 1606 TTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTP 1665
            +       PTT  S  TT P T      T     T +      ++P  + T    T T+P
Sbjct: 537  SAIGEPGEPTTYSSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVTQMIKTATSP 596

Query: 1666 S--PPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSP 1723
            S  P +   T+   TT PS+  +T  S  T+   +P+ +    +    TT  S TT    
Sbjct: 597  SSSPMLDRHTSQQITTAPSTNHSTIHSTSTSPQESPAVSQRGHTQAPQTTQESQTTRSVS 656

Query: 1724 PPT---TMTTPSPTTTPS------------PPTTTMTTLPPT------TTSSPLTTTPLP 1762
            P T   T+TTP  + T S            P  +  TT  P       TT +P T     
Sbjct: 657  PMTDTKTVTTPGSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGDGHTTQAPTTALQAA 716

Query: 1763 PSITPPTFSPFSTTT-------------PTTPCVPLCNWTGWLDSGKPN------FHKPG 1803
            PS    T  P   T+              +TP  P   WT    S  P+           
Sbjct: 717  PSSHDATLGPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQA 776

Query: 1804 GDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPM 1863
              TE  G       A++ S   +     P            S G+    E  +       
Sbjct: 777  ESTEASGQTQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTR------- 829

Query: 1864 AFCLNYEINVQCCECVTQPTT--MTTTTTENPTPPTTTPITTTTTVTPTPT--------- 1912
                 +  N       TQ TT  ++ + +    P +T   ++    T  PT         
Sbjct: 830  -----FSSNPSRDSHTTQSTTELLSASASHGAIPVSTGMASSIVPGTFHPTLSEASTAGR 884

Query: 1913 PTGTQTPT--------TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 1964
            PTG  +PT        T  I+       T T  G+ T +     T T  T  PTP     
Sbjct: 885  PTGQSSPTSPSASPQETAAISRMAQTQRTRTSRGSDTISLASQATDTFSTVPPTPPSI-- 942

Query: 1965 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2024
             T+T +T+  T T T +P+G+    TT + +  T  P    +   T  TTP+  T   + 
Sbjct: 943  -TSTGLTSPQTETHTLSPSGSGKTFTTALISNATPLPVTYASSASTGHTTPLHVTDA-SS 1000

Query: 2025 TPTPTGTQTPTTTPITTTTTVTPTPTP-TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2083
              T   T  P T+P + +T  T TP P T T + +T  +T     + +   TG  TP   
Sbjct: 1001 VSTGHATPLPVTSPSSVSTGHT-TPLPVTDTSSESTGHVTPLPVTSFSSASTGDSTPL-- 1057

Query: 2084 PITTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 2140
            P+T T++ +    TP P  + +  +T  TT   VT T + + T   T+ P+T T++V+  
Sbjct: 1058 PVTDTSSASTGHVTPLPVTSLSSASTGDTTPLPVTDTSSAS-TGHATSLPVTDTSSVS-- 1114

Query: 2141 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTP 2199
               TG  TP   P+T T++ +       T   T+ P+T T++V+     TG  TP   T 
Sbjct: 1115 ---TGHTTPL--PVTDTSSAS-------TGHATSLPVTDTSSVS-----TGHTTPLHVTD 1157

Query: 2200 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPT 2257
             ++ +T   TP P  + +  +T  TT   VT P+   TG  TP   T  ++ +T   TP 
Sbjct: 1158 ASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPL 1217

Query: 2258 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2317
            P    T  ++  T   T  P   P+   T  TTP+  T T + +     +   T T   +
Sbjct: 1218 PV---TDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVS 1274

Query: 2318 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PT 2370
            T   TP P  T T + +T  +T     +P+   TG  TP   P+T+ ++ +       P 
Sbjct: 1275 TGDTTPLPV-TSTSSASTGHVTPLHVTSPSSASTGHATPL--PVTSLSSASTGDTMPLPV 1331

Query: 2371 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTP 2429
             +P+   T  TTP+  T     +   TG  TP   T  ++ +T   TP P  + +  +T 
Sbjct: 1332 TSPSSASTGDTTPLPVTDA---SSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTG 1388

Query: 2430 ITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2487
             TT   VT P+   TG  TP   T  ++ +T   TP P    T  ++  T   T  P   
Sbjct: 1389 DTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPV---TDASSVSTDHATSLPVTI 1445

Query: 2488 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2547
            P+   T  TTP+  T T + +     +   T T   +T   TP P  T T + +T  +T 
Sbjct: 1446 PSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPV-TSTSSASTGHVTP 1504

Query: 2548 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2607
                +P+   TG  TP   P+T+ ++ +   T     T  ++  T  TT  P    +   
Sbjct: 1505 LHVTSPSSASTGHATPL--PVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDASSVS 1562

Query: 2608 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT-------TTVTPTPTPTGTQTPTTTPI 2660
            T  TTP+  T   +P+   TG  TP   P+T T       TT  P  +P+   T  TTP+
Sbjct: 1563 TGHTTPLPVT---SPSSASTGHTTP--LPVTDTSSASKGDTTPLPVTSPSSASTGHTTPL 1617

Query: 2661 TTTTTVT-----PTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTT 2711
              T T +      TP P    +  +T   T   VT P+   TG  TP   T+T   +T  
Sbjct: 1618 PVTDTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASTGHATPLPVTSTSSASTGH 1677

Query: 2712 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTVTPTPTPTGTQTP 2770
             TP P  TG  + TT   T       +   TG  TP   T +++ +T   TP P  + + 
Sbjct: 1678 ATPLPV-TGLSSATTDDTTRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSS 1736

Query: 2771 TTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPTP----TPTGTQTPTTTPIT 2822
             +T   +   VT  +   TG  TP   T T   +T   TP P    +   T   T  P+T
Sbjct: 1737 ASTGHASPLLVTDASSASTGQATPLPVTDTSSVSTAHATPLPVTGLSSASTDDTTRLPVT 1796

Query: 2823 TTTTVT-------PTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTT- 2865
              ++ +       P  +P+   T  TTP+  T         TT  P   P+   +  TT 
Sbjct: 1797 DVSSASTGQAIPLPVTSPSSASTGDTTPLPVTDASSASTGDTTSLPVTIPSSASSGHTTS 1856

Query: 2866 -PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2924
             P+T  ++V+     +   T  ++  T  TT  P        T  TTP+   T  +   T
Sbjct: 1857 LPVTDASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNSASTGDTTPL-HVTDASSVST 1915

Query: 2925 PTGTQTPTT---TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP 2981
               T  P T   +  T  TT  P  +P+   +  TTP+   T  +  PT   T  P T  
Sbjct: 1916 GHATSLPVTSLSSASTGDTTPLPVTSPSSASSGHTTPL-PVTDASSVPTGHATSLPVTDA 1974

Query: 2982 ITTTT-TVTPTP----TPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTT 3033
             + +T   TP P    +   T   T  P+T T++V+    TP P  + +  +T  TT   
Sbjct: 1975 SSVSTGHATPLPVTDASSVSTGHATPLPVTDTSSVSTGQATPLPVTSLSSASTGDTTPLP 2034

Query: 3034 VTPTPT-PTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 3091
            VT T +  TG  TP   T +++ +T   TP P  + +  +T   T   VT   +   T  
Sbjct: 2035 VTDTSSASTGQDTPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDA-SSVSTGH 2093

Query: 3092 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT--- 3148
             T+  +T  ++V+         T  ++  T  TT  P  +P+   T  TTP+  T T   
Sbjct: 2094 ATSLLVTDASSVSTGHATALHVTDASSLSTGDTTPLPVTSPSSASTGDTTPLPVTDTSSV 2153

Query: 3149 ---------VTPTPTPTGTQTPTTTPITTTTTVT---PTPTP-TGTQTPTTTPITTTTTV 3195
                     VT T +   T   T+ P+T T++ +    TP P T T + +T   T     
Sbjct: 2154 STGHATSLPVTDT-SSASTGHATSLPVTDTSSASTGHATPLPVTDTSSASTGQATPLPVT 2212

Query: 3196 TPTPTPTGTQTP---TTTPITTTTTVTPTPTP--TGTQTPTTTPITTT---------TTV 3241
            +P+   TG   P   T T   +T   TP P    +   T  TTP+  T          T 
Sbjct: 2213 SPSSASTGHAIPLLVTDTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSVSTGHATS 2272

Query: 3242 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPT 3300
             P  + +   T  TTP+  T   +P+   TG  TP   T  ++ +T   TP P  + +  
Sbjct: 2273 LPVTSLSSVSTGDTTPLPVT---SPSSASTGHATPLHVTDASSASTGHATPLPVTSLSSA 2329

Query: 3301 TTPITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT- 3357
            +T  TT   VT P+   TG  TP   T  ++ +T   TP P  + +  ++  TT   VT 
Sbjct: 2330 STGDTTPLPVTSPSSASTGHATPLHVTDASSVSTGDTTPLPVTSSSSASSGHTTPLPVTD 2389

Query: 3358 PTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 3414
             +   TG  TP   T T   +T   T  P  TG  + +T   T       +   TG  TP
Sbjct: 2390 ASSASTGDTTPLPVTDTSSASTGHATHLPV-TGLSSASTGDTTRLPVTNVSSASTGHATP 2448

Query: 3415 ---TTTPITTTTTVTPTP--TPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTP 3460
               T+T   +T   TP P    +   T  TTP+  T         TT  P  +P+   T 
Sbjct: 2449 LPVTSTSSASTGDTTPLPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRLPVTSPSSASTG 2508

Query: 3461 TTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT 3515
             TTP+  T T +      TP P    +  +T   T+  VT +P+   T   T+ P+T T+
Sbjct: 2509 HTTPLPVTDTPSASTGDTTPLPVTNASSLSTRHATSLHVT-SPSSASTGHATSLPVTDTS 2567

Query: 3516 TVT---PTPTPTGTQTPTTTPITTTTTVTPT-PTPTGTQTPTTTPITTTTTVTPTPTPTG 3571
              +    TP P  + +  +T  TT   VT T    TG  TP   P+T T++ +     TG
Sbjct: 2568 AASTGHATPLPVTSTSSASTGDTTPLPVTDTYSASTGQATP--LPVTDTSSAS-----TG 2620

Query: 3572 TQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3628
              TP   T T   +T   TP P  T T + +T   T     +P+   TG  TP   P+T 
Sbjct: 2621 DTTPLPVTDTSSASTGHATPLPV-TNTSSVSTGHATPLHVTSPSSASTGHTTP--LPVTD 2677

Query: 3629 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---------TTVT 3679
             ++V+     +   T  ++  T   T  P   P+   +  TTP+  T          T  
Sbjct: 2678 ASSVSTGHATSLPVTDASSVFTGHATSLPVTIPSSASSGHTTPLPVTDASSVSTGHATSL 2737

Query: 3680 PTPTPTGTQTPTTTPITTT-----TTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-PTGT 3733
            P    +   T   TP+  T     +T   TP P  + +  +T  TT   VT T +  TG 
Sbjct: 2738 PVTDASSVSTGHATPLPVTDASSVSTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQ 2797

Query: 3734 QTP-TTTPITTTTTVTPTPTP------TGTQTPTTTPITTTTTVT---PTPTPTGTQTPT 3783
             TP   T +++ +T   TP P        T   T+ P+T T++ +    TP P    +  
Sbjct: 2798 ATPLPVTSLSSVSTGDTTPLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPDTDTSSA 2857

Query: 3784 TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP--TTTPITTTT-TVT 3840
            +T   T   VT T +       T+ P+T T++++     TG  TP   T+P + +T   T
Sbjct: 2858 STGHATLLPVTDT-SSASIGHATSLPVTDTSSIS-----TGHATPLHVTSPSSASTGHAT 2911

Query: 3841 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTP 3897
            P P  T T + +T         +P+   TG  TP   P+T T++ +    TP P  + + 
Sbjct: 2912 PLPV-TDTSSASTGHANPLHVTSPSSASTGHATP--LPVTDTSSASTGHATPLPVTSLSS 2968

Query: 3898 TTTPITTTTTVT-PTPTPTGTQTP-----TTTPITTTTTVTPTPTPTGTQTPTTTPITTT 3951
             +T  TT   VT P+   TG  TP     T++  T   T  P  + +   T  TTP+  T
Sbjct: 2969 VSTGDTTPLPVTSPSSASTGHTTPLPVTDTSSASTGQATALPVTSTSSASTGDTTPLPVT 3028

Query: 3952 TTVT-----PTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP-TTTPITTTTTVTPTP 4004
             T +      TP P  + +  +T  TT   VT P+   TG  TP   T  ++ +T   TP
Sbjct: 3029 DTSSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSASTGQATP 3088

Query: 4005 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4064
             P  + +  +T  TT   VT +P+   T   T+ P+T T++ +   T +   T T++  T
Sbjct: 3089 LPVTSLSSVSTGDTTPLPVT-SPSSASTGHATSLPVTDTSSASTGDTTSLPVTDTSSAYT 3147

Query: 4065 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTVTPTP---- 4119
              TT  P    + + T  TTP+  T T   +   TG  TP   T  ++ +T   TP    
Sbjct: 3148 GDTTSLPVTDTSSSSTGDTTPLLVTET---SSVSTGHATPLLVTDASSASTGHATPLHVT 3204

Query: 4120 TPTGTQTPTTTPITTTTT-------VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 4172
            +P+   T  TTP+  T T        TP P  TG  + +T   T       +   TG  T
Sbjct: 3205 SPSSASTGDTTPVPVTDTSSVSTGHATPLPV-TGLSSASTGDTTRLPVTDISSASTGQAT 3263

Query: 4173 PTTTPITTTTTVT-------PTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSR 4225
            P   P+T T++V+       P  +P+   TG  T     P+   +TS+     +TP    
Sbjct: 3264 P--LPVTNTSSVSTGDTMPLPVTSPSSASTGHAT-----PLPVTSTSSASTGHATPVPVT 3316

Query: 4226 STSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHT----LSPPPSTTTSPPGT 4281
            STSS  T  TT L     +   T    P   T+P++ S GHT    ++ P S +T    T
Sbjct: 3317 STSSASTGHTTPLPVTDTSSASTGDTTPLPVTSPSSASTGHTTPLHVTIPSSASTGDTST 3376

Query: 4282 -PTRGTTTGSSSAPTPSTV-QTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLN 4339
             P  G ++ S+   TP  V  T++ S    TP P+++ S + T    P P +        
Sbjct: 3377 LPVTGASSASTGHATPLPVTDTSSVSTGHATPLPVTSLSSVSTGDTTPLPVTDASSASTG 3436

Query: 4340 DTYYAPGEEVYNGTYGDT-------CYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPT 4392
                 P   + + + GDT          V+   +  L   + S  ST   T  P   T +
Sbjct: 3437 QATPLPVTSLSSVSTGDTTPLLVTDASSVSTGHATPLPVTDTSSASTGDTTRLPVTDTSS 3496

Query: 4393 PSKPSSTP 4400
             S   +TP
Sbjct: 3497 ASTGQATP 3504



 Score =  727 bits (1877), Expect = 0.0
 Identities = 923/3466 (26%), Positives = 1362/3466 (39%), Gaps = 567/3466 (16%)

Query: 1434 PTTTPSPPITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTT 1493
            P TT    IT + T  P T+     +T T    +T  S  T+      ++ +  T +T T
Sbjct: 27   PGTTEDTLITGSKTAAPVTSTGS--TTATLEGQSTAASSRTSNQDISASSQNHQTKSTET 84

Query: 1494 PPPTTTPSPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTST 1553
                 T +       T  +S +      T  P   TT+ P   T     T+  IT  TST
Sbjct: 85   TSKAQTDTLTQMMTSTLFSSPSVHNVMETAPPDEMTTSFPSSVTNTLMMTSKTITMTTST 144

Query: 1554 -TTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTP 1612
             +TL  T   S   T ++TP  +           S  T   T+   T+  S    T +T 
Sbjct: 145  DSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSRTTSWRTSIQDTSASSQNHWTRSTQ 204

Query: 1613 PPTTTPSPPTTTPITPPTSTTTLPPT-----------TTPSPPPTTTTTPPPTTTPSPPT 1661
               TT    T+T     TST +  P+           T+PS    T++    T T    +
Sbjct: 205  ---TTRESQTSTLTHRTTSTPSFSPSVHNVTGTVSQKTSPSGETATSSLCSVTNTSMMTS 261

Query: 1662 TTTPSPPITTTTTPPPTTTPSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTP 1721
                    T +T   P  T S P+T +  P T+       T  P      T + +ST   
Sbjct: 262  EKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALV---TFDPEGQSPATFSRTSTQDT 318

Query: 1722 SPPPTTMTTPSPTTTPSPPTTTMTTLPPTTTSSPLTT-TPLPPS--ITPPTFSPFSTTTP 1778
            +       T S  TT      T+ TL P TTS+ L++ +   PS  ++  TF    TTT 
Sbjct: 319  TAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSSPSGFNPSGTVSQETFPSGETTTS 378

Query: 1779 TTPCV-------------PLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCR- 1824
            +   V             P    +   ++ + +    G  + +   V    W+  +S   
Sbjct: 379  SPSSVSNTFLVTSKVFRMPTSRDSTLGNTEETSLSVSGTISAITSKVSTIWWSDTLSTAL 438

Query: 1825 --ATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQP 1882
              +++ P +      Q      + G   +     P GV    F L+        E  T P
Sbjct: 439  SPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSP-GVSQEIFTLH--------ETTTWP 489

Query: 1883 TTMTT---TTTENPTPPTTTPITTTTTVTPTPTPTGT---------------QTPTTTPI 1924
            ++ ++   TT      P+T+    T  VT  P+ TGT               +    T  
Sbjct: 490  SSFSSKGHTTWSQTELPSTSTGAATRLVTGNPS-TGTAGTIPRVPSKVSAIGEPGEPTTY 548

Query: 1925 TTTTTVTPTPTPTGTQTPTTTPITTT-----------------TTVTPTPTPT----GTQ 1963
            ++ +T  P  T  G QT  T    TT                 T  +P+ +P      +Q
Sbjct: 549  SSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVTQMIKTATSPSSSPMLDRHTSQ 608

Query: 1964 TPTTTPITTTTTVTPTPTPT----------GTQTPTTT----------PITTTTTVTPTP 2003
              TT P T  +T+  T T             TQ P TT          P+T T TVT TP
Sbjct: 609  QITTAPSTNHSTIHSTSTSPQESPAVSQRGHTQAPQTTQESQTTRSVSPMTDTKTVT-TP 667

Query: 2004 ----TPTGTQTPTTTP-----ITTTTTVTPTPTPTG--TQTPTTTPITTTTTVTPTPTPT 2052
                T +G       P     I+  TT  P PT  G  TQ PTT      ++   T  P+
Sbjct: 668  GSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGDGHTTQAPTTALQAAPSSHDATLGPS 727

Query: 2053 -GTQTPTTTPITTTTTVTPTP-------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT 2104
             GT    T  +T   +V  TP       T     T   T    T T     T    QT T
Sbjct: 728  GGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQAESTEASGQTQT 787

Query: 2105 TTPIT----TTTTVTPTP--------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2152
            + P +    TT+  T TP        TP+G++  +T+  TT  +  P+     TQ+ TT 
Sbjct: 788  SEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPSRDSHTTQS-TTE 846

Query: 2153 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT---PTGTQTPT--------TTPIT 2201
             ++ + +    P  TG    +  P T   T++   T   PTG  +PT        T  I+
Sbjct: 847  LLSASASHGAIPVSTG-MASSIVPGTFHPTLSEASTAGRPTGQSSPTSPSASPQETAAIS 905

Query: 2202 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2261
                   T T  G+ T +     T T  T  PTP      T+T +T+  T T T +P+G+
Sbjct: 906  RMAQTQRTRTSRGSDTISLASQATDTFSTVPPTPPSI---TSTGLTSPQTETHTLSPSGS 962

Query: 2262 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTT 2312
                TT + +  T  P    +   T  TTP+  T          T  P  +P+   T  T
Sbjct: 963  GKTFTTALISNATPLPVTYASSASTGHTTPLHVTDASSVSTGHATPLPVTSPSSVSTGHT 1022

Query: 2313 TPITTTTT-------VTPTP------TPTGTQTPTTTPITTTTTVTP---TPTPTGTQTP 2356
            TP+  T T       VTP P        TG  TP   P+T T++ +    TP P  + + 
Sbjct: 1023 TPLPVTDTSSESTGHVTPLPVTSFSSASTGDSTP--LPVTDTSSASTGHVTPLPVTSLSS 1080

Query: 2357 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTV 2413
             +T  TT   VT T +   T   T+ P+T T++V+    TP P    +  +T   T+  V
Sbjct: 1081 ASTGDTTPLPVTDT-SSASTGHATSLPVTDTSSVSTGHTTPLPVTDTSSASTGHATSLPV 1139

Query: 2414 TPTPT-PTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQT 2470
            T T +  TG  TP   T  ++ +T   TP P  + +  +T  TT   VT P+   TG  T
Sbjct: 1140 TDTSSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHAT 1199

Query: 2471 P---TTTPITTTTTVTPTP--------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2519
            P   T T   +T   TP P        T   T  P T P   +T  T TP P    +  +
Sbjct: 1200 PLLVTDTSSASTGHATPLPVTDASSVSTDHATSLPVTIPSAASTGHT-TPLPVTDTSSAS 1258

Query: 2520 TPITTTTTVTPTPT-PTGTQTP---TTTPITTTTTVTP----TPTPTGTQTPTTTPITTT 2571
            T   T+  VT T +  TG  TP   T+T   +T  VTP    +P+   T   T  P+T+ 
Sbjct: 1259 TGQATSLLVTDTSSVSTGDTTPLPVTSTSSASTGHVTPLHVTSPSSASTGHATPLPVTSL 1318

Query: 2572 TTVT-------PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPT 2623
            ++ +       P  +P+   T  TTP+  T     +   TG  TP   T  ++ +T   T
Sbjct: 1319 SSASTGDTMPLPVTSPSSASTGDTTPLPVTDA---SSVSTGHTTPLHVTDASSASTGQAT 1375

Query: 2624 PTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPTP--------T 2671
            P P  + +  +T  TT   VT P+   TG  TP   T T   +T   TP P        T
Sbjct: 1376 PLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPVTDASSVST 1435

Query: 2672 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTP---TTT 2727
               T  P T P   +T  T TP P    +  +T   T+  VT T +  TG  TP   T+T
Sbjct: 1436 DHATSLPVTIPSAASTGHT-TPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPVTST 1494

Query: 2728 PITTTTTVTP----TPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPIT 2776
               +T  VTP    +P+   T   T  P+T+ ++ +       P  +P+   T  TTP+ 
Sbjct: 1495 SSASTGHVTPLHVTSPSSASTGHATPLPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLP 1554

Query: 2777 TT---------TTVTPTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTT 2818
             T         TT  P  +P+   T  TTP+  T         TT  P  +P+   T  T
Sbjct: 1555 VTDASSVSTGHTTPLPVTSPSSASTGHTTPLPVTDTSSASKGDTTPLPVTSPSSASTGHT 1614

Query: 2819 TPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITT 2869
            TP+  T T +      TP P    +  +T   T   VT P+   TG  TP   T+T   +
Sbjct: 1615 TPLPVTDTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASTGHATPLPVTSTSSAS 1674

Query: 2870 TTTVTPTPTPTGTQTPTT--------TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT- 2920
            T   TP P  TG  + TT        T +++ +T   TP P  + +  +T  TT   VT 
Sbjct: 1675 TGHATPLPV-TGLSSATTDDTTRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPLPVTS 1733

Query: 2921 PTPTPTGTQTP--------------TTTPITTTTTVT---PTPTPTGTQTPTTTPITTTT 2963
            P+   TG  +P              T  P+T T++V+    TP P    +  +T  TT  
Sbjct: 1734 PSSASTGHASPLLVTDASSASTGQATPLPVTDTSSVSTAHATPLPVTGLSSASTDDTTRL 1793

Query: 2964 TVT-------------PTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPT 3001
             VT             P  +P+   T  TTP+  T         TT  P   P+   +  
Sbjct: 1794 PVTDVSSASTGQAIPLPVTSPSSASTGDTTPLPVTDASSASTGDTTSLPVTIPSSASSGH 1853

Query: 3002 TT--PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT----- 3054
            TT  P+T  ++V+     +   T  ++  T  TT  P        T  TTP+  T     
Sbjct: 1854 TTSLPVTDASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNSASTGDTTPLHVTDASSV 1913

Query: 3055 ----TTVTPTPTPTGTQTPTTTPITTTTT-------VTPTPTPTGTQTP----TTTPITT 3099
                 T  P  + +   T  TTP+  T+         TP P    +  P    T+ P+T 
Sbjct: 1914 STGHATSLPVTSLSSASTGDTTPLPVTSPSSASSGHTTPLPVTDASSVPTGHATSLPVTD 1973

Query: 3100 TTTVT---PTPTP--------TGTQTPTTTPITTTTTVT---PTPTP----TGTQTPTTT 3141
             ++V+    TP P        TG  TP   P+T T++V+    TP P    +   T  TT
Sbjct: 1974 ASSVSTGHATPLPVTDASSVSTGHATP--LPVTDTSSVSTGQATPLPVTSLSSASTGDTT 2031

Query: 3142 PITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP----------- 3184
            P+  T T +      TP P  + +  +T  TT   VT P+   TG  TP           
Sbjct: 2032 PLPVTDTSSASTGQDTPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSVST 2091

Query: 3185 ---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT- 3240
               T+  +T  ++V+         T  ++  T  TT  P  +P+   T  TTP+  T T 
Sbjct: 2092 GHATSLLVTDASSVSTGHATALHVTDASSLSTGDTTPLPVTSPSSASTGDTTPLPVTDTS 2151

Query: 3241 -----------VTPTPTPTGTQTPTTTPITTTTTVT---PTPTP-TGTQTPTTTPITTTT 3285
                       VT T +   T   T+ P+T T++ +    TP P T T + +T   T   
Sbjct: 2152 SVSTGHATSLPVTDT-SSASTGHATSLPVTDTSSASTGHATPLPVTDTSSASTGQATPLP 2210

Query: 3286 TVTPTPTPTGTQTP---TTTPITTTTTVTPTPTP--TGTQTPTTTPITTT---------T 3331
              +P+   TG   P   T T   +T   TP P    +   T  TTP+  T          
Sbjct: 2211 VTSPSSASTGHAIPLLVTDTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSVSTGHA 2270

Query: 3332 TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQT 3390
            T  P  + +   T  TTP+  T   +P+   TG  TP   T  ++ +T   TP P  + +
Sbjct: 2271 TSLPVTSLSSVSTGDTTPLPVT---SPSSASTGHATPLHVTDASSASTGHATPLPVTSLS 2327

Query: 3391 PTTTPITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3448
              +T  TT   VT P+   TG  TP   T  ++ +T   TP P  + +  ++  TT   V
Sbjct: 2328 SASTGDTTPLPVTSPSSASTGHATPLHVTDASSVSTGDTTPLPVTSSSSASSGHTTPLPV 2387

Query: 3449 T-PTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 3504
            T  +   TG  TP   T T   +T   T  P  TG  + +T   T       +   TG  
Sbjct: 2388 TDASSASTGDTTPLPVTDTSSASTGHATHLPV-TGLSSASTGDTTRLPVTNVSSASTGHA 2446

Query: 3505 TP---TTTPITTTTTVTPTP--TPTGTQTPTTTPITTT---------TTVTPTPTPTGTQ 3550
            TP   T+T   +T   TP P    +   T  TTP+  T         TT  P  +P+   
Sbjct: 2447 TPLPVTSTSSASTGDTTPLPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRLPVTSPSSAS 2506

Query: 3551 TPTTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 3605
            T  TTP+  T T +      TP P    +  +T   T+  VT +P+   T   T+ P+T 
Sbjct: 2507 TGHTTPLPVTDTPSASTGDTTPLPVTNASSLSTRHATSLHVT-SPSSASTGHATSLPVTD 2565

Query: 3606 TTTVT---PTPTPTGTQTPTTTPITTTTTVTPT-PTPTGTQTP---TTTPITTTTTVTPT 3658
            T+  +    TP P  + +  +T  TT   VT T    TG  TP   T T   +T   TP 
Sbjct: 2566 TSAASTGHATPLPVTSTSSASTGDTTPLPVTDTYSASTGQATPLPVTDTSSASTGDTTPL 2625

Query: 3659 P----TPTGTQTPTTTPITTTTTV-----TP----TPTPTGTQTPTTTPITTTTTVTPTP 3705
            P    +   T   T  P+T T++V     TP    +P+   T   T  P+T  ++V+   
Sbjct: 2626 PVTDTSSASTGHATPLPVTNTSSVSTGHATPLHVTSPSSASTGHTTPLPVTDASSVSTGH 2685

Query: 3706 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGT 3756
              +   T  ++  T   T  P   P+   +  TTP+  T          T  P    +  
Sbjct: 2686 ATSLPVTDASSVFTGHATSLPVTIPSSASSGHTTPLPVTDASSVSTGHATSLPVTDASSV 2745

Query: 3757 QTPTTTPITTT-----TTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTP-TTTP 3809
             T   TP+  T     +T   TP P  + +  +T  TT   VT T +  TG  TP   T 
Sbjct: 2746 STGHATPLPVTDASSVSTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATPLPVTS 2805

Query: 3810 ITTTTTVTPTPTP------TGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTT 3860
            +++ +T   TP P        T   T+ P+T T++ +    TP P    +  +T   T  
Sbjct: 2806 LSSVSTGDTTPLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPDTDTSSASTGHATLL 2865

Query: 3861 TVTPTPTPTGTQTPTTTPITTTTTV-----TP----TPTPTGTQTPTTTPITTTTTVT-- 3909
             VT T +       T+ P+T T+++     TP    +P+   T   T  P+T T++ +  
Sbjct: 2866 PVTDT-SSASIGHATSLPVTDTSSISTGHATPLHVTSPSSASTGHATPLPVTDTSSASTG 2924

Query: 3910 -------PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVT-PTP 3958
                    +P+   T   T  P+T T++ +    TP P  + +  +T  TT   VT P+ 
Sbjct: 2925 HANPLHVTSPSSASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGDTTPLPVTSPSS 2984

Query: 3959 TPTGTQTP-----TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-----PTPTPTG 4008
              TG  TP     T++  T   T  P  + +   T  TTP+  T T +      TP P  
Sbjct: 2985 ASTGHTTPLPVTDTSSASTGQATALPVTSTSSASTGDTTPLPVTDTSSASTGQATPLPVT 3044

Query: 4009 TQTPTTTPITTTTTVT-PTPTPTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTT 4066
            + +  +T  TT   VT P+   TG  TP   T  ++ +T   TP P  + +  +T  TT 
Sbjct: 3045 SLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVSTGDTTP 3104

Query: 4067 TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 4126
              VT +P+   T   T+ P+T T++ +   T +   T T++  T  TT  P    + + T
Sbjct: 3105 LPVT-SPSSASTGHATSLPVTDTSSASTGDTTSLPVTDTSSAYTGDTTSLPVTDTSSSST 3163

Query: 4127 PTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTVTPTP----TPTGTQTPTTTPITTT 4181
              TTP+  T T   +   TG  TP   T  ++ +T   TP    +P+   T  TTP+  T
Sbjct: 3164 GDTTPLLVTET---SSVSTGHATPLLVTDASSASTGHATPLHVTSPSSASTGDTTPVPVT 3220

Query: 4182 TT-------VTPTPTPTGTQTGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTES 4234
             T        TP P  TG  +     T+  P+ ++++++     +TP    +TSS  T  
Sbjct: 3221 DTSSVSTGHATPLPV-TGLSSASTGDTTRLPVTDISSAS--TGQATPLPVTNTSSVSTGD 3277

Query: 4235 TTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAP 4294
            T  L    P+   T  A P   T+ ++ S GH  +P P T+TS   T   G TT     P
Sbjct: 3278 TMPLPVTSPSSASTGHATPLPVTSTSSASTGHA-TPVPVTSTSSAST---GHTT-----P 3328

Query: 4295 TPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTY 4354
             P T  T++ S    TP P+++PS   T    P   ++       DT   P     + + 
Sbjct: 3329 LPVT-DTSSASTGDTTPLPVTSPSSASTGHTTPLHVTIPSSASTGDTSTLPVTGASSAST 3387

Query: 4355 GDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTP 4400
            G          +  L   + S  ST   TP P  S  + S   +TP
Sbjct: 3388 GH---------ATPLPVTDTSSVSTGHATPLPVTSLSSVSTGDTTP 3424



 Score =  720 bits (1858), Expect = 0.0
 Identities = 892/3359 (26%), Positives = 1310/3359 (38%), Gaps = 489/3359 (14%)

Query: 1487 PTTTTTTPPPTTTPSPPTTTPITPPASTT-TLPPTTTPSPPTTTTTTPPPTTTPSPPTTT 1545
            P     T   T      T  P+T   STT TL   +T +   T+      ++      +T
Sbjct: 23   PHVVPGTTEDTLITGSKTAAPVTSTGSTTATLEGQSTAASSRTSNQDISASSQNHQTKST 82

Query: 1546 PITPPTSTTTLPPTTT------PSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPT 1599
              T    T TL    T      PS      T PP   T S P++ T +    + T    T
Sbjct: 83   ETTSKAQTDTLTQMMTSTLFSSPSVHNVMETAPPDEMTTSFPSSVTNTLMMTSKTITMTT 142

Query: 1600 TTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTT--PSPPPTTTTTPPPTTTP 1657
            +T S    T  T    T  S P T+ ++          TT+   S   T+ ++    T  
Sbjct: 143  STDSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSRTTSWRTSIQDTSASSQNHWTRS 202

Query: 1658 SPPTTTTPSPPITTTTTPPPTTTPS-SPIT------TTPSPPTTTMTTPSPTTT---PSS 1707
            +  T  + +  +T  TT  P+ +PS   +T      T+PS  T T +  S T T    S 
Sbjct: 203  TQTTRESQTSTLTHRTTSTPSFSPSVHNVTGTVSQKTSPSGETATSSLCSVTNTSMMTSE 262

Query: 1708 PITTTTTPSST-----TTPSPPPTTMTTPSPTTT--------PSPPTTTMTTLPPTTTSS 1754
             IT TT+  ST      T S P T    P  +           SP T + T+   TT  S
Sbjct: 263  KITVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALVTFDPEGQSPATFSRTSTQDTTAFS 322

Query: 1755 PLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFHK-PGGDTELIGDVC 1813
                T    +      +  +T TP T    L + +G+  SG  +    P G+T       
Sbjct: 323  KNHQTQSVETTRVSQINTLNTLTPVTTSTVLSSPSGFNPSGTVSQETFPSGET----TTS 378

Query: 1814 GPGWAAN---ISCRATMYPDVPIGQLGQTVVCDVSV-GLICKNEDQ-------------- 1855
             P   +N   ++ +    P      LG T    +SV G I     +              
Sbjct: 379  SPSSVSNTFLVTSKVFRMPTSRDSTLGNTEETSLSVSGTISAITSKVSTIWWSDTLSTAL 438

Query: 1856 KPGGVIPMAFCLNYEINVQCCECVTQPTTMTT----------TTTENPTPPTTTPITTTT 1905
             P  + P      +    +  E   +P   ++          T  E  T P++      T
Sbjct: 439  SPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGVSQEIFTLHETTTWPSSFSSKGHT 498

Query: 1906 TVTPTPTP---TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT-----TVTPTP 1957
            T + T  P   TG  T   T   +T T    P      +    P   TT     T  P  
Sbjct: 499  TWSQTELPSTSTGAATRLVTGNPSTGTAGTIPRVPSKVSAIGEPGEPTTYSSHSTTLPKT 558

Query: 1958 TPTGTQTPTTTPITTT-----------------TTVTPTPTPT----GTQTPTTTPITTT 1996
            T  G QT  T    TT                 T  +P+ +P      +Q  TT P T  
Sbjct: 559  TGAGAQTQWTQETGTTGEALLSSPSYSVTQMIKTATSPSSSPMLDRHTSQQITTAPSTNH 618

Query: 1997 TTVTPTPTPT----------GTQTPTTT----------PITTTTTVTPTP----TPTGTQ 2032
            +T+  T T             TQ P TT          P+T T TVT TP    T +G  
Sbjct: 619  STIHSTSTSPQESPAVSQRGHTQAPQTTQESQTTRSVSPMTDTKTVT-TPGSSFTASGHS 677

Query: 2033 TPTTTP-----ITTTTTVTPTPTPTG--TQTPTTTPITTTTTVTPTPTPT-GTQTPTTTP 2084
                 P     I+  TT  P PT  G  TQ PTT      ++   T  P+ GT    T  
Sbjct: 678  PSEIVPQDAPTISAATTFAPAPTGDGHTTQAPTTALQAAPSSHDATLGPSGGTSLSKTGA 737

Query: 2085 ITTTTTVTPTP-------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT----T 2133
            +T   +V  TP       T     T   T    T T     T    QT T+ P +    T
Sbjct: 738  LTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQAESTEASGQTQTSEPASSGSRT 797

Query: 2134 TTTVTPTP--------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 2185
            T+  T TP        TP+G++  +T+  TT  +  P+     TQ+ TT  ++ + +   
Sbjct: 798  TSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPSRDSHTTQS-TTELLSASASHGA 856

Query: 2186 TPTPTGTQTPTTTPITTTTTVTPTPT---PTGTQTPT--------TTPITTTTTVTPTPT 2234
             P  TG    +  P T   T++   T   PTG  +PT        T  I+       T T
Sbjct: 857  IPVSTG-MASSIVPGTFHPTLSEASTAGRPTGQSSPTSPSASPQETAAISRMAQTQRTRT 915

Query: 2235 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2294
              G+ T +     T T  T  PTP      T+T +T+  T T T +P+G+    TT + +
Sbjct: 916  SRGSDTISLASQATDTFSTVPPTPPSI---TSTGLTSPQTETHTLSPSGSGKTFTTALIS 972

Query: 2295 TTTVTPTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTTPITTTTT-- 2343
              T  P    +   T  TTP+  T          T  P  +P+   T  TTP+  T T  
Sbjct: 973  NATPLPVTYASSASTGHTTPLHVTDASSVSTGHATPLPVTSPSSVSTGHTTPLPVTDTSS 1032

Query: 2344 -----VTPTP------TPTGTQTPTTTPITTTTTVTP---TPTPTGTQTPTTTPITTTTT 2389
                 VTP P        TG  TP   P+T T++ +    TP P  + +  +T  TT   
Sbjct: 1033 ESTGHVTPLPVTSFSSASTGDSTP--LPVTDTSSASTGHVTPLPVTSLSSASTGDTTPLP 1090

Query: 2390 VTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGT 2445
            VT T +   T   T+ P+T T++V+    TP P    +  +T   T+  VT T +  TG 
Sbjct: 1091 VTDT-SSASTGHATSLPVTDTSSVSTGHTTPLPVTDTSSASTGHATSLPVTDTSSVSTGH 1149

Query: 2446 QTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPIT 2500
             TP   T  ++ +T   TP P  + +  +T  TT   VT P+   TG  TP   T T   
Sbjct: 1150 TTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSA 1209

Query: 2501 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2560
            +T   TP P      T  ++  T   T  P   P+   T  TTP+  T T + +     +
Sbjct: 1210 STGHATPLPV-----TDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATS 1264

Query: 2561 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2620
               T T   +T   TP P  T T + +T  +T     +P+   TG  TP   P+T+ ++ 
Sbjct: 1265 LLVTDTSSVSTGDTTPLPV-TSTSSASTGHVTPLHVTSPSSASTGHATP--LPVTSLSSA 1321

Query: 2621 T-------PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTP 2672
            +       P  +P+   T  TTP+  T     +   TG  TP   T  ++ +T   TP P
Sbjct: 1322 STGDTMPLPVTSPSSASTGDTTPLPVTDA---SSVSTGHTTPLHVTDASSASTGQATPLP 1378

Query: 2673 TGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTP 2728
              + +  +T  TT   VT P+   TG  TP   T T   +T   TP P      T  ++ 
Sbjct: 1379 VTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPLPV-----TDASSV 1433

Query: 2729 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT 2788
             T   T  P   P+   T  TTP+  T T + +     +   T T   +T   TP P  T
Sbjct: 1434 STDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSSVSTGDTTPLPV-T 1492

Query: 2789 GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTT 2841
             T + +T  +T     +P+   TG  TP   P+T+ ++ +       P  +P+   T  T
Sbjct: 1493 STSSASTGHVTPLHVTSPSSASTGHATP--LPVTSLSSASTGDTMPLPVTSPSSASTGDT 1550

Query: 2842 TPITTT---------TTVTPTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQ 2883
            TP+  T         TT  P  +P+   T  TTP+  T         TT  P  +P+   
Sbjct: 1551 TPLPVTDASSVSTGHTTPLPVTSPSSASTGHTTPLPVTDTSSASKGDTTPLPVTSPSSAS 1610

Query: 2884 TPTTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTT 2934
            T  TTP+  T T +      TP P    +  +T   T   VT P+   TG  TP   T+T
Sbjct: 1611 TGHTTPLPVTDTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSASTGHATPLPVTST 1670

Query: 2935 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTTPITTTTTVTPTPT 2993
               +T   TP P  TG  + TT   T       +   TG  TP   T +++ +T   TP 
Sbjct: 1671 SSASTGHATPLPV-TGLSSATTDDTTRLPVTDVSSASTGQATPLPVTSLSSVSTGDTTPL 1729

Query: 2994 PTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPTP----TPTGTQT 3045
            P  + +  +T   +   VT  +   TG  TP   T T   +T   TP P    +   T  
Sbjct: 1730 PVTSPSSASTGHASPLLVTDASSASTGQATPLPVTDTSSVSTAHATPLPVTGLSSASTDD 1789

Query: 3046 PTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGT 3089
             T  P+T  ++ +       P  +P+   T  TTP+  T         TT  P   P+  
Sbjct: 1790 TTRLPVTDVSSASTGQAIPLPVTSPSSASTGDTTPLPVTDASSASTGDTTSLPVTIPSSA 1849

Query: 3090 QTPTTT--PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT- 3146
             +  TT  P+T  ++V+     +   T  ++  T  TT  P        T  TTP+  T 
Sbjct: 1850 SSGHTTSLPVTDASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNSASTGDTTPLHVTD 1909

Query: 3147 --------TTVTPTPTPTGTQTPTTTPITTTTT-------VTPTPTPTGTQTP----TTT 3187
                     T  P  + +   T  TTP+  T+         TP P    +  P    T+ 
Sbjct: 1910 ASSVSTGHATSLPVTSLSSASTGDTTPLPVTSPSSASSGHTTPLPVTDASSVPTGHATSL 1969

Query: 3188 PITTTTTVT---PTPTP--------TGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTT 3233
            P+T  ++V+    TP P        TG  TP   P+T T++V+    TP P  + +  +T
Sbjct: 1970 PVTDASSVSTGHATPLPVTDASSVSTGHATP--LPVTDTSSVSTGQATPLPVTSLSSAST 2027

Query: 3234 PITTTTTVTPTPT-PTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3291
              TT   VT T +  TG  TP   T +++ +T   TP P  + +  +T   T   VT   
Sbjct: 2028 GDTTPLPVTDTSSASTGQDTPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDA- 2086

Query: 3292 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3351
            +   T   T+  +T  ++V+         T  ++  T  TT  P  +P+   T  TTP+ 
Sbjct: 2087 SSVSTGHATSLLVTDASSVSTGHATALHVTDASSLSTGDTTPLPVTSPSSASTGDTTPLP 2146

Query: 3352 TTTT------------VTPTPTPTGTQTPTTTPITTTTTVT---PTPTP-TGTQTPTTTP 3395
             T T            VT T +   T   T+ P+T T++ +    TP P T T + +T  
Sbjct: 2147 VTDTSSVSTGHATSLPVTDT-SSASTGHATSLPVTDTSSASTGHATPLPVTDTSSASTGQ 2205

Query: 3396 ITTTTTVTPTPTPTGTQTP---TTTPITTTTTVTPTPTP--TGTQTPTTTPITTT----- 3445
             T     +P+   TG   P   T T   +T   TP P    +   T  TTP+  T     
Sbjct: 2206 ATPLPVTSPSSASTGHAIPLLVTDTSSASTGQATPLPVTSLSSASTGDTTPLPVTDASSV 2265

Query: 3446 ----TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTPITTTTTVTPTPTP 3500
                 T  P  + +   T  TTP+  T   +P+   TG  TP   T  ++ +T   TP P
Sbjct: 2266 STGHATSLPVTSLSSVSTGDTTPLPVT---SPSSASTGHATPLHVTDASSASTGHATPLP 2322

Query: 3501 TGTQTPTTTPITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPIT 3558
              + +  +T  TT   VT P+   TG  TP   T  ++ +T   TP P  + +  ++  T
Sbjct: 2323 VTSLSSASTGDTTPLPVTSPSSASTGHATPLHVTDASSVSTGDTTPLPVTSSSSASSGHT 2382

Query: 3559 TTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3614
            T   VT  +   TG  TP   T T   +T   T  P  TG  + +T   T       +  
Sbjct: 2383 TPLPVTDASSASTGDTTPLPVTDTSSASTGHATHLPV-TGLSSASTGDTTRLPVTNVSSA 2441

Query: 3615 PTGTQTP---TTTPITTTTTVTPTP--TPTGTQTPTTTPITTT---------TTVTPTPT 3660
             TG  TP   T+T   +T   TP P    +   T  TTP+  T         TT  P  +
Sbjct: 2442 STGHATPLPVTSTSSASTGDTTPLPGTDTSSVSTGHTTPLLVTDASSVSTGDTTRLPVTS 2501

Query: 3661 PTGTQTPTTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3715
            P+   T  TTP+  T T +      TP P    +  +T   T+  VT +P+   T   T+
Sbjct: 2502 PSSASTGHTTPLPVTDTPSASTGDTTPLPVTNASSLSTRHATSLHVT-SPSSASTGHATS 2560

Query: 3716 TPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPT-PTPTGTQTP---TTTPITTTT 3768
             P+T T+  +    TP P  + +  +T  TT   VT T    TG  TP   T T   +T 
Sbjct: 2561 LPVTDTSAASTGHATPLPVTSTSSASTGDTTPLPVTDTYSASTGQATPLPVTDTSSASTG 2620

Query: 3769 TVTPTP----TPTGTQTPTTTPITTTTTV-----TP----TPTPTGTQTPTTTPITTTTT 3815
              TP P    +   T   T  P+T T++V     TP    +P+   T   T  P+T  ++
Sbjct: 2621 DTTPLPVTDTSSASTGHATPLPVTNTSSVSTGHATPLHVTSPSSASTGHTTPLPVTDASS 2680

Query: 3816 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---------TTVTPTP 3866
            V+     +   T  ++  T   T  P   P+   +  TTP+  T          T  P  
Sbjct: 2681 VSTGHATSLPVTDASSVFTGHATSLPVTIPSSASSGHTTPLPVTDASSVSTGHATSLPVT 2740

Query: 3867 TPTGTQTPTTTPITTT-----TTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTP 3920
              +   T   TP+  T     +T   TP P  + +  +T  TT   VT T +  TG  TP
Sbjct: 2741 DASSVSTGHATPLPVTDASSVSTGHATPLPLTSLSSVSTGDTTPLPVTDTSSASTGQATP 2800

Query: 3921 -TTTPITTTTTVTPTPTP------TGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTP 3970
               T +++ +T   TP P        T   T+ P+T T++ +    TP P    +  +T 
Sbjct: 2801 LPVTSLSSVSTGDTTPLPVTDTSSASTGHATSLPVTDTSSASTGHATPLPDTDTSSASTG 2860

Query: 3971 ITTTTTVTPTPTPTGTQTPTTTPITTTTTV-----TP----TPTPTGTQTPTTTPITTTT 4021
              T   VT T +       T+ P+T T+++     TP    +P+   T   T  P+T T+
Sbjct: 2861 HATLLPVTDT-SSASIGHATSLPVTDTSSISTGHATPLHVTSPSSASTGHATPLPVTDTS 2919

Query: 4022 TVT---------PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTV 4069
            + +          +P+   T   T  P+T T++ +    TP P  + +  +T  TT   V
Sbjct: 2920 SASTGHANPLHVTSPSSASTGHATPLPVTDTSSASTGHATPLPVTSLSSVSTGDTTPLPV 2979

Query: 4070 T-PTPTPTGTQTP-----TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-----PT 4118
            T P+   TG  TP     T++  T   T  P  + +   T  TTP+  T T +      T
Sbjct: 2980 TSPSSASTGHTTPLPVTDTSSASTGQATALPVTSTSSASTGDTTPLPVTDTSSASTGQAT 3039

Query: 4119 PTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTTT 4176
            P P  + +  +T  TT   VT P+   TG  TP   T  ++ +T   TP P  + +  +T
Sbjct: 3040 PLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDASSASTGQATPLPVTSLSSVST 3099

Query: 4177 PITTTTTVT-PTPTPTGTQTG-PPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTE- 4233
              TT   VT P+   TG  T  P T TS+A   + TTS P  ++S+  T  +TS P+T+ 
Sbjct: 3100 GDTTPLPVTSPSSASTGHATSLPVTDTSSASTGD-TTSLPVTDTSSAYTGDTTSLPVTDT 3158

Query: 4234 -STTLLSTLPPAIEMTSTAPP--STPTAPTTTSGGHTLSPPPSTTTSPPGTPTRGTTTGS 4290
             S++   T P  +  TS+     +TP   T  S   T    P   TSP    T  TT   
Sbjct: 3159 SSSSTGDTTPLLVTETSSVSTGHATPLLVTDASSASTGHATPLHVTSPSSASTGDTT--- 3215

Query: 4291 SSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVY 4350
               P P T  T++ S    TP P++  S   T      P + +           P     
Sbjct: 3216 ---PVPVT-DTSSVSTGHATPLPVTGLSSASTGDTTRLPVTDISSASTGQATPLPVTNTS 3271

Query: 4351 NGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKP 4409
            + + GDT      S S     +    P T + + +   +TP P   +ST S  T  T P
Sbjct: 3272 SVSTGDTMPLPVTSPSSASTGHATPLPVTSTSSASTGHATPVP--VTSTSSASTGHTTP 3328



 Score =  654 bits (1686), Expect = 0.0
 Identities = 766/2905 (26%), Positives = 1152/2905 (39%), Gaps = 432/2905 (14%)

Query: 1871 INVQC-CECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT 1929
            +++ C C C+  P  +  TT +     + T    T+T + T T  G  T  ++  T+   
Sbjct: 12   VSLSCLCLCLL-PHVVPGTTEDTLITGSKTAAPVTSTGSTTATLEGQSTAASSR-TSNQD 69

Query: 1930 VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-------TTTPITTTTTVTPTPTP 1982
            ++ +     T++  TT    T T+T   T T   +P       T  P   TT+   + T 
Sbjct: 70   ISASSQNHQTKSTETTSKAQTDTLTQMMTSTLFSSPSVHNVMETAPPDEMTTSFPSSVTN 129

Query: 1983 TGTQTPTTTPITTTT--TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2040
            T   T  T  +TT+T  T+  T   +   T ++TP+T+  ++T         T   T I 
Sbjct: 130  TLMMTSKTITMTTSTDSTLGNTEETSTAGTESSTPVTSAVSITAGQEGQSRTTSWRTSIQ 189

Query: 2041 TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP----- 2095
             T+  +       TQT   T  + T+T+T   T T + +P+   +T T +   +P     
Sbjct: 190  DTSASSQNHWTRSTQT---TRESQTSTLTHRTTSTPSFSPSVHNVTGTVSQKTSPSGETA 246

Query: 2096 -----TPTGTQTPTTTPITTTTTV-----TPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 2145
                 + T T   T+  IT TT+       P  T +   T +  P+T+   VT  P    
Sbjct: 247  TSSLCSVTNTSMMTSEKITVTTSTGSTLGNPGETSSVPVTGSLMPVTSAALVTFDPEGQS 306

Query: 2146 TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-----------PTGTQT 2194
              T + T    TT  +        +T   + I T  T+TP  T           P+GT +
Sbjct: 307  PATFSRTSTQDTTAFSKNHQTQSVETTRVSQINTLNTLTPVTTSTVLSSPSGFNPSGTVS 366

Query: 2195 PTTTPITTTTTVTPTP-------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2247
              T P   TTT +P+        T    + PT+   T   T   + + +GT +  T+ ++
Sbjct: 367  QETFPSGETTTSSPSSVSNTFLVTSKVFRMPTSRDSTLGNTEETSLSVSGTISAITSKVS 426

Query: 2248 T-------TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---TT 2297
            T       +T ++P+  P    T   T  +     T  P    + +P  +    T   TT
Sbjct: 427  TIWWSDTLSTALSPSSLPPKISTAFHTQQSEGAETTGRPHERSSFSPGVSQEIFTLHETT 486

Query: 2298 VTPT-------PTPTGTQTPTTTPITTTTTVTPTPTPTGT---------------QTPTT 2335
              P+        T + T+ P+T+    T  VT  P+ TGT               +    
Sbjct: 487  TWPSSFSSKGHTTWSQTELPSTSTGAATRLVTGNPS-TGTAGTIPRVPSKVSAIGEPGEP 545

Query: 2336 TPITTTTTVTPTPTPTGTQTPTTTPITTT-----------------TTVTPTPTPT---- 2374
            T  ++ +T  P  T  G QT  T    TT                 T  +P+ +P     
Sbjct: 546  TTYSSHSTTLPKTTGAGAQTQWTQETGTTGEALLSSPSYSVTQMIKTATSPSSSPMLDRH 605

Query: 2375 GTQTPTTTPITTTTTVTPTPTPT----------GTQTPTTT----------PITTTTTVT 2414
             +Q  TT P T  +T+  T T             TQ P TT          P+T T TVT
Sbjct: 606  TSQQITTAPSTNHSTIHSTSTSPQESPAVSQRGHTQAPQTTQESQTTRSVSPMTDTKTVT 665

Query: 2415 PTP----TPTGTQTPTTTP-----ITTTTTVTPTPTPTG--TQTPTTTPITTTTTVTPTP 2463
             TP    T +G       P     I+  TT  P PT  G  TQ PTT      ++   T 
Sbjct: 666  -TPGSSFTASGHSPSEIVPQDAPTISAATTFAPAPTGDGHTTQAPTTALQAAPSSHDATL 724

Query: 2464 TPT-GTQTPTTTPITTTTTVTPTP-------TPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2515
             P+ GT    T  +T   +V  TP       T     T   T    T T     T    Q
Sbjct: 725  GPSGGTSLSKTGALTLANSVVSTPGGPEGQWTSASASTSPDTAAAMTHTHQAESTEASGQ 784

Query: 2516 TPTTTPIT----TTTTVTPTP--------TPTGTQTPTTTPITTTTTVTPTPTPTGTQTP 2563
            T T+ P +    TT+  T TP        TP+G++  +T+  TT  +  P+     TQ+ 
Sbjct: 785  TQTSEPASSGSRTTSAGTATPSSSGASGTTPSGSEGISTSGETTRFSSNPSRDSHTTQS- 843

Query: 2564 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT---PTGTQTPT--------TT 2612
            TT  ++ + +    P  TG    +  P T   T++   T   PTG  +PT        T 
Sbjct: 844  TTELLSASASHGAIPVSTG-MASSIVPGTFHPTLSEASTAGRPTGQSSPTSPSASPQETA 902

Query: 2613 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP 2672
             I+       T T  G+ T +     T T  T  PTP      T+T +T+  T T T +P
Sbjct: 903  AISRMAQTQRTRTSRGSDTISLASQATDTFSTVPPTPPSI---TSTGLTSPQTETHTLSP 959

Query: 2673 TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQT 2723
            +G+    TT + +  T  P    +   T  TTP+  T          T  P  +P+   T
Sbjct: 960  SGSGKTFTTALISNATPLPVTYASSASTGHTTPLHVTDASSVSTGHATPLPVTSPSSVST 1019

Query: 2724 PTTTPITTTTT-------VTPTP------TPTGTQTPTTTPITTTTTVTP---TPTPTGT 2767
              TTP+  T T       VTP P        TG  TP   P+T T++ +    TP P  +
Sbjct: 1020 GHTTPLPVTDTSSESTGHVTPLPVTSFSSASTGDSTP--LPVTDTSSASTGHVTPLPVTS 1077

Query: 2768 QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTT 2824
             +  +T  TT   VT T +   T   T+ P+T T++V+    TP P    +  +T   T+
Sbjct: 1078 LSSASTGDTTPLPVTDT-SSASTGHATSLPVTDTSSVSTGHTTPLPVTDTSSASTGHATS 1136

Query: 2825 TTVTPTPT-PTGTQTPT-TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPTPTG 2881
              VT T +  TG  TP   T  ++ +T   TP P  + +  +T  TT   VT P+   TG
Sbjct: 1137 LPVTDTSSVSTGHTTPLHVTDASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTG 1196

Query: 2882 TQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 2938
              TP   T T   +T   TP P      T  ++  T   T  P   P+   T  TTP+  
Sbjct: 1197 HATPLLVTDTSSASTGHATPLPV-----TDASSVSTDHATSLPVTIPSAASTGHTTPLPV 1251

Query: 2939 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 2998
            T T + +     +   T T   +T   TP P  T T + +T  +T     +P+   TG  
Sbjct: 1252 TDTSSASTGQATSLLVTDTSSVSTGDTTPLPV-TSTSSASTGHVTPLHVTSPSSASTGHA 1310

Query: 2999 TPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTP 3050
            TP   P+T+ ++ +       P  +P+   T  TTP+  T     +   TG  TP   T 
Sbjct: 1311 TP--LPVTSLSSASTGDTMPLPVTSPSSASTGDTTPLPVTDA---SSVSTGHTTPLHVTD 1365

Query: 3051 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPT 3106
             ++ +T   TP P  + +  +T  TT   VT P+   TG  TP   T T   +T   TP 
Sbjct: 1366 ASSASTGQATPLPVTSLSSVSTGDTTPLPVTSPSSASTGHATPLLVTDTSSASTGHATPL 1425

Query: 3107 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI 3166
            P      T  ++  T   T  P   P+   T  TTP+  T T + +     +   T T  
Sbjct: 1426 PV-----TDASSVSTDHATSLPVTIPSAASTGHTTPLPVTDTSSASTGQATSLLVTDTSS 1480

Query: 3167 TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT------- 3219
             +T   TP P  T T + +T  +T     +P+   TG  TP   P+T+ ++ +       
Sbjct: 1481 VSTGDTTPLPV-TSTSSASTGHVTPLHVTSPSSASTGHATP--LPVTSLSSASTGDTMPL 1537

Query: 3220 PTPTPTGTQTPTTTPITTT---------TTVTPTPTPTGTQTPTTTPITTT--------- 3261
            P  +P+   T  TTP+  T         TT  P  +P+   T  TTP+  T         
Sbjct: 1538 PVTSPSSASTGDTTPLPVTDASSVSTGHTTPLPVTSPSSASTGHTTPLPVTDTSSASKGD 1597

Query: 3262 TTVTPTPTPTGTQTPTTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVT-PTPT 3315
            TT  P  +P+   T  TTP+  T T +      TP P    +  +T   T   VT P+  
Sbjct: 1598 TTPLPVTSPSSASTGHTTPLPVTDTSSASTGDTTPLPVTNASSLSTGHATPLHVTSPSSA 1657

Query: 3316 PTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP-TTT 3371
             TG  TP   T+T   +T   TP P  TG  + TT   T       +   TG  TP   T
Sbjct: 1658 STGHATPLPVTSTSSASTGHATPLPV-TGLSSATTDDTTRLPVTDVSSASTGQATPLPVT 1716

Query: 3372 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTP 3427
             +++ +T   TP P  + +  +T   +   VT  +   TG  TP   T T   +T   TP
Sbjct: 1717 SLSSVSTGDTTPLPVTSPSSASTGHASPLLVTDASSASTGQATPLPVTDTSSVSTAHATP 1776

Query: 3428 TP----TPTGTQTPTTTPITTTTTVT-------PTPTPTGTQTPTTTPITTT-------- 3468
             P    +   T   T  P+T  ++ +       P  +P+   T  TTP+  T        
Sbjct: 1777 LPVTGLSSASTDDTTRLPVTDVSSASTGQAIPLPVTSPSSASTGDTTPLPVTDASSASTG 1836

Query: 3469 -TTVTPTPTPTGTQTPTTT--PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG 3525
             TT  P   P+   +  TT  P+T  ++V+     +   T  ++  T  TT  P      
Sbjct: 1837 DTTSLPVTIPSSASSGHTTSLPVTDASSVSTGHATSLLVTDASSVSTGDTTPLPVTDTNS 1896

Query: 3526 TQTPTTTPITTT---------TTVTPTPTPTGTQTPTTTPITTTTT-------VTPTPTP 3569
              T  TTP+  T          T  P  + +   T  TTP+  T+         TP P  
Sbjct: 1897 ASTGDTTPLHVTDASSVSTGHATSLPVTSLSSASTGDTTPLPVTSPSSASSGHTTPLPVT 1956

Query: 3570 TGTQTP----TTTPITTTTTVT---PTPTP--------TGTQTPTTTPITTTTTVT---P 3611
              +  P    T+ P+T  ++V+    TP P        TG  TP   P+T T++V+    
Sbjct: 1957 DASSVPTGHATSLPVTDASSVSTGHATPLPVTDASSVSTGHATP--LPVTDTSSVSTGQA 2014

Query: 3612 TPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTP-TTTPITTTTTVTPTPTPTGTQTPTT 3669
            TP P  + +  +T  TT   VT T +  TG  TP   T +++ +T   TP P  + +  +
Sbjct: 2015 TPLPVTSLSSASTGDTTPLPVTDTSSASTGQDTPLPVTSLSSVSTGDTTPLPVTSPSSAS 2074

Query: 3670 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3729
            T   T   VT   +   T   T+  +T  ++V+         T  ++  T  TT  P  +
Sbjct: 2075 TGHATPLLVTDA-SSVSTGHATSLLVTDASSVSTGHATALHVTDASSLSTGDTTPLPVTS 2133

Query: 3730 PTGTQTPTTTPITTTTT------------VTPTPTPTGTQTPTTTPITTTTTVT---PTP 3774
            P+   T  TTP+  T T            VT T +   T   T+ P+T T++ +    TP
Sbjct: 2134 PSSASTGDTTPLPVTDTSSVSTGHATSLPVTDT-SSASTGHATSLPVTDTSSASTGHATP 2192

Query: 3775 TP-TGTQTPTTTPITTTTTVTPTPTPTGTQTP---TTTPITTTTTVTPTPTP--TGTQTP 3828
             P T T + +T   T     +P+   TG   P   T T   +T   TP P    +   T 
Sbjct: 2193 LPVTDTSSASTGQATPLPVTSPSSASTGHAIPLLVTDTSSASTGQATPLPVTSLSSASTG 2252

Query: 3829 TTTPITTT---------TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT-TTP 3878
             TTP+  T          T  P  + +   T  TTP+  T   +P+   TG  TP   T 
Sbjct: 2253 DTTPLPVTDASSVSTGHATSLPVTSLSSVSTGDTTPLPVT---SPSSASTGHATPLHVTD 2309

Query: 3879 ITTTTTVTPTPTPTGTQTPTTTPITTTTTVT-PTPTPTGTQTPT-TTPITTTTTVTPTPT 3936
             ++ +T   TP P  + +  +T  TT   VT P+   TG  TP   T  ++ +T   TP 
Sbjct: 2310 ASSASTGHATPLPVTSLSSASTGDTTPLPVTSPSSASTGHATPLHVTDASSVSTGDTTPL 2369

Query: 3937 PTGTQTPTTTPITTTTTVT-PTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTT 3992
            P  + +  ++  TT   VT  +   TG  TP   T T   +T   T  P  TG  + +T 
Sbjct: 2370 PVTSSSSASSGHTTPLPVTDASSASTGDTTPLPVTDTSSASTGHATHLPV-TGLSSASTG 2428

Query: 3993 PITTTTTVTPTPTPTGTQTP---TTTPITTTTTVTPTP--TPTGTQTPTTTPITTT---- 4043
              T       +   TG  TP   T+T   +T   TP P    +   T  TTP+  T    
Sbjct: 2429 DTTRLPVTNVSSASTGHATPLPVTSTSSASTGDTTPLPGTDTSSVSTGHTTPLLVTDASS 2488

Query: 4044 -----TTVTPTPTPTGTQTPTTTPITTTTTVT-----PTPTPTGTQTPTTTPITTTTTVT 4093
                 TT  P  +P+   T  TTP+  T T +      TP P    +  +T   T+  VT
Sbjct: 2489 VSTGDTTRLPVTSPSSASTGHTTPLPVTDTPSASTGDTTPLPVTNASSLSTRHATSLHVT 2548

Query: 4094 PTPTPTGTQTPTTTPITTTTTVT---PTPTPTGTQTPTTTPITTTTTVTPT-PTPTGTQT 4149
             +P+   T   T+ P+T T+  +    TP P  + +  +T  TT   VT T    TG  T
Sbjct: 2549 -SPSSASTGHATSLPVTDTSAASTGHATPLPVTSTSSASTGDTTPLPVTDTYSASTGQAT 2607

Query: 4150 PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTG--PPTHTSTAPIA 4207
            P   P+T T++ +   T     T T++  T   T  P    +   TG   P H ++   A
Sbjct: 2608 P--LPVTDTSSASTGDTTPLPVTDTSSASTGHATPLPVTNTSSVSTGHATPLHVTSPSSA 2665

Query: 4208 EL--TTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGG 4265
                TT  P  ++S+  T  +TS P+T+++++          T  A     T P++ S G
Sbjct: 2666 STGHTTPLPVTDASSVSTGHATSLPVTDASSV---------FTGHATSLPVTIPSSASSG 2716

Query: 4266 HTLSPPPST---------TTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLST 4316
            HT +P P T          TS P T     +TG ++ P P T   ++ S    TP PL++
Sbjct: 2717 HT-TPLPVTDASSVSTGHATSLPVTDASSVSTGHAT-PLPVT-DASSVSTGHATPLPLTS 2773

Query: 4317 PSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSC 4376
             S + T    P P +             P   + + + GDT        S     +  S 
Sbjct: 2774 LSSVSTGDTTPLPVTDTSSASTGQATPLPVTSLSSVSTGDTTPLPVTDTSSASTGHATSL 2833

Query: 4377 PSTPSPTPTPSKSTPTPSKPSSTPS 4401
            P T + + +   +TP P   +S+ S
Sbjct: 2834 PVTDTSSASTGHATPLPDTDTSSAS 2858



 Score = 38.9 bits (89), Expect = 0.13
 Identities = 47/205 (22%), Positives = 73/205 (35%), Gaps = 32/205 (15%)

Query: 382  CKDLPCPGTCALEGGSHITTFDGKTYTFHG-DCYYVLAKGDHNDSYALLGELAPCGSTDK 440
            C     P    + G  HITT DG +YTF+G   + ++   D N S+ L G  A  GS   
Sbjct: 4545 CATYRPPQPAWMFGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQA 4604

Query: 441  QTCLKTVVLLADKKKNVVVFKSDGSVLL---NELQVNLPHVTASFSVFRPSSYHIMVSMA 497
               +             V  +     LL   + ++V L + T +F              A
Sbjct: 4605 TNFIAFAAQYRSSSLGPVTVQ----WLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNA 4660

Query: 498  IGVRLQ------------------VQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDF 539
             GV L                   + L+ ++    +L    Q + +GL G +N    DDF
Sbjct: 4661 TGVLLSRNGSEVSASFDGWATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDF 4720

Query: 540  KTASGLVEATGA------GFANTWK 558
            +  +G     G+       F  TW+
Sbjct: 4721 RMPNGSTIPPGSPEEMLFHFGMTWQ 4745



 Score = 38.5 bits (88), Expect = 0.18
 Identities = 44/178 (24%), Positives = 68/178 (38%), Gaps = 26/178 (14%)

Query: 4484 WGDPHYVTFDGLYYSYQGNCTYVLV----------------EEISPSVDNFGVYIDNYHC 4527
            +GDPH  T DG+ Y++ G   ++LV                +  S    NF  +   Y  
Sbjct: 4557 FGDPHITTLDGVSYTFNGLGDFLLVGAQDGNSSFLLQGRTAQTGSAQATNFIAFAAQYRS 4616

Query: 4528 DPNDKVSCPRTLIVRHETQEVLI--KTVHMMPMQVQ--VQVNRQAVALPYKKYGLEVYQS 4583
                 V+  + L+  H+   VL+  +TV   P       Q    A  +   + G EV  S
Sbjct: 4617 SSLGPVTV-QWLLEPHDAIRVLLDNQTVTFQPDHEDGGGQETFNATGVLLSRNGSEVSAS 4675

Query: 4584 GINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTSDDCILPSGEIV 4641
               +      + V+   N L  S  LP   + N T+G  G   N   DD  +P+G  +
Sbjct: 4676 FDGWAT----VSVIALSNILHASASLP-PEYQNRTEGLLGVWNNNPEDDFRMPNGSTI 4728


>gi|239750277 PREDICTED: hypothetical protein XP_002347351 [Homo
            sapiens]
          Length = 2134

 Score =  773 bits (1996), Expect = 0.0
 Identities = 489/1498 (32%), Positives = 712/1498 (47%), Gaps = 126/1498 (8%)

Query: 218  CSEHRAECERLLTAEAFADCQDLVPLE-PYLRACQQDRCRCPGGDTCVCSTVAEFSRQCS 276
            C +    C +++    F  C  +  L   Y   C  + C+     T  C T +E SR C+
Sbjct: 682  CEDGIQHCNKII-GTYFEKCGKVAALSNDYKMICIDEYCQTRD-KTSTCDTYSELSRLCA 739

Query: 277  HAG-GRPGNWRTAT--LCP-KTCPGNLVYLESGSPCMDTCSHLEVSSLCEEHRMDGCFCP 332
              G G   +WR+ +  +C  + CP   +Y E G     TCS+  V+   +   + GC CP
Sbjct: 740  SDGPGTFESWRSDSDVVCETQRCPEQHIYKECGPSNPATCSN--VAPFQDSECVSGCTCP 797

Query: 333  EGTVYDDIGDSG-CVPVSQCHCRLHGHLYTPGQEITNDC-EQCVCNAGRWVCKDLPCPGT 390
            EG + DDIG+ G CV  ++C C   G +Y PG+     C  QC C   +W C +  CPG 
Sbjct: 798  EGYLLDDIGEKGKCVLKAECPCESSGTVYQPGEVREGPCGSQCTCQDAKWSCTEALCPGR 857

Query: 391  CALEGGSHITTFDGKTYTFHGDCYYVLAKGDHNDSYALLGELAPCGSTDKQTCLKTVVLL 450
            C +EG S +TTFDG  Y F G+C+++     HN+ +++  EL PC S    TCL +V LL
Sbjct: 858  CKVEGSS-LTTFDGVKYNFPGNCHFLAV---HNEDWSISVELRPCPSGQTGTCLNSVTLL 913

Query: 451  ADKKKNV--VVFKSDGSVLLNELQVNLPHVTASFSVFRPSSYHIMVSMAIGVRLQVQLAP 508
             +    V   VF SDG+V  ++++    + +    +F  SS ++ V     V+LQ+Q+ P
Sbjct: 914  LNSSVPVDKYVFNSDGTVTNDKIRNQGYYYSDKIQIFNASSSYLQVETYFHVKLQIQIVP 973

Query: 509  VMQLFVTLDQASQGQVQGLCGNFNGLEGDDFKTASGLVEATGAGFANTWKAQSSCHDKLD 568
            VMQL+V++         GLCG++N    DDF ++  ++E T   FAN+W+  S       
Sbjct: 974  VMQLYVSMPPNQFTDTVGLCGSYNNKAEDDFMSSQNILEKTSQAFANSWEMMSCPKG--- 1030

Query: 569  WLDDPCS-LNIESANYAEHWCSLLKKTETPFGRCHSAVDPAEYYKRCKYDTCNCQNNEDC 627
               +P S ++IE   +AE  C +L  +  P   CH  V+P  Y++ CK  TC C+N++DC
Sbjct: 1031 ---NPSSCISIEKEKFAERHCGILLDSSGPLASCHPIVNPKPYHEECKKYTCTCENSQDC 1087

Query: 628  LCAALSSYARACTAKGVMLWGWREHVCNKDVGSCPNSQVFLYNLTTCQQTCRSLSEADSH 687
            LC  L +Y +AC  K   + GWR  +C     SCP+  VF YN+  C  +CRSLSE D  
Sbjct: 1088 LCTILGNYVKACAEKETYIVGWRTGLCEH---SCPSGLVFKYNVKACNSSCRSLSERDRS 1144

Query: 688  CLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSCYHRGLYLEAGDVVVRQEERCVCRDGRL 747
            C     PVDGC CPD  + + +G CV  ++C CY     ++ G ++   + +CVCRDG L
Sbjct: 1145 CDVEDVPVDGCTCPDAMYQNNEGNCVLKSQCDCYINDEVMQPGKLIHIDDNKCVCRDGIL 1204

Query: 748  HCR-QIRLIGQSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGL 806
             C+  I L  Q+C+    ++DCS+  A   +  R  S + +     +  C  GC CP+G+
Sbjct: 1205 LCQIPIDLTLQNCSGGAEYVDCSDPKAQRRTN-RTCSTRNIPVFDENLPCKRGCFCPEGM 1263

Query: 807  MDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCNTCTCKRGRWVCTQAVCHGTCSIYGSG 866
            + + +G CV   +CPC      Y  G+   V CN CTC +G W CTQ  C   C IYG G
Sbjct: 1264 VRNSKGICVFPNDCPCSFGGREYDEGSVTSVGCNECTCIKGSWSCTQNECQTICHIYGEG 1323

Query: 867  HYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGR 926
            H  TFDGK Y FDG C Y  ++DYCG  +  G+F I+TE+VPC   G+TCS+ I +    
Sbjct: 1324 HVRTFDGKSYSFDGLCQYSFLEDYCGHEN--GTFRILTESVPCCEDGLTCSRKIIVAFQD 1381

Query: 927  TELKLEDKHRVVIQRDEGHHV-----AYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLA 981
              + L+D     ++  E         AY+   VG YL+++   GIIVIWDK T + + L 
Sbjct: 1382 QNIVLQDGKVTAVKSTESKKCELNANAYSIHTVGLYLILKFQNGIIVIWDKNTRLSVILD 1441

Query: 982  PSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNP 1041
            P++ G VCGLCGN +    +DFTTR   V S  L+FGNSWK +