Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 116008194

BLASTP 2.2.11 [Jun-05-2005]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|116008194 myosin light chain kinase isoform 3A [Homo
         (1863 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]     3759   0.0  
gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]      3736   0.0  
gi|116008190 myosin light chain kinase isoform 3B [Homo sapiens]     3437   0.0  
gi|116008188 myosin light chain kinase isoform 2 [Homo sapiens]      3413   0.0  
gi|16950625 myosin light chain kinase isoform 8 [Homo sapiens]        313   1e-84
gi|16950623 myosin light chain kinase isoform 7 [Homo sapiens]        306   9e-83
gi|110349719 titin isoform N2-A [Homo sapiens]                        295   3e-79
gi|110349717 titin isoform novex-2 [Homo sapiens]                     295   3e-79
gi|110349713 titin isoform novex-1 [Homo sapiens]                     295   3e-79
gi|110349715 titin isoform N2-B [Homo sapiens]                        295   3e-79
gi|146219832 myosin light chain kinase 3 [Homo sapiens]               236   2e-61
gi|167466233 myosin light chain kinase family, member 4 [Homo sa...   221   7e-57
gi|14993776 skeletal myosin light chain kinase [Homo sapiens]         220   1e-56
gi|89363047 death-associated protein kinase 1 [Homo sapiens]          200   9e-51
gi|4557511 death-associated protein kinase 3 [Homo sapiens]           191   6e-48
gi|14670383 death-associated kinase 2 [Homo sapiens]                  189   3e-47
gi|157785645 SPEG complex locus [Homo sapiens]                        186   2e-46
gi|148839466 kalirin, RhoGEF kinase isoform 1 [Homo sapiens]          185   4e-46
gi|68362740 kalirin, RhoGEF kinase isoform 3 [Homo sapiens]           185   4e-46
gi|118572606 hemicentin 1 [Homo sapiens]                              179   2e-44
gi|169178458 PREDICTED: hemicentin 2 [Homo sapiens]                   171   5e-42
gi|239749684 PREDICTED: hemicentin 2 [Homo sapiens]                   171   5e-42
gi|169177000 PREDICTED: hemicentin 2 [Homo sapiens]                   171   5e-42
gi|4502557 calcium/calmodulin-dependent protein kinase IV [Homo ...   158   5e-38
gi|4502553 calcium/calmodulin-dependent protein kinase I [Homo s...   158   5e-38
gi|9966875 calcium/calmodulin-dependent protein kinase ID isofor...   154   6e-37
gi|23943850 calcium/calmodulin-dependent protein kinase ID isofo...   154   6e-37
gi|109150416 peroxidasin [Homo sapiens]                               152   2e-36
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   151   7e-36
gi|4758194 serine/threonine kinase 17B [Homo sapiens]                 147   1e-34

>gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]
          Length = 1863

 Score = 3759 bits (9749), Expect = 0.0
 Identities = 1863/1863 (100%), Positives = 1863/1863 (100%)
































Query: 1861 EEE 1863
Sbjct: 1861 EEE 1863

>gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]
          Length = 1914

 Score = 3736 bits (9687), Expect = 0.0
 Identities = 1863/1914 (97%), Positives = 1863/1914 (97%), Gaps = 51/1914 (2%)




























Query: 1621 LFGTPEFVAPEVINYEPIGYATDMWSIGVICYIL-------------------------- 1654

Query: 1655 -------------------------NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM 1689




>gi|116008190 myosin light chain kinase isoform 3B [Homo sapiens]
          Length = 1794

 Score = 3437 bits (8911), Expect = 0.0
 Identities = 1739/1863 (93%), Positives = 1749/1863 (93%), Gaps = 69/1863 (3%)







                                      PGLG   V+S +   R      R + FP  +   
Sbjct: 359  --------------------------PGLG---VLSPSGEERKRPAPPRPATFPTRQPGL 389

             SQ+V  ++    R  + G        F E  P      S EV E+    + C       

                                    E LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
Sbjct: 436  ------------------------EGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT 471























Query: 1861 EEE 1863
Sbjct: 1792 EEE 1794

>gi|116008188 myosin light chain kinase isoform 2 [Homo sapiens]
          Length = 1845

 Score = 3413 bits (8849), Expect = 0.0
 Identities = 1739/1914 (90%), Positives = 1749/1914 (91%), Gaps = 120/1914 (6%)







                                      PGLG   V+S +   R      R + FP  +   
Sbjct: 359  --------------------------PGLG---VLSPSGEERKRPAPPRPATFPTRQPGL 389

             SQ+V  ++    R  + G        F E  P      S EV E+    + C       

                                    E LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
Sbjct: 436  ------------------------EGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT 471



















Query: 1621 LFGTPEFVAPEVINYEPIGYATDMWSIGVICYIL-------------------------- 1654

Query: 1655 -------------------------NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM 1689




>gi|16950625 myosin light chain kinase isoform 8 [Homo sapiens]
          Length = 154

 Score =  313 bits (802), Expect = 1e-84
 Identities = 154/154 (100%), Positives = 154/154 (100%)




 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 36/92 (39%), Positives = 51/92 (55%)

           P F    R+L + EG+ A+F+ ++ GYP+P+V W ++ Q I     F +D    G  SL+

           I  V  +D  KYTC+A N  G    T EL VE

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 40/119 (33%), Positives = 58/119 (48%), Gaps = 2/119 (1%)

           E +      +L  VA  KP   P F + + DL+V++GS      ++ G P PEV+W  + 

             I+ES  F  +       SL I +V  +D   YTC+A NS GE    A L V+   +G

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

           F     E +P +     P F+  +  + V EG   RF CKI G P P+V W K +  ++ 

           S    +  +++G   L I  V  DD   YTC  VN  G+A+ +AEL ++ ++

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

           V P FS  ++D  V+EG      C + G P P + W  + Q I+ +R       E G   

           L I D   +D   YTC A N+LG+ +C+A + V

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 36/127 (28%), Positives = 57/127 (44%), Gaps = 2/127 (1%)

           T P     L S++ VS+A    +  E  +    P F    +  EV E    +F C++ G 

           P PEV WF +   +R        Y++ G+  L +      D   Y+C A N+ G+ +C+ 

Query: 501 TLQVERL 507
            L VE +
Sbjct: 136 ELIVETM 142

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

            E     P F + ++D+ V EG      C++   P   ++W  + ++++ ++ F I   E 

              CS+ I     +D   Y C A N  G+A C+ ++ V+     E

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 2/124 (1%)

           T     E   S  +V    +  V E     +P+F    R +    G +    C I G P 

           P V W +D +++ +++ HF++  +ED   +L++  V      +Y     N +GE +C   

Query: 809 LMLQ 812
Sbjct: 137 LIVE 140

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

            K  + P   +   D +V  G +     K+ G       W K  + I+ES H +++  E+G

            +   I++   + CG     YT    N LG       L V

>gi|16950623 myosin light chain kinase isoform 7 [Homo sapiens]
          Length = 153

 Score =  306 bits (785), Expect = 9e-83
 Identities = 153/154 (99%), Positives = 153/154 (99%), Gaps = 1/154 (0%)




 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 36/92 (39%), Positives = 51/92 (55%)

           P F    R+L + EG+ A+F+ ++ GYP+P+V W ++ Q I     F +D    G  SL+

           I  V  +D  KYTC+A N  G    T EL VE

 Score = 67.8 bits (164), Expect = 1e-10
 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

           +L  VA  KP   P F + + DL+V++GS      ++ G P PEV+W  +   I+ES  F

             +       SL I +V  +D   YTC+A NS GE    A L V+   +G

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 37/119 (31%), Positives = 59/119 (49%), Gaps = 5/119 (4%)

           S+ +   F     E +P +     P F+  +  + V EG   RF CKI G P P+V W K

            +  ++ S    +  +++G   L I  V  DD   YTC  VN  G+A+ +AEL ++ ++

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

           V P FS  ++D  V+EG      C + G P P + W  + Q I+ +R       E G   

           L I D   +D   YTC A N+LG+ +C+A + V

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 37/127 (29%), Positives = 57/127 (44%), Gaps = 3/127 (2%)

           T P     L S+DV S+A    +  E  +    P F    +  EV E    +F C++ G 

           P PEV WF +   +R        Y++ G+  L +      D   Y+C A N+ G+ +C+ 

Query: 501 TLQVERL 507
            L VE +
Sbjct: 135 ELIVETM 141

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

            E     P F + ++D+ V EG      C++   P   ++W  + ++++ ++ F I   E 

              CS+ I     +D   Y C A N  G+A C+ ++ V+     E

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

           ++PH   +P+F    R +    G +    C I G P P V W +D +++ +++ HF++  

           +ED   +L++  V      +Y     N +GE +C   L+++

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

            K  + P   +   D +V  G +     K+ G       W K  + I+ES H +++  E+G

            +   I++   + CG     YT    N LG       L V

>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  295 bits (755), Expect = 3e-79
 Identities = 217/812 (26%), Positives = 353/812 (43%), Gaps = 130/812 (16%)

             AP FK++L++++V       L C+V+  P   + W   GK +     K+ I   +G    

             + I     +D  +Y+  A N  G    +  + V+                          
Sbjct: 30987 LIIASVTDDDATVYQVRATNQGGSVSGTASLEVE-------------------------- 31020

                             P K  +P  +        +R GE V +    +G      TW K 

             +  I  + H +V  + + + L       ++  G Y +  +N+ G  Q  V L V D PDP

             P G    SD+   S+ L+W   + DGGS + +Y +E   +  + W  +   R T + V +

             L     Y+FRV A N +G S+PS+ SE T   E      +  E  D+     EV     +

              ++ +++ + Y I E LG G+FG V R VE  ++K +  KF K     ++  +++EISI+

             N   H  ++   ++FE    +VM+ E +SG ++FERI    FEL ERE + Y+ Q+ E +

             +++H   I H D++PENI+   +  + IK+I+FG AR+L+   + ++LF  PE+ APEV 

Query: 1634  NYEPIGYATDMWSIGVICYIL--------------------------------------- 1654
              ++ +  ATDMWS+G + Y+L                                       

                         +R+  ++ LQHPWL +  + +  K +   + ++Y      +K  N V 

             +  R+S    I      +S  G   + +    +E    VS   + AV EE  HVK     

                           + CKIE Y    +V W+   + +  S  ++I Y EDG   L + D+

                DD  Y CK VN  GE +  AEL V+ + E

 Score =  217 bits (553), Expect = 7e-56
 Identities = 286/1264 (22%), Positives = 491/1264 (38%), Gaps = 198/1264 (15%)

            +APA F+    +  I++G     EG   G P   VTW +NG  +T   R    C I  T 

               I  +     ED G+Y C   N SG    + ++ +                       

                         PP F  +L  V V  G      C++ G P+  V+W KG+  L+P+  

              +  +N +  L  + V+ +D G Y C   N  G+ S S  L++Q       SF R+ + 

               DV++ V   +  +  +   E  + S             W  + +P           K
Sbjct: 8065 ---DVQETVGLPVVFDCAISGSEPISVS-------------WYKDGKP----------LK 8098

            DSP    QT  L  T++    +  R             S +G+       P         
Sbjct: 8099 DSPNV--QTSFLDNTATLNIFKTDR-------------SLAGQYSCTATNP--------- 8134

              +GS    + ++ R I  EG+     P F+ +    +    ++  F C V+G    +V+

            W  +   +R   G  ++     S +L +LK    DSG Y+C A N  G+ SC+  L + E

            RL    + PSF+  L +     EG  F L+  V G+    + W  N    QP      T 

            +     L ++ A   D G YTC   N  G   C++ + + E              P KP 

             P+F Q L+ + V +G  V ++  V G+ P  + WL  G EI+ S+   F        L 

            +++V   D+G Y C+A N AG   T++ +T+++             DG + +F+S+P+S+

                  +      + GDP P V W +         G   + Q  D   L ++      +G

             Y  +  N  GE    V+L +     +    G  R       +   G G +    D    

            L+   P   + +       D RG+L+     +Q  EE   + E+E+++ R    +K   +

             +S    +    E +    +++ Q   K    V E + K++ P+      +   KGT K 

                     +P+     S+ G +  L  +N       +   +    + S+K L+  +P+ 

               L+ V   K  +T        + N K         LKP G  K   +  +   +  ++

            + + +    CK      T  E R E++     F +++Q++ V+E +    +C+VS D  A

             + W      L  ++      +G    ++I    P+D G+Y  +A+    G+A  + ++ 

            +         K P++  SR P  ++P          ++  P  + PP  A P P ++  P

Query: 1245 EDQK 1248
Sbjct: 8973 EEKK 8976

 Score =  189 bits (480), Expect = 2e-47
 Identities = 207/837 (24%), Positives = 323/837 (38%), Gaps = 133/837 (15%)

            S+ + E P F   P  +   +GA    E  ++G P   V+W+++ + + SG ++ +   +

               F   IH ++ +  D G+Y C+ATN  G+       T  GS A +             

                            PP+F  KL  +    G+  +    I G     V W K    + +

             S  + +S    +  L+   V   + G YTC + N +G     A                

                       E ++ G    +  + ++ K   SD + +++   +K S L  +  A    

                     S  ++   Q    ++S   S + S RT P +   +K   +  L  + V  E

             +  G   +S S    G E    RK        T       L    S D    A N    

            M G  + + P        F  KP   +V     V F   V G P   V+WF   + +   

            +      ED+ +  L L    T  SG Y+C  SN  G+ SC+  L ++  A       F 

              L D ++ +G+  +L+ +  GTP   +TW  NG    P Q    T     A L I  + 

             ED G Y C  ENA G+ SCSA + + E                    P F++ L  +KV

              G   ++  Q++G P   V W     +++ +  +    R    +L   +V   D+G Y 

            C+A NS GEV     LTVQE      P F  + R V  ++G  V+  CAI+G    +V W

             +DGK L KD+ + +    ++  TL + K     AGQY     N +G  S    L+L

 Score =  188 bits (478), Expect = 4e-47
 Identities = 216/961 (22%), Positives = 369/961 (38%), Gaps = 152/961 (15%)

            P+F  K + S+ VK+++  ++ C++ G P+ +V W+ + T ++        + D+ +  L

             +      DSG Y+C A NA G  S S +L+V+   +    P     LK      G D  

            L+C ++GTP   ++W  + + ++  +      E  +  +HI +    D G Y C A N +

            G  +C   + +               AP     P F++ LSD+  + G +V +   + G 

             P  V+W  +  EI +ES++          +L    V P + G YTC+  N AG     A

             L+V EP        + KP S+  + G +  + C +AG P  +  W +DGK L  D   +

            ++     V  L +  V P  +G Y   ++N VG+ SC  SL +   S R +P    R+  

                L G  V  +      YGS     P     W  E  G ++    K +     +T  A

            +    +E+ D  D     ++T     D+                    P TV E    V 

             P  +D   VL     + T + +  PP   +     S L  G +  +  E+  +  E  +

                +S       S     A  +  L     AK  + L        KP+       G   

             + T K  G N  P +  N+ +  K  + +   + V      NC   +A   D+      

                P F ++L+ V V+ G    LQCQ++  P   + W      L+ T    +    ++ 

            ++   +    D G Y C A+N  G+   S  +TV +                        
Sbjct: 8017 TLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQE------------------------ 8052

                                  +PP   +   D +   G  V     ++G++PI+ +W K

              K +++S +++    +N + L I    +   G Y+    N +GS  +   L + +  +P

Query: 1334 P 1334
Sbjct: 8153 P 8153

 Score =  183 bits (465), Expect = 1e-45
 Identities = 200/829 (24%), Positives = 321/829 (38%), Gaps = 119/829 (14%)

            VD       P+F    +N     GA+   E +V G     V W      I SG ++    

              + TFS     L ++++   D G YTC A N +G+ +    LTV+              

                                 PP F  +   + V  G+   F+  I G P  +V W +G 

              L    R ++  ++ +  LE+  ++    G YTC+V N +G+AS +  L ++   +   

                      +S + E+  T +       +K+  N+ + E   + + E     +  +S +

            R     ++   + +  R+    L S  + P    +  P+      S++LQ          

            P + V    G+ + RP P     F      L         S +   KA      A+ +  

               Q     P F  + +  E      V   C ++G    +V W+ +G  +R  E     +

             D     L +L+     SG YSC+ASN  G  S S  L        + +P F        

            VI G+    +C V G    RITW  + + I+   +   TC      L I      D G Y

            TC A N +G+  CSA ++V E                    P F++ L   KV   G  +

             +  ++SG+P  +V W  N +E+ ES  ++     +   L I E   ED+G Y CEA N 

             G+      LTV+ P     P F  KP  V A  G  V++ C I+G P   V W++D K 

            + +++  F++       +L +  ++    G+Y     N VG   CSC V

 Score =  183 bits (464), Expect = 2e-45
 Identities = 195/836 (23%), Positives = 324/836 (38%), Gaps = 132/836 (15%)

            + + E P+F+  P  L +  G    F   +RG P  +V W R  + +  G R    C I 

                   L +  +     G+YTC  +N +G    T  L     F K+             

                            P  F  +L    V+ G+        TG     VTW K    +  

            S + ++       +LEI    + D G Y+C + N +G+                      

                  S+S +  + G      S+ + +TK   + + R   TN     V +K +  DS E

               K++N S         +    +  PP  S     KD  +T      L  + + S  +Q

                +        GVL    E  +       AT    Q  L      S +A+  +     

               +  +     P F+ KP S +V   ++  F C V+G     + W  +   +R   G+ 

             +     + +L +LK    DSG Y+C A+N  G+  CS  L V+        P F   L+

               V  +G+   L+C + G+P  +++W  N   +    +Y  S   + VA L I +A  E

            D G Y C A N +G  SCS  +TV               AP     P+F Q  S +  + 

            GS V +  ++SG PP EV+W+ +  +++ S+ F    +    SL I  +   D G Y C+

            A N  G       +  +EP     P F+ K    +  +G +V +   + G    +V WL+

            D   + +++ +  +   +++ TL L   +  ++G+Y   +KN  G  ECS  ++++

 Score =  176 bits (446), Expect = 2e-43
 Identities = 181/789 (22%), Positives = 290/789 (36%), Gaps = 142/789 (17%)

            M +  AP        L +  G  AKF   ++  P  +  W + G+ I    +    C IR

             +    SL I      D G+YTC+A+N  G+   T  LTV  ++                

                            PP F ++   +    G+  +F C +TG P  +  W K    L P

            S    +S+     +LE+  +   D GVY+C   N  G     AEL I  +D  +  F++E

             +   S + K+V      E ++D               R  +  W+ + Q  PP +   +

             C +      + P+ +   S                G  V + S E          AT  

             R+P                          P F  K   S  +   ++ +  C++ G P 
Sbjct: 3733 VREP--------------------------PSFVKKVDPSYLMLPGESARLHCKLKGSPV 3766

             +V WF     +  +  ++ +Y       L +   +  DSG+YSC A N  G  SCS  +

                  V++  PSF   L+   ++ G + +LQC V GT    I+W  + + I+ +   R 

              +  +  L I      D G Y C+  N +G+  C A   + E                 

               P F++ + DL  + G  VT+   V G+ P  V W+     I+E              

            L I +V     G YTC A N AG   +   L V+EP        I +   +  + G    

            +   +AG P     W +DG+ L   +  + +    +V  L     +   +GQY   + N 

Query: 800  VGECSCQVS 808
            VG  SC+ +
Sbjct: 4095 VGSSSCETT 4103

 Score =  172 bits (437), Expect = 2e-42
 Identities = 123/402 (30%), Positives = 180/402 (44%), Gaps = 34/402 (8%)

            P F  KPQSQ+V  N  V+ +  V G     + WF +   +     +  V++D  S  L 

            L  A+  DSGTY C  SN  G  +   TL V+        PS   VL++     GQ    

            +C + GTP  R++W L+G  I   +    +   G+A   I  A  E+ GTY C A N  G

              SCS  + V E                    P F++ L  ++V+  S V +  +V+G P

            P EV WL N  EI+ S+ +    R +  +L I +  P DTG Y C   N  G       +

             ++EP     P FI K  + T  L  S      +AG P  ++ WL+D + L +D   + +

               + V TL ++ V   H+G+Y    KN  G   C   L++Q

 Score =  165 bits (417), Expect = 4e-40
 Identities = 182/788 (23%), Positives = 302/788 (38%), Gaps = 136/788 (17%)

            L E P+FI    N      ++A F+  V G P   +TW ++ Q +       +   +   

             +L I +V     G+YTC+A N SG  +    L V+                        
Sbjct: 5103 ATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQE----------------------- 5139

                       P +   K   V V E       C + G P+ +V WLK    + PS   S

            +S +N +    I  V + D G YT  V N  G +S  A L +    +   SF +  K T 

             D  K + + I  E K+  SL  +A+              W  + +           C +

               +     +  + +++ T + + V  +    G+  +           PP     P RQ 

             +    V  KA  +            P F+ K             F+ +V  +  P+   

             LEG+                + +L L       +G Y+C  +N  G  SC+  L V   

                  P F   L+   +++ G    L+C + G+P  R+ W  N   +  +   R T   

             VA + + +   ED G + C A+N  G  SCS  V V E           PV  S P  P

            I       ++ +  ++V++  ++SG PP EV+W  +  +++ S+ +    +    S+ I 

             V   D G Y C+A N  G       + ++EP     P F+SK  S+T   G+   +  +

            I G     V WL++ + + +++ +  +   E+V TL   K +P +AG+Y   +KN  G  

Query: 804  SCQVSLML 811
Sbjct: 5693 ENMATLMV 5700

 Score =  164 bits (416), Expect = 6e-40
 Identities = 162/691 (23%), Positives = 267/691 (38%), Gaps = 79/691 (11%)

             +VTW+++G+ +   G F       GT+ L I+ + E D+G+Y CE +   G  +  ++  

              +            S  K+  Q     T+  +    A E   S      P   T L    

             V    + +F+ K TG P+P   W K    +    +  +SE  G   LEIH  +  D G+Y

             TC V N +G  S S +L+I+ +       V   K +       + V++E++    +  ++

                EA ++         SK   S +   S   +          +K     +  RT  +  

                 T  SI  +  R+  +    G         GV   + EE +        T   +Q  

                + +   +SK     +  +      +  S  P F S+P+SQ + E Q V F CE+SG 

             P PE+ WF    P+     ++ +      + L +  A   DSG Y+  A N +GQ  CS 

             T  +  L ++E  PS   VL+        D  LQ S             + Q +Q + S 

              EA  +      A       +  ++  ++        ++S S+++ +        S   +

               A  +   P      SD+ + +G  +T+    +G P PEV W   G +I  QE   FH 

             E      +L I +V  +D G YT    N  G

 Score =  163 bits (413), Expect = 1e-39
 Identities = 181/791 (22%), Positives = 289/791 (36%), Gaps = 144/791 (18%)

            E P FI  P   L ++ G +  FE ++ G P+ +V+W+ +G  IT+  +  +   I G  

            +  I     E+ G Y CEA N +G    ++EL V+                         
Sbjct: 4918 TFQISGARVENSGTYVCEARNDAGTASCSIELKVKE------------------------ 4953

                      PP F  +L  V V +       C++TG P  +VTWLK N  ++ S + ++

            +++  +  L I   +  D G Y C+V N  G  S S  ++++       SF+++ + T  

                  T V+   +   S  A             GSPP    W  + Q     ++   S 

             DS  T     V    S   T QA               + SG ER        A    +

            +P      +V KA                      +S +V E   +   C V+G P+ +V
Sbjct: 5139 EPA----QIVEKA----------------------KSVDVTEKDPMTLECVVAGTPELKV 5172

             W  +G  +         +E+  + +  +     +DSG Y+    N  G  SC   L   

            R+    + PSF+  L     + G    ++C V G+      W  +G+ I  +   R  C 

                 L + +   ED   YTC   N  G  +CS  +TV E                    

            P FL      + +  S V     + G PP ++ W  +  E+           G+   L +

              V    TG YTC   N  G      +L V EP     P F+ K   S     G S  + 

            C IAG P   V W R+   L   +  + +   + V  + +  +    +G +    +N  G

Query: 802  ECSCQVSLMLQ 812
              SC   ++++
Sbjct: 5504 STSCSTKVIVK 5514

 Score =  159 bits (402), Expect = 2e-38
 Identities = 114/408 (27%), Positives = 182/408 (44%), Gaps = 16/408 (3%)

            P+   + Q   V+  +  +F   +SG P+P+++W+ E   +       +   D   + L 

            L++A   D+  Y+C A N  G  + S +L VE   V+          P+  + L+D    

            EGQ    QC V GT + +++W    +   P ++ R T      +L I +A PED GTYT 

            +A NA+GQVS +A +++   +S         +      AP+  + +  L+V  G     T

             ++   P     W   G EI ES+           SL I      D G YTC+A N  G 

            V   A LTV E +    P F+S+P+S+T  +G++    C + G P     W +DG AL  

             + ++ +   E+   L L  +     G Y     N+ G   CQ  L++

 Score =  156 bits (395), Expect = 2e-37
 Identities = 172/788 (21%), Positives = 296/788 (37%), Gaps = 148/788 (18%)

            +TE P F+     +  +K G +++ E ++ G PE +V W RN   + +  ++ +   I  

               + ++ +  ED G + CEA N +G+   + ++ V+                       
Sbjct: 5478 VAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVK----------------------- 5514

                 P ++   PP   T      +K  ++    C+++G P  +V W K    L+ S + 

             ++ KN    + I  V+  D+G Y C   N  G  +    + +                 

                 KE    +SK + L  +  A +     +   G  P    W          + K E 

             ++S         +    +  TLQ A+ +P      +  +   G  R+       AT   

             +P +    +V KA     PM                   V   +T    C+V+G P+  
Sbjct: 5701 LEPAV----IVEKAG----PM------------------TVTVGETCTLECKVAGTPELS 5734

            V W+ +G  +   Q+     Y    S  L +L    +D+GTY+    N  G+ SC+  + 

            V   A   V PSF+  LK+   + G   +L+C V G+    + W      +++G   Q  

             +T    V  L +      D G YTC+A N  G   C A +TV E               

                 P F++    L+V+ G  VT T  + G PP +V W     E+ + +  +     T 

              L +  +    +G YTC   N+AG+      L V+EP       F+ +    +   G+S

            +++     G    +V W +DG  +   +    ++  E    L +       AGQY   ++

Query: 798  NRVGECSC 805
            N  G   C
Sbjct: 6062 NEAGRDVC 6069

 Score =  152 bits (384), Expect = 3e-36
 Identities = 153/659 (23%), Positives = 252/659 (38%), Gaps = 74/659 (11%)

            PP+   +L  V V+ G+  RF   I+GRPQP+++W K    L    +           L 

            +     +D  VYTC   N  G A+ SA LS++         V E  + + ++      +I

            +      + E       C          W +  +  +P R  ++   +D+ +        

                    L+ A   PE       V S +  +    A           P    + ++ + 

              + I ME +   A P  + K +  EV      KF CE+   P     WF  G  +   +

                +        L +L+ +  D G Y+C ASN  G +SC+ TL V         P+F S

              K      G+     C+V GTPV    W  +G  +  + +   +     HI    +   

            +D G Y+C A N  G   C A + + +K                   P F++ L  ++  

               +V +  QV  +    V W  +G ++   +D+         +L I     +D+GTY C

             A N AG     A +TV+EP     P F+ K   S     G+S  + C + G P   V W

             ++ K L + +T     + +E +  +   KV+   +G Y     N VG  SC   ++++

 Score =  150 bits (378), Expect = 1e-35
 Identities = 184/788 (23%), Positives = 286/788 (36%), Gaps = 141/788 (17%)

            AP F  P RN+      T + + ++ G    +V+W ++G+ I +  R+ +   + GT SL

             I  V   D G +TC ATN  G++  +  L V+                           
Sbjct: 4171 EIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQE-------------------------- 4204

                    PP F TK G   V  G          G     + W KGN  L       +++

            +     LE++ V   D G YTC V N +G    SA L ++       +FV + + +    

            + + T +  K +                    G+PP    W AN      RE K ES K 
Sbjct: 4313 KGDATQLACKVT--------------------GTPPIKITWFAND-----REIK-ESSKH 4346

                   T VL+ T   I                     SGE                Q 
Sbjct: 4347 RMSFVESTAVLRLTDVGI-------------------EDSGE-----------YMCEAQN 4376

              GS    S    +  P        F K E KP   EV +   V    EV+G P  E+ W

            F + T + R     + +       L +LK    D+G Y C  +N  G   CS      R+

             + E  PSF   ++  + + G     Q +++G+    +TWL +   I      R T E  

            VA L++     +  G Y C A+N  G   CSA ++V                  K  A I

              + +S + V  G   T+ V+ SG       W  +G E+     +      T   L I  

               +D+G YT E  N  G    +A + V +      P F  K + + +  G  + + C +

            AG    ++ W +D + +     +     +   F L + +++   +G Y     N+ G   

Query: 805  CQVSLMLQ 812
            C   L ++
Sbjct: 4758 CSGHLTVK 4765

 Score =  149 bits (375), Expect = 3e-35
 Identities = 114/402 (28%), Positives = 173/402 (43%), Gaps = 34/402 (8%)

            P FE  P S EV    ++ F   + G P  +V WF     +   E      ED  +  L 

            L + +  +SG YSC  +N  G  SC+  L V+  A      +F   L D +V  G   VL

            + +  GTP   ++W+ +   I  +   C   + E    L I ++  ED+  Y+CL EN  

            GQ  C A V+V E                    P F++ L  ++ + G   T+  +V G 

            P   + W     +++ +  +  + +    SL I +V   D G Y+C+A NS G V + AV

            L ++       P+F  K + V  +LG  V   C I G     V W +DG  L KD  + +

                 +V TL + +    H GQY     N +G  S    L+L

 Score =  143 bits (360), Expect = 2e-33
 Identities = 101/400 (25%), Positives = 178/400 (44%), Gaps = 35/400 (8%)

            P F+ KP S ++   ++  F+C V+G    ++ W  +   +R   G+ ++     +  L 

            +LK    D+G Y+C ASN  G+ SCS  L V+        P F   L+   +++  +F  

             +C + G+P  ++ W  +   IQ +   R +    VA L + +   ED G YTC A NA 

            G  S S  + V E                    PIF +    ++ + G+ V +  ++ G 

            PP  V W  +  E++  + +         S+ I  V   D G Y C+A N  G       

            + ++ P     P F+ K   ++  +G+ V +   I G    +V W +D   + +++ +  

            +  +E++ TL   +V+P +AG+Y   +KN  G   C  +L

 Score =  141 bits (356), Expect = 5e-33
 Identities = 118/449 (26%), Positives = 181/449 (40%), Gaps = 52/449 (11%)

            P F S+P+S      +  KF C V+G P  E  W  +G  +     +  + +    H L 

            L     +D G YSC ASN  G   C    Q E + + +  P F   L+       +   L

            +C V       +TW  +GQ +   +      E  +A L I  A  +D GTY C A N  G

              SCSA VTV E  S     ++  V PS    P             G    +  ++ G+P

              +V W  N  E+ ES         ++  L I +V  ED+G+Y+CEA N  G       +

             ++EP     P FI          G + L+ C ++G     + W +D K + + +  + +

               + +  L +        G+YE ++ N VG+C C  + +L                  Q

              + +A  RG EP S   + G  V  + G

 Score =  140 bits (353), Expect = 1e-32
 Identities = 165/790 (20%), Positives = 277/790 (35%), Gaps = 139/790 (17%)

            + + E P FI   + + + + +  + E  V G P  +VTW +N + I S  ++ L   + 

              F+L I      D G+Y C  +N  G+   +  + ++                      

                         PP F  K+            F   + G P   +TWLK +  L     

            V +S  + +  L+I  V+    G YTC   N SG     A L +Q               

                   E   ++ K   +D  E    +  C      G+P            E K++  K

            D  +  P         +++   + R+Q   +         SG+           TF    

              G  S D   +  ++ IP         P F  K    +     ++   C+VSG      

             WF +G  +        V  +  S  L +      D+  Y+C  SN  G  +CS  L V+

                  V P     + D  V        +  ++GTP  +I W  +   +          E

               + L++        G YTC   N +G  SC+  + V E                    

            P F++ L   K++  G    +  +++G+P   V+W  N +E+  S+ +      +   + 

            +  +  ED+G + CEA N AG       + V+EP     P F S P  V       V + 

            C ++G P   V W +D + L + +  +++       ++ +  V     G+Y    +N VG

Query: 802  E--CSCQVSL 809
               C C V L
Sbjct: 5597 SDTCVCTVKL 5606

 Score =  137 bits (345), Expect = 1e-31
 Identities = 113/395 (28%), Positives = 167/395 (42%), Gaps = 50/395 (12%)

            C+V+G     VAWF E T +     S   Y+   S  +C L+  + DS   G Y+C A+N

              G   C   L V+        PSF    +   V+ G++      +RGTP  ++ W    

            + +          E  VAEL + +      G YTC+  N  GQ SC+  + V E      

                       P A  FL+ LSD  V  G  + +    +G  P  V W  +G  I  SE 

             +     T    CI E+      D G Y+CE  N AG     A+++  EP     P+F++

            +   + A++G SV + C +AG P  TV W + G    + T  +      +V TLV  KV 

               +G+Y    +N +G  S +    +Q    R LP

 Score =  136 bits (343), Expect = 2e-31
 Identities = 107/403 (26%), Positives = 170/403 (42%), Gaps = 30/403 (7%)

            P F ++ +  E     +V  +C+V+G P+  V+W+ +G    R       Y       L 

              K    DSG Y+C A N+ G  S     +++     ++ PSF+  LKD     G    L

             C + G+   ++ W  +G  +   +  +++    VA L I        G Y+C A N LG

              S SA +T  E K S       P    KP +         + V+ G        V+G  

            P  + W  +  EI+   ++     G    L I +V   D+G YTC+A N  G+    A L

            +V+EP     P F+ K   S  A  G+S+ + C I+G P   V W R+   L  ++  + 

            +     V  L + +     +G Y     N VG+ SC  +L ++

 Score =  136 bits (342), Expect = 2e-31
 Identities = 119/403 (29%), Positives = 165/403 (40%), Gaps = 33/403 (8%)

            P+F  K           V+ R  V G     V W  +   V R+  +  +        L 

            L      +SG Y C   N  G   CS  L V   A +   P      +   V  G  F L

            +C V GTP     W  +G+ +        T    VA L I  A   D G Y+   +N++G

            + +C+  V+VH       S+ ++P        P F++ L D+  + G+ V +  +VSG+ 

            P  V W  +GNEI               +L +  + P DTG YTC A N AG     AVL

            TVQEP     P F   P SV    G S+  +  I G P   V W +  + L    G    

            +  ED  T L L +VQP  +G Y  L+ N  G  SC   L ++

 Score =  134 bits (336), Expect = 1e-30
 Identities = 111/435 (25%), Positives = 200/435 (45%), Gaps = 41/435 (9%)

             S    +  P   +  S+ P   +  Q   V  +   KF  + +G P+P   W  +G  + 

              Q G  ++ ED G  +L + K  T DSG Y+CT  N+ G +S S  L ++          

                 +KD    E Q    Q +   TP  +   ++  +  Q A  + E  ++E   Q+ L 

              ++  +   ++E      + S   + VHE+  K+S+ SE +   A  K  +       + 

             + + +G ++ +   ++G    +V W+ NG E+  SE++ +   G+  +L I++    D G

               TC +    G V+ Q  LT+ +      P FIS+PRS   + GQ+VL +C I+G+P P 

             + W ++   +   + +  + ++ +V++L ++      +G+Y I  KN  G+CS   SLM+

Query: 812   QNSSARALPRGREPA 826
                    LP   EP+
Sbjct: 33224 -------LPLVEEPS 33231

 Score =  130 bits (327), Expect = 1e-29
 Identities = 102/386 (26%), Positives = 168/386 (43%), Gaps = 33/386 (8%)

            V F C ++G    +V+W+ +G  + + + +++         L +L+      G Y+C+AS

            N  G  S S  L    L+  EV P F        +  G+    +C V GT   +ITW  +

             + I+     + T     A L +      D G YTC A N  G+ SCSA + V E     

                           P F++ L   +++   + T    ++ G+P  +V+W  +  EIQES

              F      +   L +  +  ED+G YTCEA N+AG   +   L V+EP     P F  K

            P  +    G  V + C + G P   V W +D + L +    ++++    + ++ +  V  

               G+Y+    N VG  +C  S+ L+

 Score =  129 bits (325), Expect = 2e-29
 Identities = 105/407 (25%), Positives = 168/407 (41%), Gaps = 33/407 (8%)

            P+F SK  S  V   +  + +  + G     V W  E   V R+  +I +        L 

              KA   ++G Y C   N  G      TL V E   ++E A   +       V  G+   

            L+C V GTP   + W  +G+ +   Q  + +    ++ L I     +D GTYT   +N +

            G+ SC+A V V ++                   P F + L +   + G+   +  +V+G+

             P  V W H   +I     +         +L +  +   D G YTC A N AG    +AV

            LTVQEP     P F+ +P  +    G++V  +  I G P   V+W R  + L K      

            +   + V  L L  +    +G+Y  ++ N  G+ SC   L ++  +A

 Score =  125 bits (314), Expect = 4e-28
 Identities = 107/395 (27%), Positives = 171/395 (43%), Gaps = 37/395 (9%)

            V+    +      +G P   V+W  +   + + E  SI + E   S  L +L++   D  

             YSC   N  GQ  C      E L  +   P F   L+    + G+   LQC V GTP  

            RI+W      ++ A   +   +  VA L I      D G Y+C A+N++G V+ SA + +

              +K        LP        P F + L D+    G  V    +++G+ P +V W  +G

              +++  +    Q    H++   ++   D    G Y C A N  G   + A L + E H+

               P+F  KP SV  +LG+S    C + G     + W +D + + +  G++++   E+  

            TL + KV    AGQY     N  G+ SC   L +Q

 Score =  122 bits (306), Expect = 3e-27
 Identities = 158/734 (21%), Positives = 285/734 (38%), Gaps = 96/734 (13%)

             G  + ++  I G PFP   W ++G+ + K      +  +E    LV+K+     +G Y++

             +L+N+ G+ +  + + +  S     P G  P   +D+    V       AD GG+D  G 

             +          W   +    VRG        +++ E   R     Q      L  +  V+

              KT L+  +    P E +D   +       +   +   +V +   ++ +     K    +

             KT +   +       PD       + ++ A+N    +ET  A + V    P       G 

             L+ +  +K + TL   KP     K             D   K ++KE +K          

                        +N+    R    T  + K   + G AP  +++++DV    G+   L CQ

             +   P   I W   GK L  ++   +S +G   ++++     ED G+Y C+A N+ G+ E

              S ++ +   P                                    P  P K       
Sbjct: 30616 TSSKLLLQATPQFH---------------------------------PGYPLK------- 30635

                 E      G ++ L     G      TW   +K +Q SE++ +EN+E+ + L +   

              R+ H G Y + + N  G+  A +++ + DKPD P G      +  +S  +SW   + DG

             GS + +Y +E  ++     W+ +++  S T+  + +L  +  Y FRV A N +G S+P +

Query: 1418  ESELTTVGEKPEEP 1431
              S +  +    E+P
Sbjct: 30812 VSSVVIIKSPFEKP 30825

 Score =  121 bits (303), Expect = 7e-27
 Identities = 105/406 (25%), Positives = 179/406 (44%), Gaps = 37/406 (9%)

            RD A P F    ++ +   N T +  C+++G     V+WF +G  +   +     + + G

            +  L +++    D+G ++C A+N+ G    S  L      +++  PSF +      V+ G

                L+ + +G+    I W    + +    S   T EA  + L +      D GTYTC  

             N  G V CSA + V E  +     ++  + PS+            LK  D +Q  +  +

            V+G PP ++ W  N  EI+ES         +   L + +V  ED+G Y CEA N AG   

              +++ V+E      P+F  + + +       V++   +AG P   + W +D   L    

             +   +Q+  V   +LK V    AG+Y+  + N VG   CS +V+L

 Score =  118 bits (295), Expect = 6e-26
 Identities = 175/807 (21%), Positives = 305/807 (37%), Gaps = 149/807 (18%)

            T P  + GL ++ V++G  VT+   +SG P P V W     +I+ S DF    +     L

Query: 681  CIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQE-------------------------- 714
             I+E F ED+G +TC A N AG V T   L VQ                           

                           P +   P+FI+KP       G SV+  C + G+P P V+W + G 

             L   TG+ ++V  N+      LV+       AG+Y I+++N+ GE S   SL L+ +  

              L + ++    +      V        + G   PG+  +  +   E+E     + + K 

             V  R + E+    QE     F + L K++     KT  E+ L+E   E+M    +    

            V+    S  + ++ + + ++   V      S  P+P        +++   +    DF   

             R+ L     LP + G  +A   N K         NA  SG     P  P+G      TL

            +P+   +   +L P   ++    +  A     +         +       +    S+ + 

               P F  K       EG+      +V   P     W  +G+ +    T  +++ ++G+ 

             S+ I  A P D G +  VA+N AG++  S  +TV+                        
Sbjct: 1514 -SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---------------------- 1550

                                +  + P  ++  ++  ++ G  +E+  + TG       W+

            K    I   ++  +++E ++  + L I +   +    YT    NK G  + + +VN+ V 

Query: 1328 VDKPDP------PAGTPCASDIRSSSL 1348
              +P+P      P GT  A +I +  L

 Score =  117 bits (294), Expect = 8e-26
 Identities = 105/405 (25%), Positives = 166/405 (40%), Gaps = 38/405 (9%)

            P F  K +S       T  F+  + G     V W  +   +   +     +E+   S YL

              ++ +    G Y C A N  G   CS  L V+  A + E A S         V +G   

             LQ    GT      W  +GQ +    +Y  S  +  V+ L I     +D G YT   +N

             +G+ SC A + V         + ++P        P F + L  +  + GS + +   V+

            G+ P  + W  +  EI  SE + F        L I ++   D+GTYTC A N AG  +  

              LTV+EP     P+F+ KP+S   +    V +   + G    T+ W +D K L      

              V +++   +L L   +   +G Y   L N VG  + + +L ++

 Score =  115 bits (289), Expect = 3e-25
 Identities = 104/403 (25%), Positives = 159/403 (39%), Gaps = 34/403 (8%)

            P F  K         QTV  +  V G     V W ++G  V R++G I++    G   L 

            +   +    G Y+C A N  G Q S    +  E   ++E A           V  G    

            L+ +V GTP  +  W  +G+P+  +   R + +  VA+L    A   D G YT    N +

            G  SC    TV ++                  AP F + L ++  +      +  +++G+

             P  V W  +G EI  S+ +         SL I  V   D G +TC A NS G   +   

            L VQEP     P F++KP S     G +V +     G    T+ W +  K L    G   

            + +     +L L  V+   +G Y   + N  G   C  +L ++

 Score =  115 bits (288), Expect = 4e-25
 Identities = 94/394 (23%), Positives = 168/394 (42%), Gaps = 26/394 (6%)

             + E Q +  +  ++G    +V W L G  +   E     Y  +GS     +K A  RD G

               +C +   +G + C + L + +   +  AP+F S  +   + EGQ+ +  C + G P P

              I W  N  PI  + +        V  L I++A   D G YT  A+N  GQ S +A + V

                         LP+   +P+  + L+   D   + GS  + +VQ+S +         + 

             +      +  F     Q    +QE F E + +      N   ++ +     ++    G  

             P   + P  ++   G+ + ++CA  G+P P V W   G+ +  ++ G F +   +D+ TL

             ++  VQ    G Y + L N  G  S  V++ +++

 Score =  115 bits (287), Expect = 5e-25
 Identities = 164/743 (22%), Positives = 263/743 (35%), Gaps = 170/743 (22%)

            F +++    + EG    F CK++G P P++ W K         R+   E+  M  L+   

                             G+AS+   + +   +    +F    K           N I   
Sbjct: 1344 ----------------DGRASLRIPVVLPEDEGIYTAFASNIKG----------NAICS- 1376

             KL  +E AA           G+P +    +P     S++ S   SPR+  ++P+     

                    R+ P   +P           R  PA   PA      PG   ++       R 

                       P F  KP S +  E QT +F  +V G P PE  WF +G  +        

            V ++ G+  L ++ A   DSG ++  A N  G+ S S  L VE +   +V P F   LK+

              + EG    ++    G P P I WL N     P +Y +   E   G A L I   + +D

               YT  A N  G+    C   V V   +   + + ++P          AP         

                          K   P F + L+ L++          +++  G+P   V WLH+G  

            ++ +            SL     +  D+G  TC A N  G   T A L V++        

Query: 715  ------------------PHDGT------------QPWFISKPRSVTASLGQSVLISCAI 744
                               H+G             +P  +  P  V    G++    C +

             G P P V+W  +G+ L + +  F V + + +  L +   + +  G+ ++  +N  G   

             +V L +Q        L R  EP

 Score =  113 bits (282), Expect = 2e-24
 Identities = 211/1044 (20%), Positives = 358/1044 (34%), Gaps = 249/1044 (23%)

             +K S RK E L     +   AP     +   +V  G      + V   P  EV W HNG 

Query: 662   EIQESE----------------DFHFEQRGTQHSLCI----------------------- 682
             E+QES                 D H +  GT  ++C                        

Query: 683   ---------QEVFPEDTGTYT-----------CEAWNSAGEVRTQAVLTVQE----PHDG 718
                      + VFPE T T              EA +S  EV++Q   T +      H  

Query: 719   TQPW--------------------------FISKPRSVTASLGQSVLISCAIAGDPFPTV 752
             +                              ++KPRS+T   G+S   SC   G+P PTV

              WLR G+ L     H +V   +   T  +  VQ    G Y ++++N  G+   + +L +Q

Query: 813   NS------------------------SARALPRGREPASCEDLCGGGVGADGGGSDRYGS 848
              +                        + ++  R + P                 +++   

             L    P +   +L+ E  +++          VL+ +  T     + +++    Q  +   

                ++    L+E D    + EI  E    + NLQ   +  K++ E+  K+   ++ D + 

Query: 955   --SVLAKKGTSKTPVPEKVPP--------------------------PKPA---TPDFRS 983
               S + +K   K P P    P                          P+P    T D ++

Query: 984   VL-GGKKKLPAENGS---------------------------SSAETLNAKAVESSKPLS 1015
             +  GGK KL  + G                            SS+  L  KA++ ++   

              + Q +  + P   A   E +     A  +E +K M  AK  E L   + ASK    EE+

             KK     +     H   T   + SE   T    K     + + EG++L+L+  ++     

              + W LNG  L  ++       GS  +++I++A   D G+  C++K   G  +C   +T+

                       + E+                SDA                 P  I  P  Q
Sbjct: 33127 ----------SKEL----------------SDA-----------------PAFISQPRSQ 33143

              +  G++V    +++G       W K    I  S ++ +  S N   L I  A     G 

             YT+  +N  G   A  +L V+   + P+          +SL  S+   S    ++ Q  S

                + S++ +   +   +  S + Q +    E    + + +  G S  +Q     S++  

              G +   PK E   SD    E +V

 Score =  112 bits (279), Expect = 4e-24
 Identities = 200/914 (21%), Positives = 315/914 (34%), Gaps = 183/914 (20%)

            +N  I EG    F  ++ GYP P++ W+++G+ I  G R+ +D    G  SL I  V  E

            D G YT  A+N  G    + +L VE   A  LG P    TL      R  +P   +R  I

Query: 156  WGE------------------------------------CPPKFATKLGRVVVKEGQMGR 179
                                                     P F  K       EGQ  R

            F  K+ GRP P+  W   G   +       V +++G Q L I      D G +T +  N 

            +G++S+S  L+++ ++      FV + K  N          I + S+L+    A  + N 

                      W  NS    P    + ++E  K        + V Q               

              T   + ++    +PEP      ++ P G  R K  A P   P      Q      D+ 

             K   ++           P F+ K  S  +K      F C ++  G P   V W  +G P

            +      + +  + G   L    A +RDSG  +C A+N  G    S TL           

Query: 503  -----------QVERLAVMEVAPSFSSVLKD---------------CAVIEGQDFVLQCS 536
                       ++E L  M    + + V  D                 V+EG+    +C 

            V G P P++ W LNGQ I+ ++       G+  L I D    D G     AEN  G +  

               + + +++  R    +L  AP  +P   +   G    +V    +   T +       E

            V+ L     I      +ESE+    F++R  +            S    E + E      

             E  +   E+  +    + E    T P F                  + +S T   G   

                 + G P P   W ++G  + +    +     ++V  LV++ V    +    +   N

Query: 799  RVGECSCQVSLMLQ 812
              GE S    L++Q
Sbjct: 2156 IAGETSSHAFLLVQ 2169

 Score =  111 bits (278), Expect = 6e-24
 Identities = 67/201 (33%), Positives = 103/201 (51%), Gaps = 4/201 (1%)

             +PP+I+  PE   ++AG+ + +   V G    TC W K   ++  S H+ V  +++ S L

              I    ++  G Y+L  EN  G+   ++ + V+D P PP      SDI + + +LSW+  

               DGGS + +Y +E  D +   W   LA+   TS  V  L+P  EY FRVRA N +G SE

             P    ++        P EPK+

 Score =  110 bits (275), Expect = 1e-23
 Identities = 73/206 (35%), Positives = 104/206 (50%), Gaps = 21/206 (10%)

           AP+F+  L+   V+EG     +  + G PVP ++W  +GQ I  +     + +   G A+

           L I      + G Y+  A N  GQ + +A + V       K+E     AP     P F+Q

            L  + V  GSQV + V+V+G P P V +  +G EIQ S DF   Q G  +SL I E +P

           ED+GTY+  A NS G   + A L VQ

 Score =  109 bits (272), Expect = 3e-23
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 57/306 (18%)

           T+AP F  P +++ + EG+TA FE  + G+P P+V+W R+GQ I++        G++ +F

           S     L I AV + + G+Y+ +ATNGSG    T EL V+   A                

                          PP F  +L  + V++G   R   ++TG P P V + +    +Q S

               +S++  +  L I     +D G Y+    N  G+A+ +AEL +QG            

           + +A  S  R+T+     +   +  ++ + E  +D   AA +     +P R   PP   +

Query: 312 SQPQPP 317
             P PP
Sbjct: 264 RSPTPP 269

 Score =  109 bits (272), Expect = 3e-23
 Identities = 65/193 (33%), Positives = 101/193 (52%), Gaps = 3/193 (1%)

             V+AG  +EL   VTG      TW K    +++ + + +EN    S +TI+ +++   G Y

              +   N  G   A V + V+DKP PPA     +D+ + S  L+W     DGGS + +Y +

             E   + ++ W +L +T + T+F    L+P+ EY FRV A N+YG  EP Q S +T   + 

Query: 1427  KPEEPKDEVEVSD 1439
              P  P   +E SD
Sbjct: 13881 DPPGPPTRLEPSD 13893

 Score =  105 bits (262), Expect = 4e-22
 Identities = 101/411 (24%), Positives = 157/411 (38%), Gaps = 48/411 (11%)

            +F    +  +V E +   F CEVS  P   V W  +   ++  +  I++ ++   H L +

               R  D+G Y+  A            +   +L V        S+ K+  VIE Q  V++

              V    V    W  +G  I +      +   E  +  + I +    D G YT +A    

                            +R S  L   AP  P     LQ L  + V  G        +SG 

            P P++ W      +       F   G +++L + E FPED   YTCEA N  G   T A 

            L+V+ P     D   P +    I+  +    S GQ     C ++G       + +D K  

             K +  F + Q ED + L + +  P   G Y  +  N VG+ S   +L L+

 Score =  102 bits (253), Expect = 5e-21
 Identities = 57/185 (30%), Positives = 97/185 (52%), Gaps = 7/185 (3%)

             +++ E  K RAG SV+L   ++G    T  W K  K++Q +  + VEN+ + + + I  A

              + + GCY L + N +GS  A + + ++DKP PP G      + +  +TL W   + DGG

             + +  Y +E  +++   W    + L  C  T+  +   +  +EY FRVRA+N YG  EP 

Query: 1417  QESEL 1421
             +   +
Sbjct: 27053 ESDSV 27057

 Score =  101 bits (252), Expect = 6e-21
 Identities = 76/249 (30%), Positives = 112/249 (44%), Gaps = 8/249 (3%)

             +PP +   ++  E   V+AG +V     + G    T  W     +I+  EH  VE     

             S LTI    +   G Y + V N  GS+   V+LTV+D P PP G     D+    +T+SW

                  DGGS V +Y +E  D+   TW  +++  S T   +  L    EY FRVRA N  G

                P  +S  T    K  P  P  +  V+D  E    V +     +    ++ +Y +E R

Query: 1470  LGSGKFGQV 1478
               +GK+ +V
Sbjct: 17744 EVTGKWVRV 17752

 Score =  101 bits (252), Expect = 6e-21
 Identities = 58/205 (28%), Positives = 104/205 (50%), Gaps = 6/205 (2%)

             PP+ +M P+   + +   V AGES ++   + G    T  W+K  +++  +  +++++++

               + L++  A +   G Y L  +N  G R   VN+ V+D+P PP G    S + +   TL

             +W     DGGS + +Y +E  +++   W  + A  ++ S  V  LL  +EY FR+ A+N 

             YG  EP +   +        P+ PK

 Score =  101 bits (251), Expect = 8e-21
 Identities = 78/253 (30%), Positives = 112/253 (44%), Gaps = 15/253 (5%)

             F +   VRAG S+ LF    G    T  W K    +  S    +  +++ S LT+    +

                G YTL VEN  GS+     + V+D P PP G     D+   S TL W     DGG+ 

             +  Y +E  +++ ++W+ ++  C    F V DL     Y FRV A+N YG  EP +  E 

                 E+P  P+  D V+ S         +P+ D         +   QK SDF+ +E    

Query: 1472  SGKFGQVFRLVEK 1484
                   V RLVEK
Sbjct: 28599 KQLTFTVERLVEK 28611

 Score =  100 bits (250), Expect = 1e-20
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 20/255 (7%)

             ++F +   ++AGE+  L   V+G  P T  W K  K+++ +  ++++ ++  + L    +

              +   G YTL   N  G  +   N+ V+D+P PP G    +++ S    LSW+    DGG

             + +  Y ++  +++   W  +A+  + T   V  LL  +EY FRV A+N YG  EP +  

              +  V     P+ PK+ EV     D        P+ D  +  IN        Y +E R  

Query: 1472  SGKFGQVFRLVEKKT 1486
               K GQ +    KKT
Sbjct: 21695 -DKAGQRWIKCNKKT 21708

 Score =  100 bits (249), Expect = 1e-20
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

             V AGE +++     G      TW K    ++++  +  E++EN S LTI  A +E  G Y

              + + N  G     +N+ V+DKP PP G     ++ + S+TLSW    YDGGS++ +Y +

             E  D++  TW+ + AT   T+     L    EY+FR+ A N YG S

 Score =  100 bits (248), Expect = 2e-20
 Identities = 76/305 (24%), Positives = 116/305 (38%), Gaps = 60/305 (19%)

            V   F S +K+  ++EG      C + G P+P+I W  +G+ I    +Y     + G A 

            L I   LPED G YT  A N  G   CS  + V          Y   L PV+  +  +P 

Query: 624  -------------------------------------------------IFLQGLSDLKV 634
                                                             +F+      K 

            ++G      ++V G P PE  W H+G +I    +     ++ GTQ SL I    P D+G 

            +T  A N AG      +LTV+      +P F+ K ++V    G  + +     G+P P +

Query: 753  HWLRD 757
Sbjct: 1588 VWLKN 1592

 Score =  100 bits (248), Expect = 2e-20
 Identities = 191/884 (21%), Positives = 315/884 (35%), Gaps = 165/884 (18%)

             G+V   A++  S  +L     +V  +PL     FI P  ++ + E   AKFE  V   P+

                 W +  Q IT   RF L+  G + +  +   A  +E +  +  E  + SG       

Query: 115   --------RQVTVELTVEGSFAKQLGQPVV----------------------SKTLGDRF 144
                     + VT +      F  +L    +                       KT    F

                +++    I  E                P F  KL      E       C+I+    P

              V W K    ++PS    +      ++L +    + D+G YTC    G+ K S   ++  

                       S++ +++    F  ET+ +  D+            +     I +E K+ S

             L       NC   Q GG    AAN +       K      L   KD   TA +T      

              S         L+  +++P  +      + P  E +      R      +    G   + 

             +K       +  +      +F    + Q V+E  T    CEVS     +V WF  GT + 

             + +   E+  D     L +      D  TY+C A + +   SC+       L V+     

             F   L D  V E +    +C +      ++ W  +G  I+  +      +  V  L I  

              L +D   Y+C    A      S  +TV E+++                  +F + L+++
Sbjct: 12435 CLLDDEAEYSCEVRTA----RTSGMLTVLEEEA------------------VFTKNLANI 12472

             +V +   + +  +VS  P  EVIW     EI E+  +     G +  L IQ    ED G 

             Y C   +S    RT   + V E        FISKP+++    G+     C+I+ + FP V

              W RD K L +    ++V+ +     LV+K       G Y +++

 Score =  100 bits (248), Expect = 2e-20
 Identities = 66/237 (27%), Positives = 109/237 (45%), Gaps = 19/237 (8%)

             MPP I    E  +V  G +V +  K+ G    T TW K        ++ +    H+    

              ++   L I  +R+   G YT+   N LG+   ++ L V+ +P PP G      + +  +

             TLSW+    DGGS + +Y IE  ++  KTW  +++  +  ++ +  LL  HEY FR+ A 

             N YG  EP        +  +PE  ++   V  + D      V   ++T+N E+   D

 Score = 99.8 bits (247), Expect = 2e-20
 Identities = 106/466 (22%), Positives = 176/466 (37%), Gaps = 63/466 (13%)

            E  + +K    PQR  S P       +P     P E+ +++             ++KT+ 

              T +   V   PR       SP     K   P             G +  ++ +A   +

              E    S+  K     ++  VK ++T   R      P P+   F +     + E  +EV

             ++ G   + +     R+          A+   +      VE   +    P+  S LK+ 

             VIEG+   L+C + G P P +TW      I+ +   + T ++G+A L I++A  ED G 

Query: 581  YTCLAENALGQVSCSAWVTVH-----EKKSSRKSEYLLP--------------------- 614
            +TC A N  G VS S ++ V      EK+++  +E                         

               P +P AP F+      K+++G  V    QV GNP P V W  +G  +     +   +

             ++  +  L I   F +D G YT    N  GE    A L  +  ++

 Score = 99.4 bits (246), Expect = 3e-20
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 4/189 (2%)

             P+ +M P+   F +   V AGE+  L   V G    T  W++  K+I+ES   +++N++ 

              + L +  A +   G Y L   N  GS+   VN+ V+D+P PP G    + + S   +L+

             W     DGGS +  Y +E  +++   W  +A+   + S  V  LL  +EY FR+ A+N Y

Query: 1411  GTSEPSQES 1419
             G  EP + +
Sbjct: 23800 GVGEPLESA 23808

 Score = 97.8 bits (242), Expect = 9e-20
 Identities = 80/318 (25%), Positives = 131/318 (41%), Gaps = 41/318 (12%)

             +E   VK+ C++    +  +V W+     +   E     YED G   L +      D GT

             Y C   N  G+ S                 C  T++      + + ++E  P F+  L +

                  G++     ++   P P +TW  +GQ I+   +        + G+ +L I     +

             D   YT +A N  G+ SC A +TV           L P        P+F + L++ +  +

             G  V   ++VSG PPP + W  +G  +    +      G   ++L I++  PEDTG Y  

              A N+AG    QA L V+

 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 69/251 (27%), Positives = 116/251 (46%), Gaps = 39/251 (15%)

            G     AS+ +   S S   +R+ +    ++P F + P ++ +  G +A FE  V G   

             ++TW ++ + I  GG + + C +  T  L I  V + D G+YTC+ATN  G    + +L

            +V+                                   PPKF  KL    V K+G+  + 
Sbjct: 6359 SVKE----------------------------------PPKFVKKLEASKVAKQGESIQL 6384

             CKI+G P+ +V+W + +  L  S + ++S  N + +L I+  + +D G Y C   NG G

Query: 241  KASMSAELSIQ 251
             AS S  L+++
Sbjct: 6445 DASCSTALTVK 6455

 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 55/168 (32%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

             VR G +V L     G    + +W+K    ++ESE ++   +EN   L+I  A++EH G Y

             T++++N +      + +  +  P  P G     +I++ S+ LSW     +GG  +  YSI

             E  +++   WK + ++   T+F V +L+ D EY+FRVRA N YG S+P

 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 134/595 (22%), Positives = 226/595 (37%), Gaps = 60/595 (10%)

             P+   ++    V  GQ  RF   +  +P  +V W    V LQ S+++  +  +G+  LEI

                + DD G Y  +  N  G+AS  A L + G D    +  R  +     V  E+T    

               +S   K   +EA++  +   S     +    + S  +    ++++S     ++  +  

               +K  +++   AAR+  +PR+    +    GE  +          PT    L    V+S

              +A  ++     + +   +  S   S E     V EN   K   E +  I K  V     

              +P R +     V           +K+  R  S   S   + +  +   + T +V+ L V

                 P  +  LK  A    +   L C V  + +    +TW  +G+ ++    +       

             G  EL I +    D G Y C      G      Q    A+ ++HEK        KS +K+

                     ++P AP       + + GL D  V   S     V+ +G P P  IW  +G  

             I +   +   +      L I +    D+G YTC   NSAG V +   LT++   D

 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 56/168 (33%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

             V+AG +V L   V G    T +W K    ++ +E +K+    N   L + +  ++  G Y

             T+  EN  GS+ A + L V+DKP PPA     + + S    LSW     DGGS + +Y +

             +  +++   W ++ AT   TS +V+ L+  HEY+FR+ A N YG  +P

 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 114/507 (22%), Positives = 189/507 (37%), Gaps = 105/507 (20%)

             K +    I+KTS + +  R  +    E  AF      + I EG     +  + G  +  V

              W  NG  +T+   +    G+ G+  +L I      D G  TC +    G  +   +LT+

                          SK L D   APA  ++P                  + EGQ   F+C+
Sbjct: 33127 -------------SKELSD---APAFISQPRSQN--------------INEGQNVLFTCE 33156

             I+G P P++ W K N+P+  S+ VS+S    +  LEI   +  D G YT    N  G+ S

              +A L +  L                 V +    V+ + S   SL+   +++S   S+ +

             +  S    ++S      E K  S      ++ Q   ++ +SSS                +

             G+ + +  E                    S   + KA  R IP         PK E+ P 
Sbjct: 33305 GISNMTQLE-------------------SSTSKMLKAGIRGIP---------PKIEALPS 33336

                + E + +   C  +G P PEV W   G  +  QE G   +        L ++  + +

             D G Y+ +  N  G  S +  + +  +

 Score = 96.3 bits (238), Expect = 2e-19
 Identities = 57/211 (27%), Positives = 97/211 (45%), Gaps = 7/211 (3%)

             P T      PP + + F +   +R GE+  L G+ +G      +W K    + E +   +

             + +     L  + A++   G Y ++VEN  GSR+    + VVD+P PP G     ++   

              + +SW     DGGS + +Y IE  +     W  + +  + T+  V  LL   +Y FR+ 

             A N+YG S+P     +       V + P++P

 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 69/265 (26%), Positives = 127/265 (47%), Gaps = 11/265 (4%)

             +G    + + +    K P      P I     D  V  GE + +          T +W K

               K+++ S+ + ++N    + L +  + +   G YT+ +ENKLGS  A +N+ V+  P P

                   ASDI  SS  L+W    +DGG+ +  Y +E  ++  +T+  + +  +  S+ V+

             DL+P+ EY FRV+A+N  G  E   E +   + + P++P D   +VEV +   +   + +

             +    +   K+  +  I E++  G+

 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 85/332 (25%), Positives = 138/332 (41%), Gaps = 31/332 (9%)

             ++A +E+ P    ++      EG      C +       ++TW    + ++ +     T 

             E GVA L+++D    D GTY C   N  G+ S  A + V               KK  R+

             ++ + L   P + T P++     +     G  V   V ++ +P P V W  +G +I+  +

             +   + FE     + L I  V  +D   YT  A N  GE   +A LTV     P D T +

             P F     +     GQSV     ++G P PT+ W +DG+ L        + +  D + L 

             ++   P   G Y +   N  G  SCQ  L ++

 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 65/220 (29%), Positives = 111/220 (50%), Gaps = 17/220 (7%)

             ++AG+++ L    + G      +W K  K I+ S+  ++ ++   S LTI  A ++  G 

             YT+   N  G++   V +TV+D P PP G    S++ +   TL+W     DGGS ++SY 

             +E  +++   W    +++ +CR  +     L+  +EY FRV A+N YG  EP Q   +  

             V    P  P ++ EVS+       V   T T++ ++ V D

 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 64/231 (27%), Positives = 105/231 (45%), Gaps = 5/231 (2%)

             VRAG S+ +F  + G      TW K    I       +EN+E+ + L I    +   G +

              + +EN  G +   VN+ V+D P P       +DI   S+TL W     DGGS + +Y +

             E  ++  K++    T C   ++ V  L    EY FRV A N YG  EP++ +E     E 

             P  P D + + D  +    + +     +   K++ +    +R GS ++  +

 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 4/186 (2%)

             PP+  M    ++F +   V+AGE +++   + G      +W K   +I+E    ++ +++

             N + LT+    +   G Y L ++N  G+R   VN  V+DKP PPAG    + + +   +L

             SW     DGG+ +  Y +E  ++++  W       + TS  V  LL  +EY FRV  +N 

Query: 1410  YGTSEP 1415
             YG  EP
Sbjct: 25963 YGVGEP 25968

 Score = 94.4 bits (233), Expect = 9e-19
 Identities = 65/215 (30%), Positives = 105/215 (48%), Gaps = 12/215 (5%)

             +RAG S+ L   V+G  P   TW K  + I  +    ++ +E+ S L +    +   G Y

             T+  EN+ G + A V + V D P P        ++   S+T++W   + DGG+ V +Y +

             E  ++A + +K + T C  T + +  L+    Y FRV   N+YG  EP + S+   V E 

             P  P  ++EV D       V   TVT+  E+ + D

 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 58/184 (31%), Positives = 91/184 (49%), Gaps = 4/184 (2%)

             V+A E +++     G    T  W K  + ++E+  + V +S+  + L+I  A +E  G Y

              L V N  GS    + + V+D+P PP G     ++   S+T+SW    YDGG  + +Y +

             E  ++ + TW  ++     TS  +  L    EY+FRV A N YG S  S+ S    V E 

Query: 1428  PEEP 1431
             P  P
Sbjct: 25583 PFSP 25586

 Score = 93.2 bits (230), Expect = 2e-18
 Identities = 60/199 (30%), Positives = 97/199 (48%), Gaps = 12/199 (6%)

             +AG  + +   + G      +W    K +K +++  H      ++E +EN S + I   +

             + H G Y++  +NK G + A   + V+D P PP      SDI   S  LSW     DGG 

              ++ Y IE      K W ++   C ST+F V DLL + +Y FRVRA N +G   P +  +

Query: 1421  LTTVGEK--PEEPKDEVEV 1437
              TT  +   P +P  ++++

 Score = 92.8 bits (229), Expect = 3e-18
 Identities = 60/220 (27%), Positives = 102/220 (46%), Gaps = 36/220 (16%)

            P F L P ++ +  G +  F+  V G    ++TW ++ + I  GG + +   +  T +L 

            +  V + D G+YTC A+N +G    + +L V+                            
Sbjct: 7271 VLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQE--------------------------- 7303

                   PP+F  KL    +VK+ +  R+ CKI G P+ +V W K    +Q S++  +S 

             + + VLE+H ++ +D G YTC   N +G AS S  L ++

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 146/682 (21%), Positives = 239/682 (35%), Gaps = 63/682 (9%)

            + P F     +L +K    A FE R+   G P   V W  +G+P+ +  R  +     G 

             SL     +  D G  TC ATN  G    +  L V  E S  ++   P   K L      

              +    ++ G       +  P        V V EG+  RF C++TG PQP+V W     

             ++ S R  V   +G+  L+I      D G       N  G      +L IQ  +   RS

             +R       +        +  E  K+D      ++K     +R          +     

             SK +   +       T V  K+          ++             + EE+K  A   

              T PT +P              +I +    ++  PK   + QSQ V +     FR  V 

            G P PE  W+  G  + R +     + +     L +      DS +    A N  G+ S 

               L V+   ++    +F+  L+D    E             P  ++ W  +G  +    

              R   +  V  L I      D   Y+C              V V ++     ++ ++  

            A  +     F++ L D++V +     +   VS    PE I   W HN  E++ +  +   

             R  + +L +++V  ED G Y+

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 58/210 (27%), Positives = 105/210 (50%), Gaps = 6/210 (2%)

             P A++ P+   + +   V AGE+  L   + G       W K  K+++E+   M+++++ 

               + L +    +   G Y L + N  G++   + + V+D+P PP G    + + +    L

             +W     DGG+ +  Y IE  +++  +W +++T  ++ ++ V  LLP +EY FRV A+N 

             YG  EP +   +T     KP  P    EVS

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 7/197 (3%)

             T +  TV+      T   + MP + I  P      AG  VEL   + G  P   +W    

              +++ESE + VE     +KLTI        G YTL ++N  G+    + + ++DKP PP 

             G     +I ++S+T+SW     DGG+ +  Y +E  D+    W  ++ +   ++F    L

                +EY FRV A N +G
Sbjct: 29897 TEGNEYVFRVAATNRFG 29913

 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 76/236 (32%), Positives = 105/236 (44%), Gaps = 16/236 (6%)

            +P+T  P  +   +N+ + EG +   E  + GYP P VTW+R    I S   F +     

            G   L+I     ED G++TC A N +G    +  L V+ S   +     V++   T   R

            F  S   V T  S+  E         P F TK     + EG    F C++ G P+P V W

             K  VPL    R  VS +++ G   L I     DD G YT +V N  G+ S SA L

 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 64/227 (28%), Positives = 106/227 (46%), Gaps = 6/227 (2%)

             +AGE V++     G  P T TW K  K +       +EN+++ S LTI    +   G Y 

             L +EN +G  + + V++ V+D P           +   ++TL W     DGGS + +Y I

             E  D+  +TW  ++  C STSF + DL     + FRV A N  G  EP + +E     E 

             P  P  ++ + D  +    + +     +    ++++  + ER G G+

 Score = 91.7 bits (226), Expect = 6e-18
 Identities = 50/166 (30%), Positives = 86/166 (51%), Gaps = 1/166 (0%)

             V+ G+ +++   ++G    T TW K    ++++  + V +S + + L+I    ++  G Y

              + V N +G + A + +  +DKPDPP G     D+ + S+TLSW    Y GG  + +Y +

             +  D+    W  + AT   T+  V  L    EY+FR+ A N YG S

 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 59/183 (32%), Positives = 95/183 (51%), Gaps = 10/183 (5%)

             KV+AGE V +   VTG       W K    I++          +V  SE  ++L+I  A 

             +E  G YT+   N+LGS    V++ V D+P PP      +DI++ S  L+W     +GGS

              +  Y I+  D++ K   W+E+  T     + +  L+P+ +Y+FRVRA+N YG S+  + 

Query: 1419  SEL 1421
Sbjct: 15588 DKV 15590

 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 63/190 (33%), Positives = 89/190 (46%), Gaps = 7/190 (3%)

             P P        PP++I       +Q ++ G+++ L   + G      TW K  +      

              + V  +  GSKL I  A  E  G Y+L VEN  GS+   V + V+DKP PP      S+

             IR  S  L+W     DGGS + +Y +E  D A+  W  L AT +  S   + L   ++Y 

Query: 1402  FRVRAINVYG 1411
             FRV A N YG
Sbjct: 17381 FRVAAENQYG 17390

 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 65/207 (31%), Positives = 101/207 (48%), Gaps = 10/207 (4%)

             PKA    +PP+I    + +KV   RA  ++ LF  + G       W   R   +  +   

             +E++ + + L +    +   G Y L VEN  GS+ A VN+ V+D P PP       ++  

             +S+TL+W     DGGS +++Y +E  +S  K +  +AT C  TS+ V  L     Y FRV

              A N YG   P++ +E     E+P  P

 Score = 90.5 bits (223), Expect = 1e-17
 Identities = 84/289 (29%), Positives = 126/289 (43%), Gaps = 32/289 (11%)

             V AG  + +   V+G  P T TW M  R   QE+    +E +   S + I   ++ H G 

             Y+LL +N+ G R+  + + V+D P  P GTP  A ++ + S  L+W+    DGGS + +Y

              IE  +S  + W  +  T    +  VQ L+    Y FR+ A N  G     + SE   + 

             E    PE P+D +EV        EV   TVT+       D       Y +E RL G+ KF

                     K T      + +     KE +     +S +N +   K   C

 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 55/184 (29%), Positives = 93/184 (50%), Gaps = 4/184 (2%)

             +RAG S+ LF  + G       W K   +I+++  + V +S   + L +    +   G Y

             TL +EN  G++ A V + V+D P PP      ++I   S++++W     DGGS +++Y +

             E  ++  K++  + T C   S+ +  L     Y FRV A N YG   P+Q ++   V E 

Query: 1428  PEEP 1431
             P+ P
Sbjct: 23131 PQPP 23134

 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 67/250 (26%), Positives = 113/250 (45%), Gaps = 15/250 (6%)

             P   P      +++++P+   D++ + G  V   G +  T PI       C W K  + I

               S+   +  SE  ++L I  A +   G Y L++ENK G +   + + V+  P+ P G  

                DI+  S+ +SW   + DGG+ +  Y +E  +     W  + +  R TS  V+ L  +

              EY FRV A N +G S+P +  E  T       PE P +  EV D  +    + +     

Query: 1455  NTEQKVSDFY 1464
             +   +V+ +Y
Sbjct: 30356 DGGSRVTGYY 30365

 Score = 89.4 bits (220), Expect = 3e-17
 Identities = 55/193 (28%), Positives = 93/193 (48%), Gaps = 5/193 (2%)

           AP F Q L  + V++GS  T    +SG P PEV W  +G  I  S            +  

           L I  V   ++G Y+ +A N +G+  + A L V+   +   P F+ + +S+T   G  V 

           +   + G P P V + RDG  + + +  F++ Q  D+++L++ +  P  +G Y +   N 

Query: 800 VGECSCQVSLMLQ 812
           VG  +    L++Q
Sbjct: 182 VGRATSTAELLVQ 194

 Score = 89.0 bits (219), Expect = 4e-17
 Identities = 94/390 (24%), Positives = 154/390 (39%), Gaps = 52/390 (13%)

            Q++   P     P+   V E +T +FRC V+G P+P+V W+L G  +R+ +     Y+  

            G HYL ++  ++ D+G    TA N +G +     L++++         F SVL+      

             +  V     LQ  V+    P        +  L   + I + +   E+   EL  +    

             + G Y  +              E  L +       W      E+K +   E  + +   

            KP          AP   + +    V  GS     V+V G P PE  W  NG +I+ S+  

            + +        L I++V  ED+ +   +A N AGE  + A L VQ     T   F  + +

             V A    ++        +PF  V W +DG

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 69/286 (24%), Positives = 118/286 (41%), Gaps = 46/286 (16%)

            P F ++L+ V V +   + L+C+V+  PP  + W  N + ++++K   L+   S+ ++ I

             K  P D G Y+C+  N+ G   CS +V + + P+     ENT      S   +S++   

Query: 1211 PPVLGT-------------------ESDATVKKKPAPKTPP------------------- 1232
            PP+  T                   +S AT++ +                          

                 P QI++  +   V   + + L   V GT  +   W+K  KQI  S +  +    N

             +   I +  ++  G YT  VEN  GS      L V+D+  PP+ T

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 62/207 (29%), Positives = 97/207 (46%), Gaps = 11/207 (5%)

             PK  + P  I      +    VRAG  + LF  V G      TW K      +++ +   

             V+  +  + L I  + ++  G Y+L + N  G +   VN+ V+D P P +     SD+  

             +S  +SW     DGGS V  Y +E  ++  KTW  +    + TSF+V +L+P +EY FRV

              A+N YG   P+   +     +   EP

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 11/211 (5%)

             P   P    P  I+  PE +          +RAG ++ L+  V G  P   TW K    +

             ++   + +++++  + L      +   G Y L +EN  G ++  + + V+D P PP    

                +I   S  ++W     DGGS + +Y ++  D+  K+W  + T C  TSF V +L   

               Y FRV A N YG  +P +  +     + P

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 66/230 (28%), Positives = 106/230 (46%), Gaps = 15/230 (6%)

             PP+I    + +KV   RA  ++ LF  + G       W K    +  ++  ++E + + +

              L I    +   G Y L +EN  GS+ A VN+ V+D P  P       +++  S+TLSW 

                 DGG+ + +Y +E  ++  K +  +   C  T+F +++L     Y FRV A N YG 

               P++ +E   V E P  P     V        +V   T TI  E+  SD

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 56/184 (30%), Positives = 89/184 (48%), Gaps = 4/184 (2%)

             VRAG S  +     G      TW   R++ + ++ +++E   N ++L+I    +   G Y

              L +EN  GS+ A V + V+D P PP       ++R  S  L W     DGG+ V++Y I

             +  +S  K +  +++ C  TSF V++L     Y FRV A N +G   P +  +     E 

Query: 1428  PEEP 1431
             P  P
Sbjct: 24213 PSPP 24216

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 46/168 (27%), Positives = 85/168 (50%), Gaps = 1/168 (0%)

             ++AGE +++   V G      +W+K  + ++++  + VE +   + L I    ++  G Y

             T+   N  G+    +++ V++KP PP G     ++ +  + +SW   +Y GG  + +Y +

             E  D+   TW  + AT   T+  +  L    EY+FR+ A N YG S P

 Score = 86.7 bits (213), Expect = 2e-16
 Identities = 66/269 (24%), Positives = 109/269 (40%), Gaps = 60/269 (22%)

            P F QK   V   +G  ++LQC++S  PP  ++W  + K ++ +K   ++ +    S+ I

                  D G Y C A N+ G   CSC V                                
Sbjct: 6518 LNLEASDVGEYHCKATNEVGSDTCSCSV-------------------------------- 6545

                           K   PP+ ++   D     G++VEL   V G QPI+  W+K R +

             I+ESE+ ++   +N + L + +    + G Y   ++N  G R+    LTV      ++K

            P+P     G P A +     +  L+  W+

 Score = 85.9 bits (211), Expect = 3e-16
 Identities = 73/292 (25%), Positives = 125/292 (42%), Gaps = 41/292 (14%)

            G+   VA  + S  +L V+          E P  +   + + ++ G  A+F   + G P+

            P+++W++  Q +++G +  FL D      ++L++     ED   YTCEA N  G    + 

             L+VE                      P V +        PP   T L   V  EGQ  R

            F C+++G    +V+W   +  ++PS    +++      LEI     +D G YT +  N  

            G+ S +A LS++    A  S + E      ++  +   VI +  K++ LE A

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 64/210 (30%), Positives = 99/210 (47%), Gaps = 11/210 (5%)

           P F    QS  V E  T  F   +SG P PEV+WF +G  +       +++    G   L

            +      +SG YS  A+N  GQ     T   E L   E A P+F   L+   V +G   

            LQ  V G P P + +  +G  IQ +   + + E  +  L I +A PED GTY+  A N+

           +G+ + +A + V   E+  ++K++ ++  A

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 60/221 (27%), Positives = 94/221 (42%), Gaps = 31/221 (14%)

            P F+L P +    EG TA+F+ +V G P P+  W  +GQ I +     +     GT SL+

            I      D G++T  A N +G   ++V LTVE                       AVE  
Sbjct: 1517 IVPATPSDSGEWTVVAQNRAGRSSISVILTVE-----------------------AVE-- 1551

                 +  P F  KL  V +KEG       + TG P P + WLK +  + P    ++ + 

               G   L+I      D   YT   +N +G+ +   +++++

 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 46/155 (29%), Positives = 76/155 (49%), Gaps = 1/155 (0%)

             + G    + +W K    +     + VE+S   + L +   ++   G YT+ ++N  G+++

               +++ VV KP  P G     ++ + ++TL W     DGGS + +Y +E  DS N  W  

              A+  + T+F V  L    EY FRV A N YG  E

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 53/182 (29%), Positives = 87/182 (47%), Gaps = 4/182 (2%)

             PP+I    FP     VRAG ++++   ++G      T  +    ++ +     E +    

              + +  +     G Y +   N  G+ +A +N+ V+D+P PP G    SDI   S+TL W 

                YDGGS V +Y +   +++   W E+ AT   T   V  L    EY+FR++A N +G 

Query: 1413  SE 1414
Sbjct: 26653 SD 26654

 Score = 83.2 bits (204), Expect = 2e-15
 Identities = 49/183 (26%), Positives = 90/183 (49%), Gaps = 5/183 (2%)

             P I++F  +      +++GES+ +   V G      TW K   +I++  +M++ +    +

              L +  A ++H G YT+  +N  GS +A++ + V D P    G    ++I    +TL W 

                 DG + +  Y IE  +++   W  +   C + S+    L+  +EY+FRV A+N +G 

Query: 1413  SEP 1415
Sbjct: 28135 GRP 28137

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 112/474 (23%), Positives = 180/474 (37%), Gaps = 54/474 (11%)

            H EE+  QQ   +  +++    ++S   ++E   +  PA +      + + VKP+ +   

            SE   K    + +   S + K     T     V   P+ A+P F      K  +P     

              A    +      K LS    +   + +  +  A T+KP      AE   L     A  

             +  KS +  E+KK+V   +       GTT  E+R E                       

            T P     L++V V EG+ + L+C +S  P  T+ W      ++++    ++ +  +  +

             I +A  ED G + C A N+AG    SC   V V +    E T   E  +   K  +   

                +D ++ ++ A    P A   P  I  P  QK+  G SV    +V G       W K

                +      KV  N + G  KL I     +  G YT++V NK G   A  +L

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 94/368 (25%), Positives = 148/368 (40%), Gaps = 59/368 (16%)

            ++G++ +   K + +P         Q+V E   V+   +VS +   E  W  +G  V+  

            +  + +  D  SH L +      D+G YS T       L  S + +V   +V  + P   

              LKD  VIEG   VL+C V    V  + W LN + I+     ++  +     L I    

              D G Y  +    +G+V  +  ++V + K                     ++GL DL  
Sbjct: 2509 ASDEGPYKLI----VGRVETNCNLSVEKIK--------------------IIRGLRDLTC 2544

             +   V   V++S +   +V+W     EI+ S  +  E  G  + L +  +  +D G YT

                  AGE  T   LTV           ISKP    T +  Q  +  C +A +P     

Query: 754  WLRDGKAL 761
            WLRDGK L
Sbjct: 2652 WLRDGKHL 2659

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 61/234 (26%), Positives = 96/234 (41%), Gaps = 46/234 (19%)

            P F ++L+ V  A  KK+ L+CQV  D   T+ W+ +G+ L   K   +  E  + ++ I

              A  +D G Y C A N+AG + CS  VTV + P                          
Sbjct: 3704 PLAKLKDSGTYVCTASNEAGSSSCSATVTVREPP-------------------------- 3737

              + VKK           + P  +  P       GES  L  K+ G+  I  TW K  K+

            + ES  +++    + + L I   + E  G Y+    N +GS      + + + P

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 101/443 (22%), Positives = 165/443 (37%), Gaps = 57/443 (12%)

             D E R++ +   AP  K   QD+ V  GK L +     + P A   W    + L T    

               +++ S   +  +K    D+G YK V +N  G+AE    + V D P             

                    PV   E   T   +               +    ++ +  G S ++ G V   
Sbjct: 13092 -------PVRNLEVTETFDGE---------------VSLAWEEPLTDGGS-KIIGYVVER 13128

             + I   TW+    + +  E       + G +     + +   G    +  +N + +R   

                   D P PP      +D+    ++L+W    YDGG+ + +Y IE+ D  +  W    

             T R+   S  V D++   EY FRVRA N  G  +PS  +    V +  E P   V ++  

             D+ +  V  +      +        I ER   GK   +    +LV + T KV       K

             +    SA+ K  +     I+  L

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 53/185 (28%), Positives = 85/185 (45%), Gaps = 4/185 (2%)

             V+AG S  +     G       W K    ++   +  V+ +++ + LTI  A +   G Y

             TL ++N L +    + + V+D P PP       D+   S  LSW     DGG+ V++Y I

             E  +++ K W  +   C   S+ V +L     Y FRV   N +G   P++  E   + EK

Query: 1428  PEEPK 1432
             P  P+
Sbjct: 26375 PSPPE 26379

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 62/203 (30%), Positives = 92/203 (45%), Gaps = 4/203 (1%)

             E + S  SE + P +     AP F + L +L V   S  T+  +V+G+P P V W   G 

             EI  +   +  ++ +G  H L I  V  +D   Y   A N  G V   A L V+ P    

              P  +    +V A  G+ V I    +G P P + W + G+ L  + GH++V+      +L

             V    V+   AG Y +  KNR G

 Score = 82.0 bits (201), Expect = 5e-15
 Identities = 70/273 (25%), Positives = 106/273 (38%), Gaps = 32/273 (11%)

             R D+M L E P  F LP  N     G   +F   +  +PEP VTW+++GQ I  G    +

             +  +   +G + L I++V  +D  +YT  A N  G      +LTV       L  P    

             TL                    P F   L     +EGQ   F  +++G P P + W K  

              PL     +  + E      L I     +D G Y     N +G  S  A L ++ L    

             + F +  +     V+K++   +     L   E+

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 59/221 (26%), Positives = 100/221 (45%), Gaps = 7/221 (3%)

             V+AG+++ L   V G       W K +    +  S  +K++   + SK ++  A++   G

              Y +   N  GS  A   + V+DKP P        D+ S   T+ W     DGG  +Q+Y

              +E  ++    W    AT  +    V  L+  +EY FRVRA N  GT  P++   +   T

               +KP  P D  EV+   ++E  V +     +  + ++ ++

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 53/193 (27%), Positives = 89/193 (46%), Gaps = 4/193 (2%)

             AP   + + D+    G    ++ Q+ G P P++ W   G E+ +S  +     G  H+L 

             +     ED G YTC A N  GEV T + L +Q       P +  K +   A +G ++ + 

                 G P P + W   G+ L +++ +  +   E    LV+K VQ   HAG+Y++ L N  

Query: 801   GECSCQVSLMLQN 813
             G     + + +Q+
Sbjct: 30709 GTVDAILDVEIQD 30721

 Score = 81.3 bits (199), Expect = 8e-15
 Identities = 94/402 (23%), Positives = 159/402 (39%), Gaps = 55/402 (13%)

            F  + Q    KE  T+  F CE S  P  +V W+ +G  V   +    ++ D   H+L +

            L   T D+  YSC     +   + +      +L V      F   L+D  V E     L+

            C V    +    W  N   ++       T   G   L ++D   ED G Y+ + +     

                       KK++ K +        KP     LQGLSD KV +G  V + V+VS    

             E +W+ +G E+Q S+  H       H L I+++  ED G Y+        +++G V   

            +V              I+  + V    G   ++ C ++     +V W  + + + K    

             + +       LV+ +      G Y++++  RV E +C +S+

 Score = 80.9 bits (198), Expect = 1e-14
 Identities = 171/811 (21%), Positives = 301/811 (37%), Gaps = 112/811 (13%)

             + E ++  F  E+S    P   W L+G  + R   + E+  + G  +L L K +   +G 

                 A NA         +    L V E+   F+  LKD  V E +    +C +  T    

             + W      I+ +         + HI    D+  +D G YT   E    + S   +VT  

               K                    F+  L D  V +G   T   ++S +    V+W  N  

             ++  S        G  H L ++EV  +D      +      E+ + A L V E      P

             +F  K    TA     + + C ++ D    V W +DG+ +      + +  +     L +

             KK      G+Y          C C       N +  A L +  +P    ++  G      

              +    D +G     W  +GQ      D E +    K  +         T + + +A   

             +    L  ++L    +    LS  D+K    ++  F   + R+  PKT     R +   Q

             ++  D R  L K GT  + V +       A   F +      +    +G    E +  K 

             +   K ++  +    +  V  +     +K   N +   T + + + + +    S + ++L

               D  + +  +    G +   K +  +G  P F  KLQD    E  +++LQC++S    A

              + W  +GK +K +K  ++  +G    + ++KAL  D G Y C    D G  + S ++ +

             +D          E+K  RP  S+  V+ TE+
Sbjct: 12103 EDR---------EIKLVRPLHSV-EVMETET 12123

 Score = 80.9 bits (198), Expect = 1e-14
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 9/209 (4%)

             PPKA +  ++    +   +RAG  + L   V G       W K  K++   E + ++ + 

               +   I    +   G YTL V+N  G++   V + V+D P  P G    S +     TL

             +W     DGG+ +  Y +E  +++   W  +   C + S+ V  L+ ++EY FRVRA+N 

             YG      SEP       T+   P  P++

 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 54/230 (23%), Positives = 92/230 (40%), Gaps = 47/230 (20%)

            P+F +KL+DV+   G  ++L+C+VS   P ++ W  +G  + +      S   ++C++++

                P D G+Y CVA N AG  ECS  +TV + P+ E T                     

                                      P+  +V  G S+     + GT P    W K  ++
Sbjct: 6840 --------------------------PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRE 6873

            +   E   +   +  ++L +   +    G Y+ LV N  GS     +L V

 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 1/163 (0%)

             +AG+++++   V G    T TW K  + +++++ +  E +   + L I    +   G Y 

             L   N +G     + + V D P PP G     ++ S  +T SW     DGG  + +Y +E

             +  + + TW ELA T   T++    L    EY+FRV+A N YG

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 39/112 (34%), Positives = 62/112 (55%), Gaps = 1/112 (0%)

            EED  +     ++E +  V+  F   I++  ++EG    F CK+ GYP P++ W+KD + 

            I+    +Q+D+ +DG  SL I  V  +D+  YT  A N  G A C+ +L VE

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 157/770 (20%), Positives = 278/770 (36%), Gaps = 117/770 (15%)

            P +++  P  EAP      ++  + +G+ A F  RV G P+P+  W++NG  I    R  

                      LVI  V  ED      +A N +G       L V+   AKQL         

                                  F  +L  VV KE   M  F C+ T  P  +V W K  +

             +    +  +     +  L I  ++  D   Y+C++V        +A+L ++G   A   

            FV+E +          E+  ++S E+       + +E  +  K   + +RG       + 

              +   E       K  +CK   +  P   +LQ  S     +   VQ E +       GV

                G+E  +P+         +   L  +D+  + A      IP  G   S      S  

                +K+   ++       C+VS      V W+L    + + +  ++         L + 

            +    D G Y        G++  +  L VE++ ++         L+D    E Q+ V + 

             +  + +  + W    + I+ +   +      + +L + + + +D G YT  A    G+ 

              S  +TV               A SKP        L+D  V +  +     +V+ NP  

            +  WL +G  +  + +   E  G +  L I     +D G YT +   S    +T A L V

            +          I K  +++T +  Q  + +  +       V W+++G  L

 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 59/265 (22%), Positives = 102/265 (38%), Gaps = 48/265 (18%)

            +  CK  +   +D    S +    P F +KL D+    GK++ LQ  +    P +++W  

            + G+ ++ +  I +S   ++ ++   +  P + G Y C  KNDAG  EC   ++V +   

                                                        P  I++ PE  KV  G
Sbjct: 7585 --------------------------------------------PATIVEKPESIKVTTG 7600

            ++  L   V GT  ++  W K  K++      K+      S L I+       G Y+  V

            +N +G      +L V D+  PP+ T

 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 57/207 (27%), Positives = 88/207 (42%), Gaps = 10/207 (4%)

             P+F     ++     + V+F   ++  P+P V W+  G  ++  +   +     D G + 

             L +    T D   Y+  A N  G+ SC   L V          + P F  +L +    EG

             Q    +  V G P P + W  +GQP+    +      G+    LHI+D LPED G Y   

             A N  G  SC A + V E+   +K E+

 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 67/283 (23%), Positives = 111/283 (39%), Gaps = 60/283 (21%)

            + Q   P+F ++L+DV    G  ++  C +S   P ++ W  +GK LK +  +  S   +

              +++I K      G Y C A N  G A  S ++ +     +E    P    R     L 

            PV     DA V                             GES +    VTGTQPI  +W
Sbjct: 8161 PV-----DAVV-----------------------------GESADFECHVTGTQPIKVSW 8186

             K  ++I+     ++   EN + LT+L   +   G YT    N++G       L + ++ 

Query: 1332 DPPAGTPCASD----------------IRSSSLTLSWYGSSYD 1358
             PP+ T   S+                  S  +T++WY ++ +

 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 68/246 (27%), Positives = 109/246 (44%), Gaps = 42/246 (17%)

             +P+  TPP  A+ P  I  P+       +V+ G+ + L   ++G+   T TW+K      

Query: 1277  -----------------QIQESE--------HMKVENSENG-SKLTILAARQEHCGCYTL 1310
                              ++QE E         + ++NS+ G S+L +  + +   G Y +

              VEN  G  +A   ++V+D P PP       DIR +S+   W     DGGS + +Y++E 

              D    +  W  + +T R   ++V  L+   EY FRVRA N +G   P     L  V + 

Query: 1428  PEEPKD 1433
             P  P D
Sbjct: 14899 PFGPPD 14904

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 164/786 (20%), Positives = 281/786 (35%), Gaps = 119/786 (15%)

            I P +++ + EG  A  E +V       V W+ N + I    R  +   ++GT   LVI+

              H  D G Y        G  +    L+VE                              
Sbjct: 2506 RTHASDEGPYKLIV----GRVETNCNLSVEKI---------------------------- 2533

                   K    L  +   E Q   F  +++      V W   +  ++PS++  +     

            +  L +  + +DD G YT      +G+   S +L++ G  + ++    +T A + +    

             EV N  SK   L   +    + N  S   G        A           K+ + K S 

            +   +   ++KT  ++T+   +          P   G+     GV+  S E+        

              +   +   +  + V      R +    +      K   KP+     EN TV F   VS

                P V WF +   ++  +    +  +   H L L      D+G Y+       GQL C

               L VE L +       +  +K+  V E +    +C V    VP + WL NG  I+ + 

                  +  + +L I +   ED   YT +  N   QVS +  VT                

                   PI +   L D+   +   +T  V V+        WL NG EI+ ++      +

               HSL I+ V   D   YT      AG+  + A L V+  H      F    + +    

             +  +  C ++ +P  TV W++D + L + T   ++ + + V  L++   +   AG+Y +

Query: 795  LLKNRV 800
            +    V
Sbjct: 3130 VAGGNV 3135

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 56/212 (26%), Positives = 97/212 (45%), Gaps = 7/212 (3%)

             P T   A + P   +  F +  +V     + +    TG    T TW    K ++  + +K

             ++     ++L I  + +   G YTL +EN++ +   ++++ V+ +P  P       DI  

              S+ L+W     DGGS +  Y +E  + + KTW K +       F V DL+   EY F+V

              A N  G  EP+   E   ++T    P+ P++

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 69/335 (20%), Positives = 137/335 (40%), Gaps = 41/335 (12%)

             PA  ++L  V  ++   +L   +   D  + I   L     K + F + +      + ++

             E+ + +    ++  AKNDAG +E                         P+ +   V+   
Sbjct: 28606 ERLVEKTEYEFRVKAKNDAGYSE-------------------------PREAFSSVI--- 28637

                 +K+     T     +  Q+I        +AG    +   ++G      TW     +

             ++E++ + +  +++ + LT+  + +   G Y L +EN  G +   V + V+ +P P  G 

                S + + S  LSW      GG+ + +Y +E  +S    W+ + ++ + T   V  L  

               EY FRV + N +G S+P + + +  + E P  P

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 85/361 (23%), Positives = 146/361 (40%), Gaps = 24/361 (6%)

            S+DVV    +      G  + A P F +KP  Q++ E  +V F C+V G PKP V W   

            G P+       +   +  G   L +      D+G Y+    N  G+ S S +L +E    

              +  S   +L    V     FV +  V G   P   +    +  +  ++     +A+  

            + ++  + +     +   E  + ++      T  E+  +   + +  + ++ S+     F

               + + ++++G  VT   ++SG P P++ W  +G  I+  E +   F Q G + SL I 

             V PED G YT  A N  G       L V+       P +I             PRSV+ 

Query: 733  S 733
Sbjct: 1413 S 1413

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 62/218 (28%), Positives = 93/218 (42%), Gaps = 32/218 (14%)

            E P FI P  ++    G  A  + +V G PE +++W++    + S   + +        S

            LVI+ V   D G+Y+C+A N  GA   +  L ++   A++L                   

                     PP FA KL  V    G    F C+I G    QV+W K  V L+  A +  S

              + +  L+I   +Q  +G Y C   N  G AS SA+L

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 81/346 (23%), Positives = 127/346 (36%), Gaps = 63/346 (18%)

             P  K       V  G+ L ++  +S  P  TI WT +G  LK T  I ++    L ++SI

             ++   +D G Y     N  GQ   S ++   D P  +  K P                  

              D + +       PP      QI  +   ++                   T  W      

             +  +  +KV   + G++             + +  EN+ G   A  +  +V      +P 

             PP GTP A+ I   S+ + W+    +GGS V  Y +E       +W   NKT        

              T F  Q+L    EY+FRV A N+ G  + S+ SE     +  + P

 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 66/242 (27%), Positives = 101/242 (41%), Gaps = 22/242 (9%)

            +  SLSV+   V S    MP+   PA I P ++    EG  A+F+ RV G  + +V+W+ 

              + I    RF        T+ L I   + ED G YT  A+N  G    T  L++E    

                       L +R     +E    +  +  P    K+  + V  G + +F+C+I   P

              +  W K    +  S + S+     +  LEI      D G YTC   N  G  S +A L

Query: 249  SI 250
Sbjct: 3544 TV 3545

 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 85/383 (22%), Positives = 150/383 (39%), Gaps = 47/383 (12%)

             F + L+D  V E    +  CQ+S +  A + W  NG+ +K  K     ++GS+  + I+ 

                +D   Y C  ++   +A    + + V+         +AP ++     E+   +    

Query: 1207  --KSSLPPVLGTESDAT-----------------------VKKKPAPKTPPKAAMPPQII 1241
               ++++  V G +                           + K    +   + A  P+I 

                +D  V  G+ + +             W K  + +       ++ +   +   IL A+

             +   G Y ++++NK G  +  +NL V+D P P       ++     ++L+W     DGGS

              +  Y +E  D   KTW  LAT R+ S  F V  L     EY FRV A N  GT EP + 

                     K + P   + V+  D

 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 43/138 (31%), Positives = 66/138 (47%), Gaps = 2/138 (1%)

            S TG+       E L   E  V++        E P   P     ++++ V+EG +   +C

             I GYP P V W+++D  I  S  FQI + + G   L+I +   +D  ++TC AVN  G 

             + +  L V+  EE E E

 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 62/234 (26%), Positives = 97/234 (41%), Gaps = 48/234 (20%)

            P+F + L+   +  G   LLQC+VS   P  I W  + K ++++K   L  + SL  + I

                  D G Y+CV  N+ G  +C C  T                               
Sbjct: 3891 FSFNSADVGEYECVVANEVG--KCGCMAT------------------------------- 3917

                +K+            PP  ++  +D     G++V L   V G++PI+ TWMK ++ 

            I+E   +K+  S   + L I   +    G YT L EN+ GS Q  V   +V +P

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 89/411 (21%), Positives = 156/411 (37%), Gaps = 69/411 (16%)

             N++P ++LK   +E +  D +  +  +  +A G ++  + SE+         P    +  

             D+ V EG+KL +     + P  T+ W  +GK +K +  + +  +     + + K++  D 

             G+Y    +N  G A  S  V V   P        ++K+              SD T    

                  PP+                             G  PI   ++  R++     ++ 
Sbjct: 14497 KLTWEPPE---------------------------FDGGTPIL-HYVLERREAGRRTYIP 14528

             V + EN    T+          + +   NK+G  +     N  +   P  P   P   ++

              +    ++T++W    YDGGS +  Y IE      + WK    C        ++  + L 

                EY+FRVRA N  G SEPS+ +  T   +  + PK      +EV   DE

 Score = 74.7 bits (182), Expect = 8e-13
 Identities = 69/308 (22%), Positives = 120/308 (38%), Gaps = 73/308 (23%)

            P F      V   +  ++ L+C++S  PP  ++W  + + L+++K   ++ +    S+ I

                  D G Y C A+N+ G   C C                                  
Sbjct: 5577 LNVDTSDIGEYHCKAQNEVGSDTCVC---------------------------------- 5602

               TVK K           PP+ +       V AGE  EL   + G QPI   W+K +++

             I+ESE++++   EN + L    A   + G Y   ++N  G R+    L       +V+K

              P     G  C  + +   +  L++ WY              S Y+  S+++  S+E  

Query: 1372 DSANKTWK 1379
            D+   T++
Sbjct: 5770 DAGTYTFQ 5777

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 59/236 (25%), Positives = 93/236 (39%), Gaps = 29/236 (12%)

            PA    LQD   +EG+    QC+VS      + W    K +K ++F  ++Q      + I

             +A PED G Y  VA N  GQ   +  ++++                 P+S L   +  E

             +  +K  P  K               E  +V  G   +   ++     +   W K  ++

            I ES+   + +S+  S L IL  +   CG YT    N+ GS      LTV +   P

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 90/389 (23%), Positives = 159/389 (40%), Gaps = 47/389 (12%)

             VKE Q V F CEV+     +  WF     +      I + +D   + L +  A   D   

             Y+ + +N +G+ +  +  L VE   +  V P     LKD   +E +     C V    V 

              + W  NG+ + +            H   I+D    D G Y                VT 

              + KS   +E L+  AP++     F++ L D  V +      + Q+S      V W  NG

              EI+E + + FE+ G+ H L I++   +D   Y C       + +++A L V+E P +  

             +P     P+ +  + G  V+    +  D    V WLR+   + +   H +++    +  L

              +  ++P   G+Y  + K++      +++

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 82/367 (22%), Positives = 148/367 (40%), Gaps = 49/367 (13%)

             V+V  G  L +   +S  P   +  + +G  LK T            ++++++++  D G

              Y+  A N +G  +    + V D P                   P V+   TE   T+K 

             +P PK    + +   I+       ++   S  ++ +V+ T  +  T MK  K     E+ 

                 +EN                    + + + S    V L     P PP+ TP  +++ 

               S+T+ W+    +GGSAV  Y +E+ D  +  W++      R+T F V  +     Y+F

             RV A N  G  +PS  SE     +  E P++ V ++D  +    + ++    +   K++ 

Query: 1463  FYDIEER 1469
              Y +E R
Sbjct: 26802 -YIVERR 26807

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 87/395 (22%), Positives = 147/395 (37%), Gaps = 84/395 (21%)

            P+F +KL+ +   +G  + L+C V+   P +I W  + + +  ++    S   +   + I

             +    D G Y C A N AG  +CS  +TV +                            
Sbjct: 4735 SQLEGTDSGTYTCSATNKAGHNQCSGHLTVKE---------------------------- 4766

                               PP  ++ P+ Q V     V+L   V GT P+T  W K  K+

            +       V   +  + L + AA+    G Y   + N +G+  ++  L V      + KP

             P         T     I  +  + +SWY    DG   +A+Q + I   D        LA

            T     F +     ++   +   A N  GT+  S E ++    T + E KP E     +V

            E+  +    P  +   +  N E + S  Y + +R+

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 12/174 (6%)

             R+++ ++    +++   G+ L +   ++     + +  EN+ G      S +     T +

             + P+PP+  P   D+  SS++LSW     DGGS V  Y IE  +++   W         +

             T + V  L+PD EY+FR+ A N  G SE S  SE        +KP +P  E+E+

 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 5/197 (2%)

             P+ PP   +    +      ++ AG+++ +   VTG    T  W K   ++ + + + ++

             N    S+L I  A ++  G Y +   N  GS+ A   + V D P P          R   

             L L+W     DGGS +  + IE  D+   TW++      +  ++  LL   EYKFRV A 

             N +G   P +   +  V
Sbjct: 15273 NKFGCGPPVEIGPILAV 15289

 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 59/235 (25%), Positives = 95/235 (40%), Gaps = 48/235 (20%)

            P F +KL+   VA +G+ + L+C++S  P   + W  N   L  +    +S   S+  ++

            I +A  ED G Y C A N  G A CS  +TV         KAP + +++P          

                           P  A+               G  V L  +++GT P    W+K RK
Sbjct: 6466 ---------------PVGAL--------------KGSDVILQCEISGTPPFEVVWVKDRK 6496

            Q++ S+  K+ +    + L IL       G Y     N++GS     ++   + P

 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 103/475 (21%), Positives = 169/475 (35%), Gaps = 98/475 (20%)

            A NG   A    A  V++  P+   +PS    PVG  K ++ +    +    P E +  K

                 +  +  K  SK          L+     + +CK  +   +D    S      P F

             +KL D     G  + L+  V    P +++W  + G+ ++ ++   +S   ++ ++ +  

                + G Y C  KNDAG  ECS  +TV +                              
Sbjct: 6614 PEASNSGKYICQIKNDAGMRECSAVLTVLE------------------------------ 6643

                             P +II+ PE   V  G    L   VTGT  ++  W K  +++ 

                  +      + L I  A     G Y+  V+N +G     V++ V D+  PP+    

              D+                S+ +++ W+    DG   V     +   S N        C

               + N+  L P     +   A NV G+ E    S + TV E P  E+  D VEV

 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 42/114 (36%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

             +D P PPA    A D   SS+TL W    YDGGSAV  Y +EI     + W  ++T    

             R+T + V +L P   Y FRV A+N  G  EP + +E     +  E P+ +++V+

 Score = 71.2 bits (173), Expect = 9e-12
 Identities = 63/276 (22%), Positives = 108/276 (39%), Gaps = 48/276 (17%)

            G     AS+   K S S        + + E P FI  L P  + +K+    ++E ++ G 

            PE +V W+++   I    +F +   +     L +H +  ED G YTCEA N +G+   + 

             L V+                                   PP F  K   +   +G    
Sbjct: 7392 SLKVKE----------------------------------PPIFRKKPHPIETLKGADVH 7417

              C++ G P   V+W K    L+   +  +  +N +  + I  V+  D+G Y C   N  

            G  +    ++++    A   FV++    ++ V KEV

 Score = 71.2 bits (173), Expect = 9e-12
 Identities = 52/180 (28%), Positives = 81/180 (45%), Gaps = 19/180 (10%)

             P T  W++  K   +    +V+   N  K             + +L EN  G  +   + 

               + + D  DPP   G P   D+  +S+ L+W    +DGG+ ++SY IE+  +    W  

             +A    +T   +  L+   EY FRVRA+N  G SEPS+ S+     EK  P  P   +EV

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 70/286 (24%), Positives = 121/286 (42%), Gaps = 28/286 (9%)

            G+  +VA +   ++S+SV  + V+++     P F+   +N+ IKEG+  + + R  G P 

            P + W +N   I      +  ++ G +G  +L I +   +D   YT  A N +G      

            ++ VE  FA+   +  +    G       +AP +E     +G              +  P

             F  KL  + +K      F C++T  G P   V WL    PL+ + R+ +  + G   L+

                   D G+ TC   N  G    SA L ++      +S V E++

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 60/249 (24%), Positives = 94/249 (37%), Gaps = 46/249 (18%)

            P+F ++L + V   EG    L+ +V+   P T+ W  N   ++ T    ++ + +   + 

            + KA   D GLY C   NDAG A C+  + +                             
Sbjct: 8309 VRKAGMNDAGLYTCKVSNDAGSALCTSSIVI----------------------------- 8339

                        K P K   PP   Q      V  GE V+L   V G++PI   W+K  +

            +I+ S+      +   + L +    +   G Y     N  GS   +  +T+ DKP   PA

Query: 1336 GTPCASDIR 1344
                A D R
Sbjct: 8445 TKKAAVDGR 8453

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 92/386 (23%), Positives = 152/386 (39%), Gaps = 75/386 (19%)

             V V  G  + L+      P  +I W  +G  LK ++F+  S+  +  ++SI+ A  E  G

              Y  +  N        C++ V   P +  T  P  K + P                    
Sbjct: 27633 KYTVILDNAV------CRIAV---PITVITLGPPSKPKGP-------------------- 27663

                           I+F E +     +SV L   V    G   ITC  ++ R+  Q +  

             M   + +    K+  L    E+   + +  EN+ G  Q  V+  +V K     P PP G 

             P   ++ S  ++L+W    YDGGS V  + +E  +  +  W+++ T       +    L+

                +Y+FRV A N  G S PS  S+  T+   P +P    +  D       V   T+T+ 

Query: 1456  TEQKVSD------FYDIEERLGSGKF 1475
                 + D       Y IE+R G+ ++

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 51/205 (24%), Positives = 79/205 (38%), Gaps = 32/205 (15%)

            G    FE R+ G    QV+W+++G  +      L    +    +L I    +   G+Y C

             A+N  G    + +L +                                  E PP F  K
Sbjct: 7189 SASNPLGTASSSAKLILSEH-------------------------------EVPPFFDLK 7217

               V +  G+ G F C +TG    ++TW K N  ++P     ++       L +  V + 

            D G YTC   N +GK S SA+L +Q

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 172/805 (21%), Positives = 281/805 (34%), Gaps = 128/805 (15%)

             G+V   A + I+   L+V    +D         F +P +++ + E   A+FE  +    E

               V W +    I S  +F +    +    LVI+    +D G YT E              

              VEG            K    R     +            KF + L    VKEG+   F 
Sbjct: 11558 -VEG------------KKTSARLFVTGIRL----------KFMSPLEDQTVKEGETATFV 11594

             C+++   +  V W K +  L  S  V +S +     LE+  V  DD+      V     +

              S +A+L +   D      + +  A   D       V K+V     K+            

             K D L    K K      +G      G+    AN   +  R  K+E     P    +  V

              +     I L    V  + +  G  + +    E               Q G+ + +V  +

             AAN +      +    P     P S  +V E    KF CEVS  PK    W L+GT    

              +   E+ +D   H + +  A   D   Y   A +              +L +  +   F

              + LKD    E +  V    +    + R+ W  N Q +   RS        + +QD    

                T+  L+ +   Q+   A            SE  L V       P F   L D   ++

               +V +  ++S    P V W  +G EI+ S++   +  G +  L +++    D G YTC+

                  G  +T   L +++     +   +    SV     ++      I+ D     +W  

              G+AL + T   E+ +   + +LVL

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 79/335 (23%), Positives = 125/335 (37%), Gaps = 54/335 (16%)

             L  + V  G K+ L   V+  P   I WT     LK  K I +       +V+I  +   

             D G Y   A N  G+A    +V V D P                   PP     +D T +

                    PP+     +I  +  +++    E                 W K    ++++  

                       K T L   +E+   + +  EN  G     Q + +T   + DPP G P   

               SDI   ++TL+W     DGGS +  Y +E  D     W        + T++ V+ L  

               +Y+FRV A N+ G  +PS+ +E   + +  + P

 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

            P F++ ++ + V+EGS A F+  I G+P PEV WF+D Q I  S     QI +  DG   

            L I  V   +  +Y+ KA N  G+AT TAEL+V+

 Score = 69.7 bits (169), Expect = 3e-11
 Identities = 51/223 (22%), Positives = 89/223 (39%), Gaps = 38/223 (17%)

            ++ + E P+F+  + P  L +  G +A+   +++G P  QVTW +N + ++      +  

             +     L I  V  ED G Y+CEA N  G+   + E+ ++                   

                            PP F   L    +  G      C+++G    +++W K    ++ 

            S +  +  +  +  LEI   N  DVG Y C+V N  GK    A

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 61/269 (22%), Positives = 98/269 (36%), Gaps = 61/269 (22%)

            P+F+Q    V V  G  L     +   PP  + W    + L   +   +S E  +  + +

             +  P + G Y C+  NDAG A C+  + V +                            
Sbjct: 6894 FEVQPLESGDYSCLVTNDAGSASCTTHLFVKEP--------------------------- 6926

              AT  K+ A                  D  V  G  + L    TGT PI+ +W+K    

            I +SE   +  +E  + L IL +  E    Y+ L+EN+ G    +  ++V++ P      

Query: 1332 -------DPPAGTPCASDIRSSSLTLSWY 1353
                     PA   C  D  +  + +SWY

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 94/414 (22%), Positives = 156/414 (37%), Gaps = 55/414 (13%)

             ESD  V + P      P TP   A+    +     + V  G S  +   +   +  +  W

              K  K I      K +N E G +             + +  EN +G  +A  N       

             DP  P GTP    ++ + +TL W    YDGGS +  Y +E  D  +  W + +      T

              F V  L  D  Y+FRV A N  G  S+PS  +   T  ++ E P        +D + V+

               +    E D     + T + +    +IEE          F+  L+ K   ++  G++  

             +A +    ++    + +++    P+  VQ      EK ++     +  GG      + E 

              E       +   E +    +++   EG EY+ +            IM VNK G

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

             GC   Y +  EN  G         ++   DP     P   P   D   +++T++W    +

             DGG+ +  Y++E   S +  WK  + + R T + +  L    EY FRV+++N  G S+PS

               S+     E+ EEP  +++

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 104/480 (21%), Positives = 172/480 (35%), Gaps = 84/480 (17%)

             E     S  ++EVT +   E + +  + A +  + S+ +     R  SP +         

                S+PQP  E + ++ + SP     TP                +  PR+P     SP  
Sbjct: 32289 LIRSRPQPAEEYEDDTERRSP-----TPE---------------RTRPRSP-----SPVS 32323

              ER      R A F   +R   + +     K + R+  +  Q+       P+   + +S 

              V   Q  +F   V   P  EV W+  G  ++ +   I     +G   L +L   T DSG

             TY    +N +G+ S   TL V                       G D+    S R    V
Sbjct: 32443 TYRAVCTNYKGEASDYATLDVT----------------------GGDYTTYASQRRDEEV 32480

             PR  +    +   YA S+       EA  +   ++  + E   + +    +A  ++  +A

                 ++ EK ++RK +  L        A   L     + V +G     +    G P P V

              WL  G  +  S          + +  I  V   D G Y+    NS G+   +  LT+Q+

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 90/366 (24%), Positives = 127/366 (34%), Gaps = 79/366 (21%)

             L  AP   L  R+  +  G   +F   V+  P  +V W+ NG  +    +        G 

Query: 89    FSLVIHAVHEEDRGKY---------------TCEATNGSGA------------RQVTVEL 121
              +L I   H +D G Y               T + T G               R V  EL

Query: 122   TVEGSFA----KQLGQPVVSKTLGDRFSAPAVETRPSIWG-------------------- 157
             T   ++A    K+  +   S ++ +   +   ETR S+                      

                           +  TK   + V EG+  RFSC   G P P VTWL+    L  SAR 

              V+        EI  V   D G Y+ +V N  GK      L+IQ      ++ V E KA 

              S  R     V S E ++ S EA    K   SP+    P       P   + +  E  + 

Query: 328   SPRTAP 333
              P +AP
Sbjct: 32712 LPVSAP 32717

 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 84/348 (24%), Positives = 127/348 (36%), Gaps = 66/348 (18%)

             P    KL  V  V  G  + L+  V   P   + WT +      T+   + +        

              S+ KA   D G Y   A N AG       V V D P    N K  ++ S R        

                    TV   P P+      +   I++  E +++                     W  
Sbjct: 18313 ------CTVCWDP-PEDDGGCEIQNYILEKCETKRM--------------------VWST 18345

             +   +             G+ +T L    E+   + +  ENK+G+     +  V+ K   

                  PDPP  T  + +     +T+ W    YDGG ++  Y +E  +  +  W  +  + 

                    VQ+LLPDHEY+FRV+A N  G  EPS  S    V + P EP

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 57/219 (26%), Positives = 88/219 (40%), Gaps = 35/219 (15%)

            P+FI   +++    GA+   E RV G     V W ++G  I SG +           +L 

            +  +   D G YTC A N +G+ + +  LTV+                            
Sbjct: 6800 LSLLEPSDTGIYTCVAANVAGSDECSAVLTVQE--------------------------- 6832

                   PP F      V V  G    F+  I G P  +V W KG+  L P    ++S +

            + +  LE+  V   + G Y+CLV N +G AS +  L ++

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 81/389 (20%), Positives = 141/389 (36%), Gaps = 63/389 (16%)

             P+ +      +V   ++L +       P AT+ W  +G+TLK T  + +S   ++ S+SI

             ++A  ED G Y+    N AG       + V D P                   PP     

              + +         PP+     QI  +  ++K                +  + TW    + 

             +  +  +K+     GS+             + +  EN+ G      +  VV +    P  

             P GTP       S++ ++W     DGGS V  Y +E       +W  ANK          

             T   V  L     Y++RV A N+ G  + S+  E       P +P  + EV++   K   

             + +     +   K++ +      L  G++

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 60/294 (20%), Positives = 118/294 (40%), Gaps = 57/294 (19%)

             S+    APAF  + +  ++ EG+ +L  C++S +P   I W  N   +  +  + +S+  

             ++ S+ I  A   D G Y   AKN  GQ   +  + V    + P+ E             

               ++++ +M + + ++S      + + +  + K A  +    +                 

                                 +PP+I   P D  +  G+ + +    TG      TW    

             ++I  QE     +EN+++ + L I+  +++  G YTL + N+ GS  A VN+ +

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 50/235 (21%), Positives = 84/235 (35%), Gaps = 45/235 (19%)

            AP  K+K++ + VA G      C++ S P     W   G+ +  +    +     + S+ 

            I +    D G Y C A N+ G   C+  +TV +A                          
Sbjct: 3515 ILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEA-------------------------- 3548

                                PP  +  P+      G++ +    VTGT  I   W K   

             +  S + ++ ++EN   L +     +  G Y+    NK G+   Q  L ++DKP

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 48/162 (29%), Positives = 76/162 (46%), Gaps = 12/162 (7%)

            KW K G  + A     I   +++A +   S     +G  T  ++ E   S  + +   L+

                    + P+F+K +R+++ V     R DCKI G     V WFKD + I  S  ++I 

            + E G  SL I  V  +D   +TC+A NS+G    +  LIV+

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 60/273 (21%), Positives = 101/273 (36%), Gaps = 63/273 (23%)

            APA F ++L D  + +GK L+L+   +  PP ++ W  NG  +  ++   ++       +

             I  +  ED G Y C  +N +G+  CS Q+ + +                          
Sbjct: 7926 EIPSSTVEDAGQYNCYIENASGKDSCSAQILILE-------------------------- 7959

                                 PP  ++  E  KV  G+S  L  ++ GT  I  +W K  

             +++ +   K+    N + L          G Y    EN +G   A   LTV ++  PP+

Query: 1336 ------------GTPCASDIR---SSSLTLSWY 1353
                        G P   D     S  +++SWY

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

            S +  S A L   AE  P   P F + ++ + V +GS  R   ++ G P P V +++D  

             I+ S  FQI  + D   SL+I++   +D   Y+  A NS+G AT TAEL+V+  EE

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 63/233 (27%), Positives = 93/233 (39%), Gaps = 41/233 (17%)

            P   Q+LQ V V  GK       +S  P   I W    + L T    KF+   QE +L  

            +   +A PED  +Y C AKND G A  S  ++V+          PE+ S  P   +P   

                                  PP II   +D     G+      +V+GT  +  +W   

             K+I+ S   ++   E+  +L I  A  E  G YT +  N +G   +  NL++

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 78/330 (23%), Positives = 117/330 (35%), Gaps = 66/330 (20%)

             ++ + V  G  +     +   P  T  WT +G  +KT +   +  +     ++I+  L  

             D G Y+    N AG    +  +TV D P              P   +  +  T    T+ 

              +P    P      P I    E Q  R     + +G V+                     
Sbjct: 17625 WQP----PKDDGGSPVINYIVEKQDTRK----DTWGVVS--------------------- 17655

                    +GS  T L       GC   + +  ENK+G      +   V K    P  P G

              P  +DI  ++ T+SW     DGGS +  Y +E       W   NKT           F 

             V  L   + Y+FRV A N+ G S+PS  S+

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 76/322 (23%), Positives = 120/322 (37%), Gaps = 60/322 (18%)

             V  G  + L   V   P  T+ W  +G  LK  + I ++ + +LC++ +     +D G Y

                A+N +G    + ++ V D P    + K  +M S R   S  P L   G+E    +  

             K     P  A                         +V+ T PIT   ++  K I+  E+ 
Sbjct: 19427 KRETSRPNWA-------------------------QVSATVPITSCSVE--KLIEGHEYQ 19459

                                    + +  ENK G          + K   DPP     P  
Sbjct: 19460 -----------------------FRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVI 19496

             S+I    +T+SW   + DGGS +  Y +E  ++    W ++        +     L    

             EY+FRV AIN  G  +PS  S+

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 56/235 (23%), Positives = 93/235 (39%), Gaps = 48/235 (20%)

            P F +K   V V   G+    +CQ++  P   + W L+G  +   +   +S    L +  

            I  A  E+ G Y C A+NDAG A CS ++ V + P    T   E+K              

                                P +++++ +         VEL  +VTGT P   TW+K  +
Sbjct: 4963 --------------------PVEVVKYSD---------VELECEVTGTPPFEVTWLKNNR 4993

            +I+ S+   + +  +   L I        G Y  +V N+ GS      + + + P

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 60/261 (22%), Positives = 98/261 (37%), Gaps = 47/261 (18%)

            +  CK  ++  T + K   R + +   P+F ++L+D+    G  + L C+++   P  + 

            W  +G  L+  + +  S   ++ ++ I +      G Y C A N  G A  S ++T    

                        +R PK S                            P     P    V 
Sbjct: 6264 ------------AREPKKS----------------------------PFFDIKPVSIDVI 6283

            AGES +    VTG QP+  TW K  K+I+   +  +    N   L IL   +   G YT 

               N +G       L+V + P

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 50/237 (21%), Positives = 87/237 (36%), Gaps = 43/237 (18%)

            P F  +L  V    G+    +C V+   P  + W  + + +++     +S   +   +++

             K    D G Y C A N+ G+  C+ Q+ + +                    +PP     

               TV++                           G S +L G+V G+QPIT  W K   +
Sbjct: 8255 LSETVEETE-------------------------GNSFKLEGRVAGSQPITVAWYKNNIE 8289

            IQ + + ++    N   L +  A     G YT  V N  GS     ++ + +   PP

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 82/367 (22%), Positives = 139/367 (37%), Gaps = 64/367 (17%)

             G +D    S+ Q      ++ L D+     K L+++   S          P   ++W+  

                L+T  ++  +   S  S++IE A   D G Y    +N    A  +  V V D P   

                             PP   T  D T +          A +   +   PE+        
Sbjct: 26280 ----------------PPTNITVQDVTKES---------AVLSWDV---PEND------- 26304

                     G  P+    ++ R   + S+   V  + N ++L+      +    Y   V  

             EN+ G     + +  + + +KP PP      S I   S++L+W    +DGGS +  Y +E

               +   K W + A  +ST   V  L  + EY FRV A N  G S+P +      + E+ E

Query: 1430  EPKDEVE 1436
              P+ +++
Sbjct: 26473 PPEIDMK 26479

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 60/253 (23%), Positives = 98/253 (38%), Gaps = 44/253 (17%)

            + + E P F+  P++  +      + +  V G     + W ++ + + SG    +     

             T SL + A    D G Y C+ +N  G       L     F K+                

                         PP+F  K   V+V + GQ   F C+ITG P+ +V+W      +    

            +  +S  +G+   +I G   ++ G Y C   N +G AS S EL ++       +F+RE K

Query: 266  ATN----SDVRKE 274
                   SDV  E
Sbjct: 4963 PVEVVKYSDVELE 4975

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 38/113 (33%), Positives = 58/113 (51%), Gaps = 15/113 (13%)

            P+F   +  ++ V G +A F+C + G    +V W KD + IR    +QI Y E+ +  L 

            +  V   D  +YTC AVN +G+ +CTA+L              + ET+EE EG

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 79/316 (25%), Positives = 128/316 (40%), Gaps = 54/316 (17%)

             + +  GK L +   V+  P  T +WT     L   + +++   G+   + I+ AL +D G

              Y   A N  G    + +V V D P              P   L PV+ T     +    

              P+    + +   II+  +D K+            T  QPI            E+E  K 
Sbjct: 15219 DPEDDGGSEITGFIIE-RKDAKMH-----------TWRQPI------------ETERSKC 15254

             +       +T L   QE+   + ++ +NK G     ++  +  VD   PP        ++

                S++TL W     +GGS +Q Y IE        ++ +    C +TSF V++L     Y

Query: 1401  KFRVRAINVYGTSEPS 1416
             +FRV+A+N  G SEPS
Sbjct: 15366 EFRVKAVNEIGESEPS 15381

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 74/315 (23%), Positives = 115/315 (36%), Gaps = 53/315 (16%)

             G+   L+  VS  PP T+ W+ +GK L+ T  + +       ++  + +   D G Y   

             A N  G A+    V V D P              P      V    S+  V     P   

               A +   I+Q  E  ++                     W     ++Q ++         
Sbjct: 21583 GGAKIDHYIVQKRETSRL--------------------AWTNVASEVQVTK--------- 21613

               K+T L    E+   + ++  NK G  +   +  V+       PDPP   P  + I   

             S+ + W     DGGS + +Y +E  D A + W +    T     + V  L   HEY+FR+

Query: 1405  RAINVYGTSEPSQES 1419
              A N  G S PS  S
Sbjct: 21730 MAENAAGISAPSPTS 21744

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 40/122 (32%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

             QE C  Y  +L EN+ G     +   ++   ++P PP G     D+  +S++LSW    +

             DGGS +  Y +E+    +  W   AT + T   +  L+   EY FRV A N  G S+P Q

Query: 1418  ES 1419
Sbjct: 22135 LS 22136

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 41/116 (35%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

             P PP+  P   D    S++L+W    YDGG+ +  Y +E+ +     W  +   AT R+T

              F V DL    +Y FRV A+NV G SE S+        E+ E P  ++E++DD +K

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 54/234 (23%), Positives = 84/234 (35%), Gaps = 44/234 (18%)

            P F +KL+DVH   G  +  +C+++   P  + W  +G  LK    +  S   ++ ++ I

             +      G Y C A N  G A  S ++ + +                            
Sbjct: 7176 LQTDQSHIGQYNCSASNPLGTASSSAKLILSEHE-------------------------- 7209

                              +PP     P    +  GES      VTGT PI  TW K  ++

            I+   + K+   EN + LT+L   +   G YT    N  G       L V + P

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 62/258 (24%), Positives = 96/258 (37%), Gaps = 37/258 (14%)

             +AP F    RNL ++  + A    +V G+P+P V W+R G+ I + G ++ +     G  

              L+I +V ++D   Y   ATN  G+   T  L VE      L                  

                        PK    +G V    G++       +G+P P +TW KG   +  +    V

                     L   +GV + D G Y     N  G    + EL +  +    R          

             SDV ++  N+   E   D

 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 71/342 (20%), Positives = 124/342 (36%), Gaps = 55/342 (16%)

             P+ K       +  G+ L ++  V   P   I W  +G+ LK T  + + +  +   + I

             ++   +D G Y   A N AG A  +  V V + P                   PPV    

              D  +         PP      QI  +  +++                   T TW     

              +  +  +K+   + G++             + +  EN+ G      +  V+      +P

              PP GTP  + I    + + W+    DGG+ +  Y +E  +  +  W +L     + T F

                 L    EY+F+V A N+ G  +PS+ SE     +  + P

 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 67/307 (21%), Positives = 118/307 (38%), Gaps = 39/307 (12%)

             S+ + + SL  + S    +  T A   +  PR++ + EG +A+F     G P P VTW R

              GQ +++  R  +     + TF   I +V   D G Y+    N  G ++    LT++ + 

Query: 127   -FAKQLGQPVVSKTLGDRFSAP---------------------AVETRPS-------IWG 157
                K +  P   K+   R  +P                       ET+P+       +  

               PPK    L     KE  + + +C +        +VTW K    L+ +         +G

                L+I+ + + D G Y C +    G +  + +   Q   S +    + ++   SD +  

Query: 275   VTNVISK 281
              + V  K
Sbjct: 32833 ESTVTRK 32839

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 52/224 (23%), Positives = 85/224 (37%), Gaps = 33/224 (14%)

            + + PA I+    L  +  G  A  E  V G PE +  W+++G+P+ +  ++ +      

               L  ++    D G+YT E +N  G+       T            V+ + +   F+ P

                   + G C                   R  CKI G    +V+W K    +  S R 

             ++   G   LEI  V+ +D G +TC   N  G    S  L +Q

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 69/307 (22%), Positives = 116/307 (37%), Gaps = 64/307 (20%)

            + DENL++      A+ + L+ D+ +    +C   +  GT  +  R  +     +P F  

            K   + V  G+    +C V+   P  I W+ + K ++      ++  G+   + I K   

             D G Y C A ND G+  CS Q++V +                                 
Sbjct: 6336 GDSGQYTCQATNDVGKDMCSAQLSVKE--------------------------------- 6362

                          PP+ ++  E  KV + GES++L  K++G+  I  +W +   ++ ES

                +    + + LTI  A  E  G Y     N +G       LTV   P       P G

Query: 1337 TPCASDI 1343
Sbjct: 6469 ALKGSDV 6475

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 31/114 (27%), Positives = 63/114 (55%), Gaps = 7/114 (6%)

            E+ +D+ +A +  +        PYF + +  +E V G  A   CK++G P+  + W+K+ 

              +R +  +++ + ++   SL+I+ V   D  +Y+CKA NS+G    +A L+++

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 6/189 (3%)

             VR G+++ +  +V G      TW K  K +   + + +       +L I  A +   G Y

              +  +N  G  Q    + V+D+P P       +++   + T+SW     +GGS + ++ +

             E      K W  +A+  +      +LL ++EY FRV A N  G   P+ E++   +    

Query: 1426  -EKPEEPKD 1433
              ++P EP++
Sbjct: 18098 IDRPGEPEN 18106

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 66/229 (28%), Positives = 97/229 (42%), Gaps = 25/229 (10%)

             G +S+  V + P   P  PP    PP I+    D       SV L     K TG  PIT 

               ++F  R  +      K        K+T L    E+   + ++  N  G  +  +    

             V   DP  P G P   +I  +S+TL W    YDGG  +  Y +E  D  +K+W +     

                 +F V DL+   +Y+FR+RA N  G  S PS+ +E     ++ E P

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 67/331 (20%), Positives = 125/331 (37%), Gaps = 69/331 (20%)

            +P F ++ + + V +   ++L  +V+  PP  I W  +   L++ +      +  L S+ 

            I K +  D G Y+C   N+ G + CS +VT+ +                           
Sbjct: 4452 ILKFVAADAGEYQCRVTNEVGSSICSARVTLRE--------------------------- 4484

                                PP  I+  E      G +      + G+ PIT TW+K   

            +I E +++++    N + L +     +H G Y    +N  G ++    L+V +       

                D   G P    ++ S    +T  W+  G     GS    Y I + D+ +   K ++

            T +  S    F VQ+ +     K R+  +++

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 14/163 (8%)

            KW K G  +       I    +++++  +S  K  +G  T        E + DV ++  +

            A +      + P F+K ++ ++ ++GS    +C + G     + WFKDDQ I  S  ++ 

             +  D    L IS + G D   YTC A N  G   C+  L V+

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 53/230 (23%), Positives = 85/230 (36%), Gaps = 44/230 (19%)

            +K + V V E   + L+C V+  P   + W  +GK +  +++  +S E ++ S  I+  +

             +D G Y    +ND G + C   + V D                   ++PP        T
Sbjct: 5205 KQDSGQYTFKVENDFGSSSCDAYLRVLD------------------QNIPP------SFT 5240

             K     K                      G S+ +  KV+G+ PI+  W K  K+I  S

               ++   E    L +     E    YT  V N  G       LTV + P

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 5/118 (4%)

             QE C  Y  +  EN+ G     Q    + V + P PP G     D+  +S++LSW    +

             DGGS +  Y +E+    ++ W E A  +S    + +L    EY FRV A+N  G S+P

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 87/403 (21%), Positives = 150/403 (37%), Gaps = 89/403 (22%)

            G+ +LV   HI+   L+V             PA+    +++ +KEG T     +    P 

             +  W RNG+ +   GR   +   +    L I  V  ED+G+YTC+  +     + + EL

             +E                                   P +F  ++  +VV E Q   F 
Sbjct: 8828 RIEAE---------------------------------PIQFTKRIQNIVVSEHQSATFE 8854

            C+++      VTW KG   L  S + +         + IH V  DD GVY+ +  +   G

            +A  +AEL +                T  +++ E+      +S++       ++      

                 PP        PP    L + ++     P    ++ T  ++   A +V  +P+   

               ++P  E  K+P PP     P + P +   DV SKA   +I

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 57/224 (25%), Positives = 89/224 (39%), Gaps = 19/224 (8%)

             S+ TV + P  K P     P   +   +  +V+  E +   G +V G      +  +  W

             +K  K        K    E G +     + +   G         +G         V   P

               P G P A  +  +S+TL W   +YDGGS +  Y +E  +     W + +      T F

              V  L+ DH Y+FRV A N  G  SEPS+ +   T  ++ + P+

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 78/337 (23%), Positives = 129/337 (38%), Gaps = 55/337 (16%)

             G  + L+  +S  P  TI W  + K L+T   + +     L S+ I+ A   + G Y+  

              +N  G A  + +V + D P              P   +     T    T+  +P P   

               A +   I++  E  +V                     W         SEH++    E 
Sbjct: 26994 GGAKITHYIVEKRETSRV--------------------VWSMV------SEHLE----EC 27023

                 T +    E+   + +   NK G  +   + +VV K     P PP G P  + I  +

             S+T+ W     DGGS +  Y +E  D  +  W ++   T R T   V  L  + +Y++RV

              A+N  G    S+ SE     +   P  P  ++ ++D

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 33/95 (34%), Positives = 48/95 (50%)

            P   + I+   V +GS A F  ++ G PDPE  W+K+   I  S      + ED  C L+

            I DV  +D A    KA+N  GE +  A L+V+  +

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

             P  P   P   D   SS++L W   + DGGS ++ Y +E+ +     WK        + T

             C     N+++L    +Y+FRV+A+N  G SEPS  +      +  EEP+  +++   D

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

             + KP PP   P A D   +S+ L+W    +DGGS +  Y +E     ++ W+       +

             C  T + V  L     YKFRV A+N  G S+P+   E   V ++ E P+

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 110/471 (23%), Positives = 168/471 (35%), Gaps = 95/471 (20%)

             K V +S PLS   P   L+     K + TL           L P+  G AK D  + S  

             +EE   D   + +  +  +    G  + +K                 E++G   A +Q L

                    + + +  GKKL ++  V   P  T  W      + T+  + + +  S   + I

             +    +D G Y   A+N +G      +V V DAP                   PP  +  

              ++DA       P     + +   I+   E   V  G+ V     VT T        +  

             K I   E++    +EN              G    L   K+    AQ    V  +P    

              T    D     + ++W     DGGS +  Y IE       +W  AN T       RST 

             +    L+   EY FR+ A+N  G+S PS+ +E  T    P +P  + EV D

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 11/210 (5%)

             +EG   K+  ++  Y +  QVTW+   + + +  ++ +     G   L +  + + D G 

             Y C+  N  G      EL V+G   +++      +T+  +      +T   +  E PP+F

                L       G+  RF   IT  P+P VTW K    ++P     + +     G+  L I

             + V  DD   YT +  N  G+ S  A+L++

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 58/249 (23%), Positives = 97/249 (38%), Gaps = 12/249 (4%)

            D EK+ +     P FK+KL  + +        +C+++   DP   + W  +GK L+    

            + +  E   CS+    A   D G+  C A N  G    S  + V D    E +   E + 

               +  L  +   E  A         T  K    P I+ +PE  +V  GE+     +VTG

                   W    + I++S+  +V   +    L I+  +    G   +  EN  G  + +V

Query: 1324 NLTVVDKPD 1332
             L +  + D
Sbjct: 1926 KLEIQQRED 1934

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 54/228 (23%), Positives = 80/228 (35%), Gaps = 35/228 (15%)

            L E P F+    +L    G T   +  VRG     VTW +  + I   G+  +     G 

              L+I  V     GKYTC A N +G++    EL V+                        
Sbjct: 3979 AVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE----------------------- 4015

                       P K   +   + V  G        + G P+ +  W K   PL  S +  

            +S KN +  L+ +     D G YT  + N  G +S     ++   D A

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 58/246 (23%), Positives = 97/246 (39%), Gaps = 46/246 (18%)

            L E P+FI    +     G TA F+  ++G     VTW ++   IT       D  IR T

            F     SL +  +  +  GKY C+A N +G ++ +  L+V+                   

               PA  T  ++              + V +G       K +G  +    W K    L  

             ++  +S  + + +L+I    + D G YT  V N  G++S  A +++  L     SF ++

Query: 264  TKATNS 269
             K  +S
Sbjct: 4681 LKKMDS 4686

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 57/244 (23%), Positives = 86/244 (35%), Gaps = 35/244 (14%)

            V ++ L E P F+    +L +  G  A+ +  + G     V W +  + +      +   

             +    +L        + GKY C+  N  G R+    L V                    

               PAV                K G + V  G+     CK+ G P+  V W K    L  

            S +   S  N +  L I  V + D G YT  V N  GK+S +A + +    +   SF R 

Query: 264  TKAT 267
             K T
Sbjct: 5806 LKNT 5809

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 40/111 (36%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

             KP PP   P   DI  SS+ LSW    YDGG  +Q Y +E  D +   W           

             T+  V+ LL  HEY FR+ AIN  G  E +       V EK E P  ++++

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 53/248 (21%), Positives = 95/248 (38%), Gaps = 47/248 (18%)

            AF ++L D  V  GK ++L+   +   P ++ W  +G  + T++   +      C + I 

             +   D G Y C  +N+AG+  C   V+  +                     PP   TE 

            +           P +AA+               G+SV L  +V GT  IT +W K   ++
Sbjct: 6086 E-----------PLEAAV---------------GDSVSLQCQVAGTPEITVSWYKGDTKL 6119

            + +   +   + N + L          G YT   EN +G+  ++    + ++  PP+   

Query: 1339 CASDIRSS 1346
               DI  +
Sbjct: 6180 QLKDIEQT 6187

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 92/399 (23%), Positives = 152/399 (38%), Gaps = 56/399 (14%)

             +VV+ G   R    I GRP P+VTW K N+ L+  A +  +E     +L I   N+ D G

              +   + N +GK   S  ++++ LD+      +R T  T   V              +TN

              I ++   ++     A  K   C+    G S          A N     +P   ++    

              ++P       ++  T S+++L      P+P+  G   ++    E +R    +  T  T 

               GL               Q +   +A R  P E      +  +  P+ + +   Q++  

              K    +K    V G PKP V W  +G  + +Q   +     A S  L + +    DSG 

             Y  TA N  G++    T+QV  +      P  F  V  D

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 61/234 (26%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

             AP     +KD     G+   L C + G P+P I W   G+ +  +R    + +     L 

             +     ED G YTC+A N +G+V  S             S+ LL   P   P  P+  + 

                +    GS + + V   G P P + W H    +Q SE+   E       L ++ V  +

                G Y  +  N  G V   A+L V+      +P   + P  + A L  S +IS

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 14/152 (9%)

            PP   + L  V V EG+     C I+G P P VTW + +  ++ S    ++ ++G+  L 

            I     +D G +TC  VN +G  S S  L++Q     +  F +ET A        VT   

            + E K  ++S +      + +  Q G   P A

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

             +++      + V +       TI    + H   + ++ +NK G       + +    +  

              P  P   P  S +  +S+T++W    YDGGS V  Y +E+ D+ +K WK +      A 

                 S+ V  L+   +Y+FRV AIN  G    S  S+  T  +    P

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 77/340 (22%), Positives = 133/340 (39%), Gaps = 57/340 (16%)

             + V  G+ + +  +V   P   I WT  GK L   K + L Q+     + I++A+  D G

              Y   AKN +G A+ S  V V D P              P  +L     T+ + T+    

                            + P D                G   IT   +++RK  Q+   +  
Sbjct: 18022 --------------WENPLD---------------NGGSEITNFIVEYRKPNQKGWSIVA 18052

              +         L A  E+   + +  ENK+G      ++   + +  +D+P  P     A

              D   + + L W    YDGGS   SY +E     +  W+ +   + + T + V   + + 

              Y+FRV+  N  G S+  +  E+  V E  ++P  ++++S

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 25/182 (13%)

            T+  E   +++   P F Q+LQ + V +G ++ LQ +V+  P   + +  +G  ++++  

              +SQEG L S+ I +A PED G Y   A N  G+A  + ++ V   ++ PA +      

              +  E +  R +  +       S ATV+             K  P+ PPK    +  PP

Query: 1239 QI 1240
Sbjct: 270  SI 271

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 35/96 (36%), Positives = 46/96 (47%)

            KP F       + +EG  ARFD K+ G P PE  WF D Q I      ++   EDG  SL

            II      D  ++T  A N  G ++ +  L VE +E

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 48/217 (22%), Positives = 87/217 (40%), Gaps = 36/217 (16%)

            E P+F+  P +  +  G+    +   +G     + W +  + + SGG   +      + S

            L ++ V   D G YTC+ +N +G  + +  L     F K+                    
Sbjct: 4263 LELYLVKTSDSGTYTCKVSNVAGGVECSANL-----FVKE-------------------- 4297

                     P  F  KL    ++K+G   + +CK+TG P  ++TW   +  ++ S++  +

            S      VL +  V  +D G Y C   N +G    S+

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 44/140 (31%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

             + ++ EN  G  +       +  +D  DPP G P   +I   ++TL W    Y GG  + 

             SY +E  D  N  W     +      F V  L  D  Y+FRV A N  G  S PS+ S+ 

              T  +  E PK +V+V   D

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 91/388 (23%), Positives = 134/388 (34%), Gaps = 60/388 (15%)

             PAFK       V  G+ L +       P   + W  +   LK T  +      +   ++I

             + A  ED G Y     N AG+A  +  V V D P                   PP    +

              D  T         PP               K   G S+  +  V      T TW     

                         S   ++ TI A R +  GC   + +  EN+ G S       TV   P 

                 P GTP  +     S+ + W     DGGS V  Y +E  +  +  W +L       T

              F    L    EY+FRV A N+ G  +PS+ SE   V   P +P    E          +

              ++  T +   K++ +   ++ L  G++

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 82/331 (24%), Positives = 122/331 (36%), Gaps = 60/331 (18%)

             P +K  +  VH  E  K+     +   P  TI W    + L  T  + +       S+S+

             + A+  D G Y   AKN AG+   +  V V D P       PE          P V+   

             S  T +K      PP       II +  +++    E+  L   V     Q ++C      

                      KV     G++ T           + ++  NK G  +   +  VV K     

             PD P   P  + +   S+ + W   + DGGS +  Y +E  D     W            

               V  L+ +H+Y+FRV A N  G SEPS  S

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 45/169 (26%), Positives = 67/169 (39%), Gaps = 12/169 (7%)

             W+K  K   +    K    + G +     + +   G         +G         V   

             P  P G P A  I  +++TL W   +YDGGS +  Y +E  D  +  W +        T 

             F V  L+ D  Y+FRV A N  G  SEPS  S   T  ++ + P   ++

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 9/134 (6%)

             AQ+  TV D P    G P  S+I  +S+TL+W     DGGS +Q Y +E  +  +  W +

             + + R    T F V  L   +EY+F V A N  G    S  S L    E   P  P   V

Query: 1436  EVSDDDEKEPEVDY 1449
             +V+D  +    +++
Sbjct: 28261 KVTDTSKTTVSLEW 28274

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

            ++ G +AR  CK++G P  +V WFK+++ + ES   ++ Y  +    L I+DV  +D   

            Y+C+AVN +G  +C+ E++++

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 49/235 (20%), Positives = 90/235 (38%), Gaps = 48/235 (20%)

            P F +KL+   + + G    L+C+++  P   ++W  N   L  +    ++   S+  + 

            +     ED G + C A+N AG   CS +V V + P                SS PP++ T

              +A                                  V L  +++GT P    W K ++
Sbjct: 5529 LKNA---------------------------------EVSLECELSGTPPFEVVWYKDKR 5555

            Q++ S+  K+ +    + + IL       G Y    +N++GS      + + + P

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

             P  P   P  +D   SS++L+W    YDGG+ V+ Y +E+ ++A   W    TC      

             +   F V  L  + EY FR+ AIN  G  EP+         E+ E P+ E++

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 72/342 (21%), Positives = 133/342 (38%), Gaps = 65/342 (19%)

             +HV  G+ + L   ++  PP    W   G  L+ ++ + +     +  ++I +    D G

              Y    KN  G    + +V + D P                    P+   E DAT   + 

              +P P+    A +   +++  +  +          G +  ++ +T +  KF +  + +E+

             +            + A  +   G Y   +++++   ++ + +     P PP  T    D+

                 +TL+WY    DGGS V  Y +E        W   NK    +   RST      L  

               EY+ RV AIN  G+ +PS+ S+     +      KP+ P+

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%)

            +E P   P     ++D    EG  ARF C++ G  D +V W+  D+ I+ SR F++   E

            D    L I++   +D+  YT  A N++G+ + TA L +E  E    E  E+E

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 60/238 (25%), Positives = 90/238 (37%), Gaps = 41/238 (17%)

            P F Q L  V V+EG+ + L C V    P  I W   G+ +K +     S       + +

                  D G Y C A N AG               S+ TK                    
Sbjct: 8406 RDVAKADSGDYVCKASNVAG---------------SDTTK-------------------- 8430

            S  T+K KPA  P T  KAA+  ++    E Q +R  E  +     KV G       W K

             + +Q+ +   + +    + +KL I    +   G Y  +  N+ G  ++ VNL V ++

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

             P PPA  P   D   SS++LSW   +YDGGS +  Y +E+  + +  W         + T

              F V  L+ D +Y+FRV A+N  G S+PS

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

             +   ++P PP       D   SS  L+W    +DGGS +  Y +E+    +  W E    

             +  +F V+ L+   EY+FRV+A N  G SEP +      + E   EP

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 76/349 (21%), Positives = 134/349 (38%), Gaps = 48/349 (13%)

             P    + +    K  +  +  C++ G P P++ W+  G  +  Q    ++  D  +H L 

             ++     D G Y+C A+N  G++  S  L ++  A  +  P +    K    + G    L

                  G PVP +TW    + +Q + + T E      H+  ++   + H G Y     N  

             G V     V + +K             P KPT PI ++ L          +  +  +S  
Sbjct: 30709 GTVDAILDVEIQDK-------------PDKPTGPIVIEAL----------LKNSAVISWK 30745

             PP +    W+ N      E +E  ++         + C      E+ G Y    A N+ G

                 +   +V+ ++ P +  +P    KP ++TA        SC +A  P

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

             P++  P  +   ++  +   + AKF  +  G P P   W ++G+ IT GG++ L    +G

              F L IH     D G YTC   N +G+   + +LT++

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 72/302 (23%), Positives = 123/302 (40%), Gaps = 31/302 (10%)

             +P+P  E+++++ K  P     TP+    ++ +T+     + E +AP      P G  + 

               K+   P  A     +PG G +    +A     P   Q  +   KF  + +   + E++

              V     F C VS  P   +  W  +G+ +R +        D     L ++  +  D+G 

             Y+C       + + +  L VE L V  V     ++ ++  V++GQ   L C +       

             + W  +G+ +         GV      L I DA   D GTYT   ENA   + CS+ V V

Query: 601   HE 602
Sbjct: 11301 VE 11302

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

             V KP PP G P   D   SS++++W    YDGGS +  Y +EI       W+ +   A  

             ++TS+ +  L  + EYK R+ A+N  G  EP+

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 48/176 (27%), Positives = 72/176 (40%), Gaps = 16/176 (9%)

             W K  K +     MKV   + G               Y +  EN  G  +   +   V  

              DP  P G P  ++I   S++L W    YDGG+ +  Y +E  +  +  W +      + 

             T F V +L  D  Y+FRV A N     SEPS+ +    V +  E P+  ++V   D

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 52/241 (21%), Positives = 87/241 (36%), Gaps = 54/241 (22%)

            T  NE  S S          P+F +K+   ++   G+   L C++   P   + W  N K

             L  +  + +    S   + I     ED G Y C A ND G   CS ++ + +       

                                                    PP  I+  E   +  G +  
Sbjct: 3830 ----------------------------------------PPSFIKTLEPADIVRGTNAL 3849

            L  +V+GT P   +W K +KQI+ S+  ++ + ++   L I +      G Y  +V N++

Query: 1317 G 1317
Sbjct: 3910 G 3910

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 73/351 (20%), Positives = 128/351 (36%), Gaps = 64/351 (18%)

            P+F +K++      G     Q  +    P T+ W  +   +     I ++ E ++ S+ +

                 +  G Y C AKNDAG   CS  ++V +                 PA+   K    

Query: 1199 PEMKSRRPKSSLPPVLGTESDATV------------KKKPAP-----------KTPPKAA 1235
             E+ ++  K      LG++   +V            +KK +            ++  KA 

            +       PP   +  +      G  ++L   V G+ PI+  W K  ++I  SE  K   

             +N + L I        G YT    NK G  Q   +LTV + P   + P       + R 

                    ++ +T+ W+  + +  S     +  +W     T  EL   ++T

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 28/92 (30%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

            PYF K +  ++V  G +A   C++ G P+  V W+K D  +R +  +++ +  +   +L+

             + V  +D  +Y CKA NS+GE + +  L V+

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 42/128 (32%), Positives = 59/128 (46%), Gaps = 2/128 (1%)

            ++ G  +S  N   LE+ E +    +E   E +    P   + I  LEV  G  A+F C+

            I+  P+    WFK  + I ES    I   +  + SL I      D  +YTCKA N  G  

Query: 1841 TCTAELIV 1848
            +CTA L V
Sbjct: 3538 SCTATLTV 3545

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 51/237 (21%), Positives = 86/237 (36%), Gaps = 44/237 (18%)

            P F  +L+ +  A G  + LQCQV+  P  T+ W      L+ T         ++ ++  

             K    D G Y C A+N                                       +GT 
Sbjct: 6139 NKVNINDSGEYTCKAENS--------------------------------------IGTA 6160

            S  TV +        +  +PP   +  +D +   G  V L  ++ G+ PI   W +    

            +++ E+++    +N + L IL     H G Y+    N LG+  +   LT  +    P

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 41/157 (26%), Positives = 68/157 (43%), Gaps = 4/157 (2%)

            KW K G  + +  +   ++  + +SG K    +P S       E +  V +    A  + 

                V P F++ +++   + GS+   +CK+ G P   V WF +   I   R +Q     D

              C+L ++ +   D   YTC A N  G   C+A L V

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 71/338 (21%), Positives = 128/338 (37%), Gaps = 62/338 (18%)

             W     T+K TK  +    EGSL              +++  A+N  GQ++ +    ++D

             +  +++T           +  PP      D T +       PPK      I ++  ++K 

             R G                  W+K  K      + +V +   G+++      +   G   

                   +G       +  ++ P  P   P     +D     + ++W     +GGS +  Y

              +E+     + W  + +   +   F V++ ++PD EY  RVRA+N  G SEPS+ SE   

               +   +P  ++E  D    E E     V +R V + T

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 75/315 (23%), Positives = 112/315 (35%), Gaps = 53/315 (16%)

             V  G+   L+  V   P  TI W    K ++ +    +        + ++ A+  D G Y

                A N AG       V V D P              P      V G  S+    K    

              +PP       I  +  +++    E+  L   V  ++ +T                    
Sbjct: 23740 WSPPLQDGGSDISHYVVEKR----ETSRLAWTVVASEVVT-------------------- 23775

               N  K+T L    E+   + ++  NK G  +   +  V+ K     P PP      ++I

                S+T+ W     DGGS +  Y +E  D +   W +    R T     V  L  DHEY+

Query: 1402  FRVRAINVYGTSEPS 1416
             FRV A N  G  EPS
Sbjct: 23891 FRVSAENAAGVGEPS 23905

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 60/273 (21%), Positives = 100/273 (36%), Gaps = 48/273 (17%)

            +AS E ++ D+ +  N  C+  ++  + +   +      P+F  K     V  G  + L+

                   P TI W    K L +     +++E    S+ +      D G Y C   N AG 

             ECS  + V                             +  AT  +K  P          
Sbjct: 4287 VECSANLFV-----------------------------KEPATFVEKLEP---------- 4307

                    Q ++ G++ +L  KVTGT PI  TW    ++I+ES   ++   E+ + L + 

                E  G Y    +N+ GS      + V + P

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 155/774 (20%), Positives = 290/774 (37%), Gaps = 128/774 (16%)

             V E +  +F C ++   +  V W  +G  + +     ++  D   H L +  ++  D G 

             Y+   +  +G+ + +      RL V  +   F S L+D  V EG+     C +    +  

             + W  N   +  +R+   +   + H  +           + E  L  +S      V E  

             S+ + + L          P F   L D   ++  ++T+  +VS + P  V W  +G EI 

              S  +  +  G +  L I++   +D G Y C+     G  +T+A +TV+      +   +

              KP   V   +G++      ++    P VH  W   G+ L   +   E++++     L+L

                Q    G+      N     + +V       +   S  +   +          REP +

                L G     +  G DR+  ++ G   +    ++    ED    +    +  +HT    

               E IR + +  L  +D+  K+    V T  LS D+++      + +  N QR    ++V

             S ++E K HS   + F+  L+   TS+  V                 +  + KL    G 

                + +  +   VE  + +   + S    PV   K  + +KP  NA              

                +K+  K+    LKK +K+D+       GT     + + +       + L  V V E 

             +    + ++S D      W L G+ L  T    + +EG + S+ +     +  G

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 72/338 (21%), Positives = 118/338 (34%), Gaps = 53/338 (15%)

             R E      +   K +DV V   G+  +L+  +   P   ++W+ +GK L+ T   + + 

                   ++ ++  +  D G Y     N  G       V V D P              P 

                  V G  ++        P     A +   II+  E  ++                  

               +W +   ++Q   +          K+T L    E+   + ++  NK G  +   +  V

                   KP  P  TP  S I   S+ ++W     DGG+ ++ Y +E  D     W +   

              T       V  L   H Y+FRV A N  G  EPS+ S

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 56/243 (23%), Positives = 88/243 (36%), Gaps = 34/243 (13%)

             EAP      +++  K G  A+   ++ G P P + W+R G+ +    ++ +    R T +

             L +    +ED G YTC ATN  G  + + +L ++ +     G P+  K  G         

                                     G   R      GRP P +TW  G   LQ S  +++ 
Sbjct: 30641 ----------------------AVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIE 30678

                    L +  V  +   G Y   + N  G      ++ IQ   D      V E    N

Query: 269   SDV 271
             S V
Sbjct: 30739 SAV 30741

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

             +KP  P G P  + +   S  ++W   + DGG+ +++Y +E  +     W  + T   R 

             T F+V++L+   EY+FRV+  N+ G SE S+ SE       P  PK +V +     KE

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 49/175 (28%), Positives = 74/175 (42%), Gaps = 22/175 (12%)

             P FK+ L +    EG+ +  + +VS  PP T+ W  +G+ L     I +  EG    ++ 

             I   LPED G Y+  A N AG   C   + V+      +  K+ E   R  +  +   L 

                   GTES            +A V  KPA  T   K     +I +  E++K+R

 Score = 58.2 bits (139), Expect = 8e-08
 Identities = 42/230 (18%), Positives = 82/230 (35%), Gaps = 47/230 (20%)

            P+F ++L++     G   +L+C+V+   P ++ W      + +      +   ++C++ +

                  D G Y CVA N AG  EC   +TV + P+                         
Sbjct: 5860 NSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPS------------------------- 5894

                                   ++ PE  +V  G++V     + GT P    W +  ++

            + + +   +   +  ++L +        G YT +V N  G       L V

 Score = 58.2 bits (139), Expect = 8e-08
 Identities = 55/284 (19%), Positives = 97/284 (34%), Gaps = 65/284 (22%)

            +N+ +     L      +  C   +   +D  +   +    P+F ++ + + V  GK + 

                +   PP  + W    + L          +G  C++  E  + E           G 

            Y CV  N+AGQA C+ ++ V +                                      
Sbjct: 5963 YTCVVSNNAGQASCTTRLFVKE-------------------------------------- 5984

                     P   ++   D  V  G+S+ L    TGT PI+ TW K    I  SE   + 

             +E    L IL + +   G Y+  +EN+ G       ++ ++ P

 Score = 58.2 bits (139), Expect = 8e-08
 Identities = 49/237 (20%), Positives = 84/237 (35%), Gaps = 44/237 (18%)

            P F + L+ V    G+   LQC+V   P   I W      L++     +  + ++ S+ I

             K    D G Y C A N  G    S  + +              K+R+            
Sbjct: 7080 NKVDHSDVGEYSCKADNSVGAVASSAVLVI--------------KARK------------ 7113

                              +PP   +  +D     G  V    ++ G++P+  +W K    

            +++  +++     N + L IL   Q H G Y     N LG+  +   L + +   PP

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

            PYF       ++VEG +  F C++ G P P V W K    +     +++ Y+ + G C L

            +IS    DD  +YT    N  GE + +A L+ E

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 52/233 (22%), Positives = 90/233 (38%), Gaps = 50/233 (21%)

            +K   + V  G+   L+C+V+  P  ++ W  +GK L ++   KF   ++  SL  +S+E

            +   +D G Y    +N+ G++ C+  V V D                             
Sbjct: 5768 R---QDAGTYTFQVQNNVGKSSCTAVVDVSD----------------------------- 5795

                            A+PP   +  ++     G S  L  KV G+ PI+  W   + +I

                  +   S+N   L + +      G YT +  N  GS + +  LTV + P

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 51/227 (22%), Positives = 84/227 (37%), Gaps = 41/227 (18%)

            + + E P+F   P ++ +  G +  F   +RG P  +V W +  + +  G      C I 

                   L +  V   + G Y+C  TN +G+   T  L     F K+             

                            P  F  +L    V+ G         TG P   V+W+K    +  

            S R S++      +LEI     +D   Y+CL+ N +G+    A +S+

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

             + ++ EN+ G       +  V   +PP+  G    +D+  +S +L W    +DGGS V  

             Y +E+     + W  +A  +  +  V  L    EY+FRV+A N  G S+P

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

             ED  +A L       P    ++P F + + + E  EG +  F+ ++ G P P + W KD 

             Q +    + +I ++     +L I D   +D   Y   A N+ G  +C A L VE +   +

Query: 1856  GEGEEEEE 1863
              E + +EE
Sbjct: 31893 QEFKSKEE 31900

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

            P   + ++ + V  G  ARF   I G P P++ W+K++Q +  S  F+  +  DG   +L

            ++ +   +D A YTC+A N  G AT +A L VE  E

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 50/237 (21%), Positives = 87/237 (36%), Gaps = 47/237 (19%)

            P F +K+ D+    G+ + LQ  V    P ++ W    + ++    I +S    +  + I

                    G Y C+A+N+AG      Q +V +    E                       
Sbjct: 3984 PDVQISFGGKYTCLAENEAGS-----QTSVGELIVKE----------------------- 4015

                               P +II+  E  +V AG+   L   V GT  +   W K  + 

            +  S+  ++    N ++L   +A     G YT  + N++GS   +   TV+D+   P

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 2/93 (2%)

            P F K +   +V  +G + + +CKI G P+ +V WF++D  + ES  + + +  +    L

             I++   +D   Y C+A N +G+A+C+  L V+

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

            P F K    +E ++G+    +C+++G P   V W+KD + +R  + ++I   E+   S+ 

            I +V   D  +Y CKA N +G  TC   + ++

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 41/118 (34%), Positives = 56/118 (47%), Gaps = 8/118 (6%)

             V KP PP       D   +S+TL+W    YDGGS +  Y +EI  +  + W+ +      

             R T F +  L    EYK RV A+N  G  E +  S   TV  KPE+  +  E+  D E

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 3/119 (2%)

             QE C  Y  +L  N+ G    A+    V V +P  P G     D+  ++ T+ W     D

             GGS +  Y +E+    ++ W      ++    +  L    EY FRV A+N  G S+P Q

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 45/160 (28%), Positives = 76/160 (47%), Gaps = 8/160 (5%)

            KW K G  +    R  SM+  + ++  R  S     S     K+E++   S   A+L  +

             +  P   P F+K +  ++ V GS+   +CK+ G       WFKD + I  S  +++   

            E  + SL ++++  +D A YTCK  N  G+  C+  L V+

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

            PYF   +  LE   G +    C++ G P+  V W+K D  +R +  ++  Y  +   +L+

             + V  +D  +YTCKA NS+G A+

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 55/269 (20%), Positives = 96/269 (35%), Gaps = 62/269 (23%)

            F ++L D  V  G  ++L+   +  PP ++ W  +   +  ++   ++       + I +

            +  ED   Y C+ +N+AGQ  C   V+V +                              
Sbjct: 6989 STIEDYAQYSCLIENEAGQDICEALVSVLE------------------------------ 7018

                             PP  I+  E  +   GE   L  KV GT  I  +W K   +++

             +   K++   N + L I        G Y+   +N +G+  +   L +  +  PP     

Query: 1335 -------AGTPCASDIR---SSSLTLSWY 1353
                    G P A + R   S  L +SWY

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 30/93 (32%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

            P F K +    +V +    R++CKI G P+ +V+W+KD+  I+ES  F++ +  D    L

             + ++  +D   YTC+A N+ G A+ +  L V+

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 50/225 (22%), Positives = 79/225 (35%), Gaps = 32/225 (14%)

            + + E    I  P  + +  G     E  V G PE    W ++G+ +++  +  +   I 

               SL I      D+G Y+ E  N  G    TV + V                  DR   

                         PP F  KL  V    G      C+++G     V W +    +    +

               S    +  L +  +   D G+YTC+  N +G    SA L++Q

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 53/224 (23%), Positives = 87/224 (38%), Gaps = 41/224 (18%)

            E   F+    +  ++ G+    E    G P   V+W ++   I+   R    C I  T  

              I  + E   ED  +Y+C   N +G               + + + +VS          
Sbjct: 6981 STILEILESTIEDYAQYSCLIENEAG---------------QDICEALVS---------- 7015

             +E         PP F   L  V    G+     CK+ G P+ +++W K +  L+ +   

             +  KN +  L I+ V+  DVG Y+C   N  G  + SA L I+

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 68/317 (21%), Positives = 120/317 (37%), Gaps = 58/317 (18%)

             V  G  + +   VS  PP T+ W +N +TL     I  +   S  S+ I+      +G+Y

               +AKN+AG+ + +  V V D P    T  P +       S                   

                       ++  F PED                G  PIT  ++  +++        V 
Sbjct: 16634 ----------KLTWFSPEDD---------------GGSPIT-NYVIEKRESDRRAWTPVT 16667

              +      T+    Q     + +  EN +G      + +A V    +  P+ P       

             ++  +++TL+W    YDGGS + +Y +E      + + ++      S  + V+ L     

             Y++RV A+N+ G  +PS
Sbjct: 16787 YEYRVSAVNIVGQGKPS 16803

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 66/316 (20%), Positives = 112/316 (35%), Gaps = 53/316 (16%)

             G  + ++  V   P  T+ W    + LK T+ +      +   ++I + +  D G Y   

             A+N  G+      + V D P                   PP    + D            
Sbjct: 21140 ARNIVGEVGDVITIQVHDIPG------------------PPTGPIKFDE----------- 21170

                 +    + F  D     G        V   Q  + TW++    +       +  +  

              ++LT     Q     + +  +N+ G      +  +V       P PP GTP  + +   

             S+T+SW+    DGGS +  Y +E  +     W+ +  A      F    L     Y+FRV

Query: 1405  RAINVYGTSEPSQESE 1420
              A N+ G S+PS+ SE
Sbjct: 21334 IAENMAGKSKPSKPSE 21349

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 74/390 (18%), Positives = 140/390 (35%), Gaps = 53/390 (13%)

             E L   ++ E +   KND        A ++   K  + + TA       Q +    G   

              +   +S  P   + W L    LK T  + ++      +++++ ++  D G Y    +N 

             AG    S  V V   P              P +    V    +++ V     PK      

             +   I++  E                      T  W      ++ ++           K+
Sbjct: 28773 ITNYIVEKRESG--------------------TTAWQLVNSSVKRTQ----------IKV 28802

             T L    E+   + +  EN+ G S+  +    + + P  P   P   +   + ++++++ 

             W    +DGGS +  Y +E  +     W  +    C   ++ V  L+   EY+FR  A+N 

              G S+ S+ S    + + P +     EV+D

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

            P F++    +  ++GS     C+I G P  EVVW KD + +R S+ F+I   +  + SL 

            I ++   D  +Y CKA N +G  TC+  +

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

            +VS +    V E+K  + P FS+ +RD++   G    FDC I G     V W+KD + ++

            +S + Q  +  D   +L I         +Y+C A N +G A+ +A LI+

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 41/142 (28%), Positives = 62/142 (43%), Gaps = 13/142 (9%)

             P  P   P  +D    S +L+W    YDGG  +  Y +E     ++ W +  T    R T

              F V DL    +Y FR+ AIN  G  EP+   ++  V         E E++ D E + E+

               RT+ +     +  F  I+ R

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 4/130 (3%)

            P      +++E  E ++   A      ++K   KP        + V+EG  ARF C++ G

            YP P+V W+ + Q IR+S+ F++ Y  DG   L I D    D  +    A N  G     

Query: 1844 AELIVETMEE 1853
             +L ++  E+
Sbjct: 1925 VKLEIQQRED 1934

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

             GC   + ++ EN+ G  +       V   + P PP       DI  S+++L+W    +DG

             GS +  Y IE     +  W  + T +     V++L    EY F+V A+N  G S P +ES

Query: 1420  ELTTVGEKPEEPK 1432
                 V E+   P+
Sbjct: 21052 RPVIVKEQTMLPE 21064

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 52/241 (21%), Positives = 83/241 (34%), Gaps = 46/241 (19%)

            AP F Q LQ V V EG     +  +S  P   + W  +G+ + T+    + +S       

            ++I      + G Y   A N +GQA  + ++ V    A                      

                                  PP  +Q  +   VR G  V L  +VTG       + + 

              +IQ S   ++    +   L I  A  E  G Y++   N +G   +   L V  + + P

Query: 1335 A 1335
Sbjct: 201  A 201

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

            P F    + L    G AA+F C + G P  E +W KD  ++  S +++I  D +    L 

            +S++   D   Y+CKA N  G   C AELI+

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 67/319 (21%), Positives = 123/319 (38%), Gaps = 53/319 (16%)

            + + D   R   Q   P+F +KL  +    G  + ++C+VS   P +  W  +GK + T+

             K+ ++  E S+ S+ +     ED   Y C   N AG   CS  +TV + P S   K P 

Query: 1201 MKSRRPKSSL---------PP---------------------VLGTESDATVKKKPAPKT 1230
             +   P S++         PP                     + G+ S   +    A KT

                                    PP+ ++  E  K V+AG+S  L  K+ G+  I   W

             +   ++  S+  ++   ++ + + +     E  G +    +N  GS      + V + P

               +  P    ++++ ++L

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

            +P   P+F      ++V+ G +A F+C + G     + W KD++ IR   ++ I     G

            N   L I  V   D  +YTC+A N +G+  C+A+L V+

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

             P   P+F + +R+L V   S A   CK+ G+P P V W++  +  I +   ++I   + G

                LII+ V  DD   Y  +A N  G  + TA L VE

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

             P F    R   + EG    F C+I G P PE+ WFK++  I  S +  I    +   SL 

             I +    D  KYT KA N  G+ + TA L+V  + E

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 41/159 (25%), Positives = 71/159 (44%), Gaps = 5/159 (3%)

            R  W   GN + AI +   ++ I GL+  + S G+          E+  D   A      

            E K    P F + ++ +EVV+ S    +C++ G P  EV W K+++ IR S+ + +  D 

                +L I+     D  +Y C   N  G  +C+  + ++

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

            P FS     +E ++ +    +C++ G P  EVVW+KD + +R S+ ++I   ++ + S+ 

            I +V   D  +Y CKA N +G  TC

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 35/113 (30%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

             P PP   P  +D   SS  L W     DGGS V  Y +E  +   + W++      R T 

               V  L     YKFRVRA+N+ G  EP + +++  + ++   P  +++ S  D

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

             KP  P   P   D    +  L W     DGGS +  Y +E        W  +      R 

              +F V  L+  +EY+FR++A N+ G  EP + +E     +    P+ E++V+  D

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 60/243 (24%), Positives = 94/243 (38%), Gaps = 33/243 (13%)

             TES   + K    K  P    PP++ +  +++        E  G   +TG      +  +

               W+   K       MKV+N              +H   + +  EN++G  +  +    V

                DP  P G P      D    S+TL W    YDGG+ +  Y +E+       S ++ W

             K     A      F V  L  + EY+FRV A N  G   P++  E     E  E P+ ++

Query: 1436  EVS 1438
             + S
Sbjct: 18609 DAS 18611

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

             D+  S++TL+W    YDGGS +  Y +E   +  + W ++ T + T     V  L    +

             Y FR+RA N  G SEP +     TV

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 65/266 (24%), Positives = 104/266 (39%), Gaps = 36/266 (13%)

             AP F   L++  V    +  L C V G P P + W   G+ I     +Y     + G  +

             L I     +D   Y   A N  G VS +A + V                P+K   P  L+

             G+  +  + G  V++ +  SG P P + W   G ++ ++   H++   T+    +  VFP

                  +D G Y   A N  G   +     V  V +P  G +   +S+       +  AS 

             G S + +  +         WLR G+A

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

             PDPP        I  +++ LSW     DGGS V  Y +E   WD   +  + W++     

                  F V+DL+   EY+FRV+A+N  G S+PS      TVG    ++P+ P

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 163/845 (19%), Positives = 282/845 (33%), Gaps = 134/845 (15%)

             + G + K    + G P P + W+++ + + +     L C +  T  L    + + DR   

             G Y  +  N  G+   T+ + +        G P+  KT+         E    +W     

                 K+   +V++ +  R    +      +        +KGN  +            +P 

                SV  KN        G+ +   +   +  VV     A   +++S   ++  D  +  +

              +  K T  D R++VT +              + + C+    G  P        +P    

             K     D P    +  +   T SSITL  ++   +      G  V    GEE +      

                  T +       PG+     VS    A +  P+E             P+        

              S   K  + V+      G P P V W  +     +  GS   Y  E+  S  L  +   

             TR D+G Y  T  N  G+   S T+ V         ++L V  V+    ++L D  +I+G

                ++   +      + TW +            +       + D   +    +  LAEN 

             +G                   E   PV  ++  API    + D               DG

               V     V      E  W H G  I ++ +    Q   Q  L  +     + G      

               + G +  + ++   E      P        VT  +G +V +     G P P++ WL+D

             G  L K++      + E+  TL +K  +  H G+Y ++L N V  C   V + +      

Query: 818   ALPRG 822
             + P+G
Sbjct: 27658 SKPKG 27662

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 12/132 (9%)

             + +  EN  G  S       T+   P  P GTP   D+   ++TL W     DGGS +  

             YSIE     N+ W      +++ C+   + V  L P   Y+FR+ A N  GT S PSQ S

Query: 1420  ELTTVGEKPEEP 1431
              +    ++   P
Sbjct: 27945 GIIMTRDENVPP 27956

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

            +EAV  +   VKP F + ++++ + EGS      +  G P+P++VW K+   I   ++ +

            I  +   G  +L I      D A YT  A+N  G  T   ++ VE +E  E E E +

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 90/398 (22%), Positives = 150/398 (37%), Gaps = 53/398 (13%)

             G+ + +V  K  + R+ + G R     KF S  + Q VKE +T  F CE+S   K  V W

             F     +     ++ +  +  +H L + +    D                        +L

              V+E  P F+  L D   +E  +  L+C V    VP + W  +G+ I      S    G+

                L I+ A  +D G Y C      G     A VTV  +           +   KP    

                 L  ++V  G      +++S  P     W   G  +  S D    + G +H L +  

                  TG  + +A N+    ++ A L V+E        FI+    V           C +

             + +P  T  WL+  + +  D   FE++++    ++V+K

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 82/353 (23%), Positives = 125/353 (35%), Gaps = 50/353 (14%)

             F+ KL    +  G+   L  + S  P   + W  +    L+  +  I +   +L    I 

             KA   D G Y  V +N  G  +  CQV V D P                   PPV     

             D   K        P        I     +K   G+ V +    + +   TC   K  K +

             +  +++   ++EN                Y +       S +A+    V D PD P  T 

                D    S  ++W    +DGG  + +Y +E  ++ +K W  +        T F V DLL

                +Y+FRV A N  G  +PS  S+     +   +P   V     D     VD

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

             +QL  PV++K L                   PP F        V  G+  +      GRP

              P VTW K NVPL+ + RV+        +L I    ++DVG Y   + N +G+A

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 44/77 (57%)

             V+ GQ  +    I+GRP+P +TW K  +PL+ + R++V++   +  L I   ++DD G Y

                V N  G+ + S E+
Sbjct: 23301 GITVANVVGQKTASIEI 23317

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 25/72 (34%), Positives = 40/72 (55%)

             ++ G+  +    + GRP+P ++W+K   PL+ + RV+V E     VL I   N+DD G Y

Query: 232   TCLVVNGSGKAS 243
             T    N +G A+
Sbjct: 24383 TVTATNSAGTAT 24394

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

             P F+  + +     G   RF   I  +P+P V W+K  Q I+     + +  + D+ G  

              L I+ V  DDDA+YT  A N  GE +C A+L V

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 51/230 (22%), Positives = 81/230 (35%), Gaps = 35/230 (15%)

            +R++ + L   P+F    + +   +G+    E  V G     + W ++ Q I++  ++  

                   F L I  +   D G YTC ATN +G  Q +  LTV+                 

                              PP F  K     V      +    + G     + W K N  L

               A  SV + +    LE+      D G Y C + N  G A+  A L ++

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 84/388 (21%), Positives = 136/388 (35%), Gaps = 87/388 (22%)

             ++ G   R    I GRP P+V W K +  ++ +A + V+      VL+   VN+ D G Y

Query: 232   TCLVVNGSGKASMSAELSIQGLDSAN-------------------------------RSF 260
             T  + N SG  + SA ++++ LD+ +                                  

             V + +AT       VTN      K+D L+          A        P +   P   A 

               PQPP +  ++    +  +   T       S I      +Q +         R   L  

             +  +   GEE          K  + PR    P     + ++D+V +              

               P  +    S  V+  Q +K    +SG PKP + W  +G P+ +Q   I V +      

             L + +    D G Y  T +N  GQ + S

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 1/111 (0%)

             E  A E    KP     ++D  V   S A+F  K  G P P  +W KD ++I +   +++

               D+ G   L I      D   YTC   NS G  + + +L ++ +++ E +

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

            PYF+K  + +EV++        ++ G P  E+ WFKD+  +R  R ++  + +D   SL 

            I      D  +Y C+  N +G + C+A +

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 53/245 (21%), Positives = 82/245 (33%), Gaps = 35/245 (14%)

            V S+ L   P F+    ++    G   + +  + G     V W ++   I      +   

                  +L    V   + GKYTC+  N +G ++    L+V                    

                            P     K   + V  G      C + G P+    W K    L  

              +  +S  N +  L+I  V   D GVY+  V N  GK S +A L +    +   SF R+

Query: 264  TKATN 268
             K TN
Sbjct: 7688 LKETN 7692

 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 37/110 (33%), Positives = 60/110 (54%), Gaps = 6/110 (5%)

            LE  AE +   +P  F+K I+++ V E  +A F+C++  + D  V W+K    + ES+ +

              ++  DG C  + I +V  DD+  Y+  A +   GEA  TAEL + T E

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 25/93 (26%), Positives = 54/93 (58%), Gaps = 2/93 (2%)

            P F K +   ++V+ G ++R +CKI G P+  VVWF+++  +  S  +++ +  D    +

             ++++  +D   + C+A N  G  +C+ ++IV+

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 89/404 (22%), Positives = 153/404 (37%), Gaps = 60/404 (14%)

             +VV+ G   R      GRP P++TW +       + +V + +      L I   +++D G

              Y   + N SG  S SA ++++ LD+         K    +VRK+   ++ +   +D   

               AK KN    +R  +    AN   +  + S K+E+  +                     

                      P + P    L    +TS+S+  +        R  G  V + P G E K   

                         GL S        KA N +         +P+  +  +  P  +    + 

              ++  + +K    V G P+P ++W  +G P+ +Q   + V E A S  L + +    D G

              Y+ TA+N+ G  + + ++ V       V P  F  V  D  VI

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/82 (29%), Positives = 41/82 (50%)

             +++K G+  R    + GRP P+VTW K  V ++    + +++  G   L +    +D  G

             VYT    N SG A    ++ +Q

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/92 (26%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

             P   K ++D+    G AA+  C+I G P P++ W++  + + +SR +++  D   +   +

             +++   +D+  YTC A N +GE   +++L+++

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

            +G A +  CK+ G P  ++ WF +D+ I+ES   ++ + E     L ++DV  +D  +Y 

            C+A N  G   C++ +IV+

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 37/113 (32%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

            S E  S +    VA ++P   P F K I +   V  S+A F   + G P   + W KDDQ

             + E  +  I +  D   +L I  V      +YTC+A N  G   C A L+V+

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 50/235 (21%), Positives = 84/235 (35%), Gaps = 48/235 (20%)

            P F  K   V +A G+    +C V+   P  I W  + + ++      ++   +  ++++

             K    D G Y C A N AG+  CS Q+ V +                            
Sbjct: 7272 LKVGKGDAGQYTCYASNIAGKDSCSAQLGVQE---------------------------- 7303

                               PP+ I+  E  + V+  E      K+ G+  I   W K   

            +IQES   ++   ++ + L +     E  G YT    N  GS  +  +L V + P

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 48/199 (24%), Positives = 78/199 (39%), Gaps = 12/199 (6%)

             PT  +       + V  G  V + + ++G PPP   W   G++++ESE    E       

             L I+E    DTG YT E  N  G    T  V+ + +P   T P  I +    S+T S   

                 G + L    +         WL   +++ + T  F  L   + +   +     +  G

              Y   L++ V EC   + +
Sbjct: 29916 SY---LQSEVIECRSSIRI 29931

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

            AP FI  P    + EG +  F  +V G P+P V W ++G P+T+G R+ +    + G   

            LVI     +D G+YT    N  G    +  L  E  +

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

            P F KT+   ++V G+ A   C++ G    E+ WFKD + IR S+ +++ + +     L 

            I      D  +Y C   N +G+  C A

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 2/119 (1%)

             ++A+  +   D  Q  +  +A++   + P F        V+ G   + D    G P P V

              W KD+  ++++     +  E+ N  L I D C +D   Y  K  NS GEA  T  +IV

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 62/233 (26%), Positives = 97/233 (41%), Gaps = 22/233 (9%)

             K   P TP     PP+    P +       SV L     K  G   +T  +++ ++   +

                 H K + +     +T L    E+   + ++ +N +G S  +  +  VV     DKP 

              P      S I   S+TL W     DGG  +  Y +E   S +  WK+      +   F 

             +  LL   EY+FRV A N  G S P     S +++LT+ GE P   K+  +V+

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 8/183 (4%)

             P F+ + ++  V+        C+V+G PKP V W+ +G  +        + E  G ++  

             ++ + T D  T Y   A+N  G +S + +L+VE  A + + P     +     + G+   

             ++    G P P ITW   GQ +       +  V         P     +D G Y   A+N

Query: 588   ALG 590
Sbjct: 31106 RFG 31108

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

             V +EG   ++ CKI    Q  QVTW  G   L+ S +  ++ ++G+ +L +  + + D G

              Y C VVN  G+ S  AEL ++G+      + R T

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 54/233 (23%), Positives = 82/233 (35%), Gaps = 48/233 (20%)

            F +KL+   + + G    L C+V+  PP  I W  N + +K +    +S   S   + + 

                ED G Y C A+N+AG   CS  V V ++P                           
Sbjct: 4361 DVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPY-------------------------- 4394

              T + KP                     +V     V L  +V GT P   TW K    +

            +     K    ++   L IL       G Y   V N++GS      +T+ + P

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 72/338 (21%), Positives = 111/338 (32%), Gaps = 54/338 (15%)

             ++ H+  G  L L   +   P   + W    +   T   I ++  GS   + I  A  ED

              G+Y    +N AG    S +V V D P              P+      +  +S     K

             +P                         G SV     V      +  W       ++  H 
Sbjct: 17332 EPLDD----------------------GGSVITNYVVERRDVASAQWSPLSATSKKKSHF 17369

                 +E    L  +AA            EN+ G          +   DP  P G P    

               D+  + ++L W     DGGS +  Y +E  +   + W +  T  +    V  L     

             Y+FRV+A N+ G   P     +    EK   P  E++V

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

             L IK G + + +  V+G P P+VTW ++G  I       +   + G+ SL +     + R

             G YT EA N SG+ +  +++ V+ +  K +G    +   G++ +

 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 27/96 (28%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

           ++A P F  + QS  V++   V+ +  V+GIP P V ++ +G  + +     ++ ++   

           + L + +A   DSGTYS  A+N+ G+ + +  L V+

 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 51/244 (20%), Positives = 83/244 (34%), Gaps = 55/244 (22%)

            AP F + L++V         L C+++   P  + W  +GK +  + ++ I   EG+  S+

             I +    D G + C A N  G  + S  + V +                          
Sbjct: 4171 EIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQE-------------------------- 4204

                                 PP  +  P  + V  G +V L     G+ P+T  W K  

            K++       +      S L +   +    G YT  V N  G  +   NL      T V+

Query: 1330 KPDP 1333
            K +P
Sbjct: 4304 KLEP 4307

 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

            + ++V E      +C + G P+ +V W KD + I  SR+F + + E+   S  I  V   

            D  +YT K  N  G ++C A L V

 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 18/153 (11%)

             W K  K +  + H KV     G               + +  EN  G          +  

             +D  +PP      +DI  +S++LSW   ++DGGS +  Y +E  D  +  W +       

              T F +  L  + +Y+FRV A N  G+ S PS+

 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

            V P F + ++D+  + G++   +C++ G     V WF+D   I      Q  + E+  C+

            L +S +   D   YTC A N  G   C+A L V+

 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 34/92 (36%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

            P F K + D+  V G   +    IEG     VVWFKD  + +RES +  I Y E+   +L

              S V   +  KYTC+  N  G   C A L V

 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

             +  P PP   P  +D  S+++ L W   +++GG  +  Y ++        W        +

                + V+++    +YK RV A+N  G   P  E++  TV E  E P  E++VS

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

            V P F++ +++   V G++   +CK+ G     V WF +   I     +Q  +  D  C+

            L ++ +   D   YTC A N  G   C A L V+

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 71/323 (21%), Positives = 113/323 (34%), Gaps = 62/323 (19%)

             PP T+ W  + K L +     +    S   ++I +    D G Y    +N  G+ + S  

              V V D PA+      +  SR   + L  PP++   S   +  ++K+ A K         

                                            TW     +   +    ++ SE        
Sbjct: 27411 -------------------------------TWSVVSHKCSSTSFKLIDLSEKTPFF--- 27436

                      + +L EN++G  +       V   + PA     S  D   +S+ LSW    

             +DGGS +  Y +E      +TW      ++    V  L      +FRV A N  G S+P 

                 + TV E    P  EV++SD
Sbjct: 27548 TIGPI-TVKELIITP--EVDLSD 27567

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 41/157 (26%), Positives = 69/157 (43%), Gaps = 9/157 (5%)

             SE   K+T L    E+   + ++ EN  G   A     L    +P  P G P     +D 

               ++++L W    +DGG  +  Y IE+  +    W ++    C  T + V DL    EYK

             FRV AIN  G  +  + +      ++   P+ +++ +

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 31/92 (33%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

            P F K + DL  + G        + G     V W K  + IRE    ++ +  +G   LI

            I DV      KYTC A N  G  T   ELIV+

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

            S A L   A + P   P+F++ ++D+    G    F+C+I G    +V W+KD   +++ 

             + Q  +  +   +L I         +Y C A N LG A+ +A+LI+   E

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 55/281 (19%), Positives = 99/281 (35%), Gaps = 50/281 (17%)

            AK    ++P GN K    EN  + +  ++ K       C   +    D+          P

             F +KL+   + +  +    +C++   P   ++W  +   ++ +    +S   S+  + +

                 ED G Y C A N AG A  S  + V +                     PP+    
Sbjct: 7366 HNLSVEDSGDYTCEAHNAAGSASSSTSLKVKE---------------------PPIF--- 7401

                 +KKP P    K                  G  V L  ++ GT P   +W K +++
Sbjct: 7402 -----RKKPHPIETLK------------------GADVHLECELQGTPPFHVSWYKDKRE 7438

            ++  +  K+ +    + + IL       G Y     N +GS

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

             G  P    + + VT  LG++  +SC I G P P + W R GK L + +  +++  +    

             TL +   +    G Y  +  N VGE      L+LQ

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

            V P+F      +++  G +  F C + G    ++ W KD++ IR   ++++   E+   +

            L +  V   D  +YTC A N  G+ +C+A+L V+

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 12/155 (7%)

             S P  E +     E P  F     L  + VK G        +TG+P+P++TW K ++ L+

                R+++        + I    + D G Y    VN  G+A+   E+++            

              D  N S +        D   ++TN + +    DS

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 10/118 (8%)

             P PP G P        S+ +SW     +GGS +  Y +E  +  +  W  ++        

              +   FNV  LL   +Y+FR  AIN  G   PS+ S+    G+   P  P    EV D

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 76/335 (22%), Positives = 109/335 (32%), Gaps = 60/335 (17%)

             G  + L   V   PP  I W+     L+    + +        +  E     D G Y   

              +N  G+ E +  V V D P                   PPV  T  + +         P

             P       II +   ++       +   K   T    C+   FR          V N E 

             G               + +  EN+ G          V     P G      +RS   SS 

             ++ W     DGGS +  Y ++     NK W+ +    S  ++ +DL    EY FRV A N

               G   P   SE+T V       +D+V   D D K
Sbjct: 19960 ENGEGTP---SEITVVA------RDDVVAPDLDLK 19985

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

             S +  +GQ + I   I+G P PT+ W +DG  L K T    V  + D+ TL +K+     

              GQY I + N VG+ +  + ++

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 83/373 (22%), Positives = 138/373 (36%), Gaps = 43/373 (11%)

             VV++     R    I GRP+P+V W K    L   A++ V+  +   +L I  V + D G

              Y   + N SG  S +A ++++ LDS +      +RE K  +          D   ++TN

              I ++ +      A  + NC+         Q G S  +   +  +       E+ +    

             + P  P  + T   +T   A ++ E        +  G  V   +    K     +  T  

                 GL  G + V   AA         R    P      E KP  +       VK  + +

             K      G P+  V W  +G  + ++   + V        L + +A   D GTY    SN

Query: 492   AQGQLSCSWTLQV 504
             + G ++   T+ V
Sbjct: 25472 SAGSITVPITIIV 25484

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 1/92 (1%)

            P F K I     + G  A F   ++G     V W KD   I E  + ++ + E+   SL 

            +S +    D KY C+A N  G   C+A L V+

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 24/81 (29%), Positives = 40/81 (49%)

             + VK G        + G+P P V+W K    L+P+  + ++ +  +  LE+  VN+ D G

              YT    N SG  S + +L +

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 67/319 (21%), Positives = 114/319 (35%), Gaps = 50/319 (15%)

             W+  GK ++ +    ++   +   ++I+ A  +D G Y   A N  G      +VTV D 

             P                   PP     S+ + +K     TPP       I  +  +++  

               E+  L             W    + IQ   H+  +  + G++     +   H G    

                   G       + +VD+  P  P   P  S++  ++ T+SW     DGGS +  Y +

             E  +  +  W        +     V  L     Y+FRV A N  G   PS+ S+   + +

Query: 1427  K--PEEPKDEVEVSDDDEK 1443
                P  P     V+D  +K

 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 15/123 (12%)

             I++T++++ P    S P+T   A  +PPR          L +K G     +  V G P P

              V+W ++G  +    G +  +    R   +L + +V+ +D G YT  A N SG++  T++

Query: 121   LTV 123
             L V
Sbjct: 19383 LKV 19385

 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

             +  +D   PP     P  +D   +S++L+W     +GGS V  Y IE+       W +  

              C +T   +++    H     EY+FRV A N  G  EP++      V E  E P  E++

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

             + + PS        ++  G+D  ++  V G P P I+W+ +G+P+ Q  R   E  A   

              LHI++   +D G YT  A N+ G  + +  V V EK

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 19/126 (15%)

             +QLG PV+++          +E +PS+  E P  F T      VK  +  +      GRP

             Q  V W K    L+ + RV+VS    +  L I   +++DVG Y   V N +G  S++  +

Query: 249   SIQGLD 254
             +I  LD
Sbjct: 25481 TIIVLD 25486

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

             C  TN         ELT +  +  +    V ++   D  S P+  T P I  +   PP+ 

                +     +VVK G++ + +  I GRP P ++W K  + ++  AR  +   +   +L +

                 + D G Y   + N +G  S++    +

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 38/158 (24%), Positives = 63/158 (39%), Gaps = 9/158 (5%)

             AV +  + S M   S +   KS        L++ +  +  ++  A LE  + E+      

                T+        R + V EG +ARF C  +G P P V W +  Q +  S   Q+   + 

                +  IS V   D+  Y+    NS G+      L ++

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

            +++   KP+F K +  L +     A F+C++    DP +V  W  D + +  +   ++  

            +E G CSL        D    TC+A N  G    +A LIV+

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 1/92 (1%)

            P F K    LEV+ G    F   I G P  +V WF+  + + +     I Y ED    L 

            + ++      +YTC   N+ G+A+CT  L V+

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 9/182 (4%)

             G  P+T  ++  ++++      KV +     + T+    Q     + +   NK G  +  

                  VN+ T    PDPP       D  ++S+ L+W     DGGS ++ Y +E     + 

              W         T   V  L     Y +RV+A+N  G S+PS+ +E     +  E P+  +

Query: 1436  EV 1437
Sbjct: 13693 DV 13694

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 82/417 (19%), Positives = 152/417 (36%), Gaps = 61/417 (14%)

             K    ++    + G P P+ +W  +G   +  ++G  ++ EDA       S  + + + +

                +G YS TA N  GQ + +  ++V       + L V ++      +       +G D 

                  ++G  + + T  ++G+        C  G     + D L E    +   AEN  G 

                   V   ++ ++R      P+ P  P           +K+  G     TV +S  PP

                            + W   G + +     + ++   +    ++++       +  +A 

             N+AG  +  A +   +      P  I     +    G +V I   I G PFPT+ W +  

                 D K       H   L  +D  TLV+ + +    G Y I   N +G  S ++ L

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 17/144 (11%)

             P D   +  +A NA+G +S            S+ S  ++     V P     P +  GL 

                +  G  + +   V G P P V W  +G EI++  +          SL +++   +  

             G YT EA N++G  + +  + VQ+

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

            ++  + P F++ ++D+E   G      C++ G    +V W++D   +R+  + Q  +  D

               +L I         +Y+C A N LG A+ +A L

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 47/244 (19%), Positives = 83/244 (34%), Gaps = 35/244 (14%)

            S+   E P F+    +     G   +    V G+    V W ++   +           I

                +L + +    + GKY C+  N +G R+ +  LTV                      

                          P +   K   + V  G      C +TG P+    W K    L   +

            +  ++  N +  L+I      D G+Y+  V N  GK++ +  + +        SF+R+ K

Query: 266  ATNS 269
Sbjct: 6749 DVNA 6752

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

             +++P PP     +SD   SS+ L W     DGGS +  Y IE  +     W    +    

               ++ V  L   ++Y +RV A N  G S+PS+     T  +   EP  ++    D

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 7/133 (5%)

             +P++  T T L E A  Q    A   V+    S  S+ +  +A +  P   + +   S L

              V  G+ V +   V G P P V W  +G  ++ +E     +   Q +LC  E+F    +D

Query: 690   TGTYTCEAWNSAG 702
             +G YT  A NS+G
Sbjct: 19363 SGDYTITAENSSG 19375

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 25/82 (30%), Positives = 36/82 (43%)

             + KE    R    I G+P P V+W KG  PL    RVSV        L ++   + D G 

             YT  + N +G    +  + + G

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

             LT  P+  LP     I+ G   K E  V G P P ++W ++G+P+    R  ++     T

               L I   +++D GKYT  ATN +G     + + V

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 1/119 (0%)

             NA    S    S   +    E  P +  +  +    L +  G + R    ++G P P V 

             WFKD   I +  + +I  D  G+ SL + D   D    YT +A N+ G A    ++ V+

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 173/894 (19%), Positives = 314/894 (35%), Gaps = 157/894 (17%)

             I+ G+    +  V G PEP++ W +  + +    +  L   G R T   VI      D G

             KYT    N SG + V+V + V  S     G+  VS+   ++    +S P  +    I   

                +  T     V+ EG+    S  +T   +      +V  +    P  P     +  +N

                +    G+ ++   G    ++     ++    E+S   +D   +  +R T+       

              D R +VT+++               + C    R  +   A NS+P     S   SC++ 

                  P +AP+  V+  T  SI+L   +   +     +G +    E+           A 

              R   F      +G +     AA   + ++G  + +    E +P                

             ++  ++   +++    VSG P P + W  +G  +     S  + +   S+ L ++ K   

              D+G Y+  A N  G+ S +  ++V         + V EV+    ++  +   I+G    

                   G PV   I          +   T +       I   +      +  L EN  G 

                   S  V V E          +P+ P+K            L+V+D ++ T+T  ++ 
Sbjct: 29620 GEPCETSDAVLVSE----------VPLVPAK------------LEVVDVTKSTVT--LAW 29655

               P     L++G            + GT+  + +  + P   E T T   E       +R

              Q    V EP +      +   R             ++    G+ V +   IAG P P  

              W   G  L +++    V  +  V  L +++      G+Y + LKN  G  S  + +++ 

             +               A ++    EP   +    GG    G   ++  + RPGW

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

             P PP G P         + + W     DGG+ + +Y ++  +  +  W  +        T

                V  L+   +Y+FRV A+N  G SEPS+ S   +  E    P

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

             V +   S  S++   ++P     +P  E    +   + + I+ GA+ +    V G P P 

             +TW + G  + S  R ++D        L++  V+  D GKYT EA N SG +  TV + V

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 74/370 (20%), Positives = 134/370 (36%), Gaps = 58/370 (15%)

             EG  +   C++ + D    + W    + L+ ++   ++ E  +  + ++     D G Y+

             C   ND G+     ++ V         +  +   RR               T+KK K   

              T      PP+      ++    GE+V     +T       TW K  ++I+  ++ K   

              E+ +   +LTI +   +    YT++  NK G    +  LTV   P P            

                     G     +IR S +   TL W     DG       +IEI       +      

                + +++D LP+    +RV A N  G++      ++  +  K +E K + E     +K+

Query: 1445  PEVDYRTVTI 1454
              +   R   I
Sbjct: 31909 IDKTLRMAEI 31918

 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 47/217 (21%), Positives = 87/217 (40%), Gaps = 29/217 (13%)

            C   N+    QC  H      P+ ++  ++ +    ++ ++K  +        KW K   

                 A R++ +  +   +   + + + +G+    L+        DV  A  +A    +E

             P    +  K    L +  G +  F+C+I G P   V W+ D   I   +   I +  DG

              +  IS    ++   Y C+A N  G A+C+ EL V+

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 2/95 (2%)

            + P F+K + + +E  EG++ + + ++ G     V W+K++  I+ + + +I + ++   

             L +     +D   YTCK  N  G A CT+ ++++

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 37/120 (30%), Positives = 50/120 (41%), Gaps = 11/120 (9%)

             GLG  D         IP+E Q     P  E   +  E   VK   TV+F   + G+P P 

               W  +G+ ++  E    V  D  S  L +     RD+G Y  T SNA G  + +  L V

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

             LP      KE +  + +  ++G P P V+W +   P+ +  R  ++     T +L+++  

              + D GKYT    N +G ++ T+ + V G

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 34/121 (28%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

             S ++  +  P+ P      E++    E V    + A  +    +K   SK I  L  VVE

              S  R           EV W+KD + ++E+ HFQ  Y  DG   L I+++   D  +Y C

Query: 1832  K 1832
Sbjct: 32792 E 32792

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

            L+DV+V EG K +L+C+VS     ++ W LN + +K    +    +G+   + I +    

            D G YK +     G+ E +C ++V+

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

            P F K + D   + G A      +EG+    VVW KD  + IRES + +I +  D   +L

             +      +  KY C+  N  G   C+A L V

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 1/102 (0%)

            ++  ++P   P F + +  + V EG   +  C ++G     + W K  + I+ S      

            +   G   L + DV   D   Y CKA N  G  T  +++ ++

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

             PHV+  F + + DL+V E   ARF+C++    + +V WFKD   I++ + + I   +   

               L+I+    DD+A+Y+C+

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

             ++E  P +   L    +  G+   ++  V+G PVPR+TW  +G  I+   +   T   G 

               L ++DA  +  G YT  A+NA G       V V +

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

            E  H++  F K I+D++V+E   A F+C++   PD  V W KDDQ ++ +   +I  ++ 

             +  L+I      D  KYT  A    G    TA+L VE

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 1/92 (1%)

            P F +T   +EV+ G +  F   I G P  +V WFK  + +       I   ED    L 

            + +V   +   Y+C   N  G A+CT  L V+

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 97/438 (22%), Positives = 161/438 (36%), Gaps = 66/438 (15%)

             RQ TV+   EG+  K     V +   G     P  ET+P    E     A +L     G 

             + +  G+  R    +TGRP P   W K    L    RV +        L I    + D G

              Y     N  G    +A           L ++ + +  +  +        D   E+T  I

                K++K+ +    +E      + +    G    +   ++ +    PP E       D  

              P T+P+     ++T S+ITL       EPR+ G   +     E++R   P         

              PT    + + D         KA N        +P+    Q D   P    +   +  + 

             +VK  + V    +V+G+P P++ W    T + +   ++++ ++  S       L + KA 

               D GTY+ TASN  G +

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 36/144 (25%), Positives = 58/144 (40%), Gaps = 30/144 (20%)

             +V P+FSS     +V  GQD  ++  + G P P ITW  +G P++       T    +  

             L I++   +D G Y     N +GQ + S  +   +K             P  P  P+   

              +S            ++ +S NPP
Sbjct: 23334 DVS----------AESITLSWNPP 23347

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

             +  G  + + + V G P P + W+ +G  ++++   + E+  T   L I+E   +D G Y

             T  A NSAG      +V+ +++P

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 168/821 (20%), Positives = 276/821 (33%), Gaps = 127/821 (15%)

             +K G   + E  V G P P + W ++G+ +    +  +      T +LV       D G 

             YT  ATN              G FAK +    V    G      +   V +   +    P

             P      K+   +V++ +  R +       + QVT LK    L+ +    RV    K G+

                     VL ++     D              +  C     S   S      ++  D A

              + +++  K T +D+R +V+ +    E +   +   A   +  SP            +P 

             PP   + L++ + S   A   P+    S           PE        P A GL   S 

             +          +   +     GLG   +V    KA +R +P E + D+   K  +     

              ++   T++    + G P PEV W  +       E   +   ++ S Y  L+       D

             SG Y  T  N+ G  S    ++V       + L V EV  +  ++  D  +++G   +  

               V      R       +      + C     ++   D L E    Y   LAEN  G + 

               A      K S R      P+ P K T            +MD ++   +V +S   P  

                 H+G           + +G+ + + C      E T T   +    +  V  Q    +

              +P   + P  I+K             + T   G+ + +     G P P V W +D   L

              K T        E+   L +K       G Y + L N  GE

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 57/219 (26%), Positives = 87/219 (39%), Gaps = 16/219 (7%)

             P  PP A   P++     +   +R  E         G   I   W+  K R  I   +  

             KV   E   K+T L    E+    Y L       + +A   +   +  D P G P  +D+

               S+++L W   +YDGGS V  Y IE   + +  +  W +          F V  L    

              Y+FRV A N  G  S+ S+ +   T  ++   PK E++

 Score = 44.7 bits (104), Expect = 9e-04
 Identities = 41/156 (26%), Positives = 64/156 (41%), Gaps = 6/156 (3%)

             W+ +G+ I+ES    F   G    L I +V   D G YTC       E  + A L V+E 

                   +  +    VT   GQ + +SC +  +    V W +DGK + +  G         

             +  L +       AG Y + ++N    ECS  V ++

 Score = 44.7 bits (104), Expect = 9e-04
 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 4/112 (3%)

             P  P G P   D+  S+++L W    +DGGS +  Y +E        W    T       

               +    L    +Y+FR  A      S PS+ S+  T+  +   P+ ++ V+

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

             L +K G T +F   +RG P P   W  +G  I +   + ++      FS  L I      

             D G+Y    +N +G++ V V LTV

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 2/123 (1%)

             +EK  S   +  +PV A      P F    +   V+ G  + + V   G P P V W  +

                ++++   + E       L I++   ED G Y  +  NSAGE + T  V+ + +P   

Query: 719   TQP 721
             T P
Sbjct: 22245 TGP 22247

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

            + V  G     +CK+ G P+  V W+KD + +  S+  +  +  +   SL I  V   D 

              YT +  N++G+++CTA

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 54/235 (22%), Positives = 90/235 (38%), Gaps = 42/235 (17%)

            D S   ++ +   P F   P  +   +G+    +  + G P  +V W ++ + + +  +F

             +      T SL I  +   D G+Y C+ATN  GS     +V+      F K+L     S

              +GD     AVE R  + G  P                               V WLK 
Sbjct: 6562 TLIGD-----AVELRAIVEGFQP-----------------------------ISVVWLKD 6587

             G V ++ S    +S  + +  L++      + G Y C + N +G    SA L++

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

            ++V  G     +C + G P+    WFKD + +     ++I +    +  L I +V   D 

              Y+ +  N +G+ +CTA L V

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

            P F +    ++V+ G+   F   ++G P   V WFK    +       +   ED    L 

            + DV      +YTC   N  G+A+CT  L ++

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 81/381 (21%), Positives = 132/381 (34%), Gaps = 74/381 (19%)

             V+V+ G   R    + GRP P+VTW K  +      +  V   + M  L I    +DD G

              Y+  +VN +G+ ++   + +      +     S V +T          +D   +VT+ I

Query: 280   SKESKLDSLE----------------------------AAAKSKNCSSPQRGGSPPWAAN 311
              ++ + D                                A        P     P  A++

               S+P PPR+ ++     +  T    P L+    K    IT      QP  R     V+ 

                        G++ K     R A   + P    G      V +A  + +P         

             PK    P+   +K  + ++    V G P P   W  +G         + V++   S  L 

             +     +DSG YS TA N+ G

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

             PPK      ++ +K G+  R    + G+P P   W KG   +  S+ ++V + +   +L 

             I  V + D G Y+    N SG

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 1/92 (1%)

            KP+F K +  ++         +C+++      V W KD Q +   + ++I + ED   +L

             I      D   Y C A N  G ++C+A + V

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

             VK V ++ +SK S +V P    R D  P  +   F+       ++EG       +++G P

              P +TW +       N +P+   T   + ++D     T +LVI      D G YT  A N

Query: 111   GSGARQVTVELTVEG 125
               G     + L V G
Sbjct: 16201 NLGTASKEMRLNVLG 16215

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

            + +KT++++EV E   A F+C++  +  P  +W K+   I  S  F+I      +  LII

             +   +D A+YT    N    AT T   I+ T    +   EE++

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

             +EV EG+      KI+G P P + WFK      +++   + YD        D  C+L+I 

                  D   YT  AVN+LG A+

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 7/118 (5%)

             + V+ GQ  R   ++ GRP+P +TW K    L    RV + +      L+I    + D G

              Y     N SG A  SA +++  LD       +  K TN  V KE    IS E+ LD+

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 1/102 (0%)

             E V E K  + P        + +  G   R +  + G P P   W K +  +  S H  +

              +  D +  LII DV   D   Y+  A NS G  T   +++V

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 36/121 (29%), Positives = 49/121 (40%), Gaps = 7/121 (5%)

             NA  + SE   S   + A  E  P    + P +  TI    V  G + + D  I G P P

              + W K DQ +  +   +I    D   SL + D    D   Y  KA N  GE + T  + 

Query: 1848  V 1848
Sbjct: 22633 V 22633

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

             P PP      S +   S+TL W     DGGS +  Y IE  +  +  W  +         

             V+   L    EY++RV A N  G S PS+ S L

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 57/243 (23%), Positives = 94/243 (38%), Gaps = 58/243 (23%)

            +G    F ++LQD+ V E     L+C VS   P  I   W  N   LK+  K+ I S+ G

               +++++    ED+G Y  V                                       
Sbjct: 2320 RQ-NLTVKDVTKEDQGEYSFV--------------------------------------- 2339

              + G ++   +K KP P           I+Q   DQKV  G+ V+L  KV+  + +   

            WMK  +++Q S+ + +   +    L I    +E  G Y+  +     S   +V++  VD 

Query: 1331 PDP 1333
Sbjct: 2448 ITP 2450

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 10/98 (10%)

             F K I+D+ + E    GS+A F+C +   P   +  W KD  +IRES +H  I   +D  

               +I  DV   D  +YTC       E T TA+L+VE +

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 33/143 (23%), Positives = 57/143 (39%), Gaps = 12/143 (8%)

             +  + TV G    Q  +  V++K      S P+  T P    +          PKF    

               +VV  G+  R    + G+P P + WL+G+  ++ SAR  +   +   +L +    + D

              G Y     N +G  S    + +

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

            +KS  K +++ K + + +N +  H G   +      + T+ A          F++ ++D+

             V E K+ + +C+VS +P  T+ W  + + L+ T  I + +E  +  + I      D G 

Query: 1168 YKCVAKNDAGQAE 1180
            Y  VA  +   A+
Sbjct: 3127 YTVVAGGNVSTAK 3139

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

             +K G   R S  I G P P+VTW K +      AR+ V+       LEI     +D G+Y

             +  V N +G  ++S ++ +

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 21/72 (29%), Positives = 34/72 (47%)

             ++++ G   R    + GRP P++TW K NV L+    + +   +    L    VN+ D G

Query: 230   VYTCLVVNGSGK 241
              Y   + N  GK
Sbjct: 19763 KYILTLENSCGK 19774

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

             G  + + + V G P P V W      +++++  +FE   T   L I E    D+G Y   

             A N  GEV    V+T+Q
Sbjct: 21140 ARNIVGEVGD--VITIQ 21154

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 25/148 (16%)

             KD  V+  G+ F +   + G P+P I W+   Q +   AR   ++      L ++DA+  

             D G Y   A+N  G+ S    VTV+ K   R         P  P  P+ + G++  K   

                  + DG    +   V       ++W

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

             +P VKP FS       V  G   + +  I G P P + W KD   ++++    +  D   

               +L I +   DD  +Y     N +G+ T + E++

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

             + + I     G P  TV+W +DG+ L K+T    V  ++ V +L +K+      G YE+ 

             + N  G  +  +++++ +      P   +  SC+ +

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

             F + L+D  V EG   +L+C+VS +  A + W  NG + LK+ K+ I++ +G +  + I 

                PED   Y C    DA   + SC + V

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 49/222 (22%), Positives = 76/222 (34%), Gaps = 44/222 (19%)

             L E   F     N+ + E  T K    V   P  +V W++  + I   GR+ +    R  

               LVI   H ED G Y C   +     +V V                             
Sbjct: 12518 I-LVIQNAHLEDAGNYNCRLPSSRTDGKVKVH---------------------------- 12548

                      E   +F +K   + + EG+   F C I+    P V W + +  L+   +  

             V      +VL +      D+G Y  +V    G A  +A L++

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 9/87 (10%)

             G+   +   V G P+P+I W  N   I+      +             EL I  A+ ED 

             GTYT  A N LG V  +  V V+++ S

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 26/93 (27%), Positives = 39/93 (41%)

             P+  + ++ +  L V  G+ V     + G P P   W  +G+EI+  E +  E       

             L I+     DTG Y     N+AG       LTV

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 80/404 (19%), Positives = 147/404 (36%), Gaps = 56/404 (13%)

             V G P P+V W   G     ++G +++ +     +L +  +   DSG YS T  N  G+ 

             +    ++V         L V +V  +   V       +G   V    V      R TW  

                    +  T E      H+ + +P +   +   A N  G       V     K    S

             + L     S+P  P         + ++ +++T         PP    L +G    +    

                E+     R T++S+ ++++    TG        +   A N+ G    +    V E  

             +   P  I  P  +T   G+ + I   + G P PT  W + G+     + H  V + +  

               L++K V    +G Y +  +N  G  + ++ +++ ++     P

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

             +T   G +V +   + G P PTV W +DG  L K     ++    ++ TL L  V    +

             G Y I  +N  G  S  + L

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

             VV+ G   R      GRP P   W K +  L  S R  +   +    L +   N++D G 

             YT  V N SG  S++  + +

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 13/142 (9%)

             +  LA+NA G +S  +  T      + + EY    AP K      L G  DL  +  GS 

             + +   V G P P++IW     E+   E    +  G + +  I+     D+G YT    N

             ++G   T+AV  + +  D   P
Sbjct: 29125 ASG---TKAVSVMVKVLDSPGP 29143

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

             T  D ++ P  E    + G+           V ++ G        + G+P+P++ W KG+

               L    +VS+          I   ++ D G YT  V N SG  ++S  + +  LDS

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 63/277 (22%), Positives = 106/277 (38%), Gaps = 59/277 (21%)

            +N+ + E  TA FE  V  +  P + W +NG  I    +F +   ++G    L+I     

Query: 99   EDRGKYTCEATNGSGARQVTV----------------------ELTV--EGSFAKQLGQP 134
            ED  +YT    N   +  +TV                      E+TV  EG   K L   

Query: 135  VVSKT---------------------LGDR----FSAPAVETRPSIWGECPP-KFATKLG 168
            V  K+                      GD     F A    +  +++ E    +F   + 

             + V E +   F C+++  P   V W+K +  LQ + R+ + ++  +  L I      D 

            G YT +    +G    +A+L ++G D   RS  +E +

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 78/373 (20%), Positives = 136/373 (36%), Gaps = 47/373 (12%)

             V + Q +   CE++   + +V W  +G  V  + G I          L +  A   D+GT

             Y+ T  NA   L CS  ++V    V  +       ++D  V      +  C +     P 

             I W      +  +P        +     L I++A+PED   Y    E         A +T

             + E    R+ E L P+               D+ + +    +   ++S    P   W   

             G  ++ S     +  G +  L + +V  +  G    +A N+     T A+LTV+E     

             +  F    + VT    +     C +  +    V W + G  + K +  F+++ +     L

Query: 780   VLKKVQPWHAGQY 792
             V+   Q    G Y
Sbjct: 11542 VINDSQFDDEGVY 11554

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

             F+K + ++EV E    +  C++   P  EV+W+K D+ I E+  ++I   E     L+I 

             +   +D   Y C+  +S  +      EL  E + + +     EGE+ E

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 12/122 (9%)

             A+  ISK S S  P  + +    E P   + P+    + +  G T + E  V G P P +

              W R  + I    R    C I+ T     L++      D G+Y   A+N +G++   V +

Query: 122   TV 123
Sbjct: 23714 KV 23715

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 8/105 (7%)

             ++VK G     +    GRP P V W K +  L+  A V  ++      L I   N++D G

              YT  + N    AS++  L ++ LD+        T  T  DV KE

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 1/90 (1%)

             +K  ++++ +  V G P P V WF +G  + ++  ++E+ +  GS  L +  A     G 

             Y+  A NA G       ++V+      V P

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

             + P       D+ + EG      C   G P PEV W    + I  +E   F I+ + D  

              +LII DV   D   YT    N  G  + T  + + ++

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 24/96 (25%), Positives = 43/96 (44%)

             +C P    +   ++V EG+           P P V+W K    ++ S R+++   +    

             LE+    + D G+YT  + N  G A+ S  + + GL

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

             P+      D  VIEG+   +    R  PVP ++W  +G+ ++ + R T +     A L +

               ++  D G YT   EN LG  + S  V V

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 57/244 (23%), Positives = 94/244 (38%), Gaps = 35/244 (14%)

             VSK +    P + QR    P  + K +  EV+E   V    ++ G+P P + WF    P 

             ++ +    V  D   + L     C L   ++R  D+G Y+ TA N  G  S    L V  

                  V P  F SV  D   +       +G   +    +      R TW+ ++ +P    

                C   + +L     L      +  +A+N  G         +  +  + ++ + +P AP

Query: 618   SKPT 621
Sbjct: 16321 DKPT 16324

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 25/87 (28%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

             K I  L V  G+  RF   I G P P   W  D   I+   H+ ++ D   +  L I + 

                D  +Y     N+ G  T    L V

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 23/80 (28%), Positives = 36/80 (45%)

             +    G++ ++   I G P P V W +DGK L +     E+       TLV+K       

             GQY + L N  G  S  +++

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 26/85 (30%), Positives = 34/85 (40%)

             V +  G  L+L   V   P   IIWT   K L   + + L   G   +  I+     D G

              Y    KN +G    S  V V D+P

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 3/93 (3%)

            F K + D  V  GS    +    G P   V W KD+  I +S    I   E      I+ 

                +D A+Y+C   N  G+  C  E +V  +E

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

             K SR +E +  V   + P   + ++ L+ L V  G+++ +   V+G P P++ W      

             +++ +    E    + ++ I +    DTGTY  EA N  G  R  AV+ V

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

             K +  L V  G+       + G P+P++ W K D  +++ +   I+ +     ++ I D 

                D   Y  +AVN  G AT   E+ V

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

             P PP      + I  ++  L W     DGGS + +Y +E  D   K W+ +  T + T  

              V  L     Y FRV A N  G S+

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 1/91 (1%)

             P  IL P  + IK G   + E  V G P P   W +    + +     +      +  L+

             I  V  +D G Y+  A N SG     +++ V

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 38/145 (26%), Positives = 62/145 (42%), Gaps = 18/145 (12%)

             ++  +A N +G +S    L V  +A  + + P+F  +     V+ G+D  +     G P 

             P +TW  +  P+ Q  R   E+    + L I+DA  ED G Y     N+ G+   +  V 

             V +K             P  PT P+
Sbjct: 22237 VLDK-------------PGPPTGPV 22248

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 20/81 (24%), Positives = 39/81 (48%)

             +VV  G+  +    I G+P P + W+KG+  L  +AR+ +   +    L +    + D G

              Y     N +G+ S++  + +

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

             ++ G   K E  + G P+P +TW ++G P+    R  +   +  T +L I   H++D G+

             Y     N  G +  ++E+

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

             ++P          +  G   + +  + G P P + W KD + ++++    ++ +   +  

             L I +   DD  KYT  A NS G AT    +IV

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/74 (31%), Positives = 33/74 (44%)

             Q+ + V   G P   V W  +G  ++E+   +     T  SL I+E   ED GTY     

Query: 699   NSAGEVRTQAVLTV 712
             NSAG +     + V
Sbjct: 25471 NSAGSITVPITIIV 25484

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 14/111 (12%)

             +V EP + T P  +      PR          +    G+ + I+  IAG P P + W +D

             G  + ++    E++  ++   L +K       GQY + LKN  G  S  V+

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

             F+K + D  V EG+ A  +C++    + +V WFK+   I +S+ ++I  D      L+I 

Query: 1820  DVCGDDDAKYTCKA 1833
             D   +D   YTC A
Sbjct: 12345 DCTPEDIKTYTCDA 12358

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

             + ++ G T +   RV+G PEP +TW + G+ +    R  L   +     L I      D 

Query: 102   GKYTCEATNGSGARQ 116
             GKY   A N SG  Q
Sbjct: 17977 GKYIISAKNSSGHAQ 17991

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 79/398 (19%), Positives = 146/398 (36%), Gaps = 55/398 (13%)

             V+  QT++    V G P+P++ W  EG  + R E  +++ +D     L + +A   D G 

             Y  +A N+ G    S  + V       + L V  V     ++  +  +  G   +    V

                           +P Q   S   + V +  I+ + L  +   +   AEN +G      

               T+  K        +L + P  +P  P       +L + D  +  + ++       G  

             P   +  H    ++ S+D+    +G+  +    +          +  +  N  GE   V+

             T+ V+  +   D  +P    K   V T   G ++ +   + G PFP V W +D  A    

              +   ++    D     L K +    G+Y +   N  G

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

             VK    V     V G P P V+W  +GT ++  EG I++        L L     +DSG 

             Y+ TA N+ G  S +  L+V

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 24/148 (16%)

             S++ G ++    +++ R+++    P F   +    V  G+ F L+  V G P+P I WL 

               + I+ + + CE       A L ++DA+  D G Y   A N  G  S    V V ++  

                        P  P  P+ + G++  K
Sbjct: 23719 -----------PGPPEGPVQVTGVTSEK 23735

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 46/201 (22%), Positives = 72/201 (35%), Gaps = 29/201 (14%)

            R +W K G  ++   R S       A++      K+ +G      ++   ++  +S+  +

                  A A +K  V  + +F    + + VVE + A F  K+ G P P V W K      

                    + +     L I D    D   Y C A N  GE      L V+  ++ E    

Query: 1856 --------------GEGEEEE 1862
                          G GEEEE

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 21/180 (11%)

            VA S  +K+ +++      + P T+  A      F+  P+++ + E  TA F  +V G P

             P V W +   + +  GGR F+   G      L I    + D G Y C A N  G  +  

            V L V         EG     L + P++ K  G+      +E   ++  +   K+A   G

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

             DP+ V    L     E P  IL     R   IK G T +    ++G P P+VTW +  + 

               +  R  +D    G+   + +A H ED G Y+    N +G++ V+V++ V

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 3/82 (3%)

             VK   T++    V G P PEVAW    + T + R    +++   A S    L KA+  D 

             G Y  TA+N  G      T+ V

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

             V V+EK  S      +P VA      P      S   V  G  + + V +SG P P + W

               +G  ++++   +        +L I+E   +D G Y     N  G+   +  ++T+ +P

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

             KD  V+  G+ FVL+  +RG P+P + W  +G+ ++   AR   ++ + +  L ++D + 

              D G Y     N  G  S    V V ++             P  P  P+ + G++

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 87/450 (19%), Positives = 159/450 (35%), Gaps = 68/450 (15%)

             Q+  V+   +++      G P P   W     P        +++       L +      

             D+G Y+ T  N  G  S ++T++V         +   +V    ++++ D  +++G   + 

                V      R +W       Q     C   + +++              LAE       

              SA   V+E       E   P+  ++  AP        L V+D S+ +  +         

               WL   H+G            Q+  DF  E   T Q +  ++ +  +    +  +A N 

             AG    +   +   ++EP  + T        + +T   G    I   I+G P P V W  

             +   L K+T    +   +D  TL +K      +G+Y + L+N  G  +  V++++     

                 P      S E  +   G   DGGG++

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 71/346 (20%), Positives = 136/346 (39%), Gaps = 57/346 (16%)

             ++ + K++V  +    E     +VE    +   G+K   K L E   K  P E++  ++ 

             L++   + +PK   ++  KV  P           ++V+  +V  ++   K P P KVP  

             KPA P           LPA       E   A+      P    +P+    PV    P   

              K    A   E  KP G   P + +   +   ++ + +       G     +     + +

                  F ++++D+ + E    G   + +C VS   P+T I  W  +G  ++ +   +FI 

               ++  L  + ++ +   D G Y CV +    +   + ++ V++ P

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

             S +D SQ  +EA+   +E K  V    PYF+  ++D   VE       C+I    D  V 

             WFKD + I+ S++  I  D      LI+      D  +YTC

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 8/110 (7%)

             PSR    + ++   EAP   L  +    L +K G   +    V G PEP++TW +    +

                 R  ++  +    ++ I      D G Y  EA N  G     VE+ V

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 68/354 (19%), Positives = 126/354 (35%), Gaps = 56/354 (15%)

             V E + +        +P P V+W  +G  V+  +  + +  D  S +L + K+   D+G 

             Y+ T  N  G  + S  ++V       + +   ++  S   +  +    +G   +L   +

                   R T++    P+    +     V     +D +P     +   A N +G       

                         E   PV    P  P       D++V + +   MT+  +  PP     L

             ++G             +G +    C + + P    TYT +      E    VR +    +

              EP   T P     P          S+    G  + +  +I+G P+PT+ W++D

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 105/504 (20%), Positives = 176/504 (34%), Gaps = 76/504 (15%)

             L I+ G      GR  G P+P+V+W ++   +    R  +      T +L        D 

             GKY     N +G+R+   ++ V      + G PV   +    F     +     W     

                +K+   ++++ ++G+            V     +   + + +VS   +    +  IH

               N    G+   LV +     SM A+   +  D+ ++  V E    ++        D  K

              +TN I ++ +  S   A  +K+                C    R  +        P PP

              +   +K    K SP   P+       S  +T Q  R     +  G  V     G+E  R

              A   P + P T+    G +D    K     +   G+ D A        K   +P     

                  + Q +K   T++    + G+P P+V W  E       +  I+V    GS  L + 

              A   D G YS T  N  G  + S

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 23/81 (28%), Positives = 34/81 (41%)

             +VVK G   RF   I G P P   W      ++     +V   N   VL I    + D G

              Y   V N +G  +++  L++

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 29/123 (23%), Positives = 52/123 (42%), Gaps = 6/123 (4%)

             +++ A + +     +  P  V      EAP   L     + + ++ G +A+     +G P

              P++TW R     T   +  ++ G+  T  L I      D GKY  +  N SG++   V 

Query: 121   LTV 123
             + V
Sbjct: 24110 VKV 24112

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

             V +  G  L L   VS  PP  I W+  G  L +   I  ++  SL  + ++K    D G

              Y   A+N +G+   +  V V D P

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 65/327 (19%), Positives = 119/327 (36%), Gaps = 37/327 (11%)

            P F    +SV    G +      I+G P P V W RDG+ +   T    ++  ++    L

             +  V   ++G+Y +   N  G+ +    L+++  +A        P   + L    +   

             G   R      G P     +    DG +++  L  ++            E         

             ++  + +G+  ST  L     +E+PA++     +   Q+     +  E+K+ +    D 

            RS+    +   G +   +P K PP  P  P  RS     +  K +L  +   S       

                S  P+ + +   P  PV +  PA

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 27/102 (26%), Positives = 38/102 (37%), Gaps = 1/102 (0%)

             E V  + P  KP       D+ V+EG            P P V W KD + ++ S    +

               D   +  L +      D   YT    N LG AT +  + V

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 34/126 (26%), Positives = 52/126 (41%), Gaps = 7/126 (5%)

             SV     ++ G+   +   V G PVP   W      +   R   +     +EL I+DAL 

             +DHG Y   A N+ G    +A V V +         +L + P      + L   SD +  

Query: 636   DGSQVT 641
Sbjct: 15224 GGSEIT 15229

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

             G  + I   I G P P   W  DGKA    KD  H        E  +N  V  +++ + +

               H G+Y I  KN+ G+   +C+V +M

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 34/144 (23%), Positives = 58/144 (40%), Gaps = 9/144 (6%)

             D HFE  G    H    + +     G ++ E   S G +  +    V  P     P +  

                ++    G+S  +   I G P PT+ W++  + L  +T   E+   +   +L +K   

                +G Y +  KN  GE S  V++

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

            ++V +G  A    K  G  +    WFKD Q +     ++I   +  +   IIS     D 

             +YT +  N +G ++C A + V

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

            + +  S   F   ++G P  ++ WFKDD  +       I   E     L +  V      

            +YTC   N +G  +CT  L+V

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 21/81 (25%), Positives = 35/81 (43%)

             + V  G  + +  +V G P P++ W   G  +   +     Q   +  L I+E    D G

              Y   A NS+G  +  A++ V

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

             SV A  G+ V +     G P PTV W +D K L  D   + +   +    L + +V    

              G+Y + ++N VGE           SS  ++     PA+C+ L

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

             G +  L+   +G P P I+WL +G P+   ++ R +       L I++A  E  G YT +

              +NA+ +++    V             L P  PSKP  PI
Sbjct: 27638 LDNAVCRIAVPITVIT-----------LGP--PSKPKGPI 27664

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 3/114 (2%)

            G E+  T   + PAP   P    PP ++   ++  V  GESV L   ++G    T TW +

               QI+ S   ++      ++L I  A  E  G +T    N+ G+      L V

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

             PV  ++P  P    + +     +++M G  + +   V+G P P  +W     E+ + +  

               +  GT+  L I++   +D G Y   A NS G

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

             L +K G T + E  VRG P P+V W   ++   +T   R  +D     + FSL       

              D GKY   ATN +G+
Sbjct: 18269 SDGGKYVVTATNTAGS 18284

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 91/425 (21%), Positives = 154/425 (36%), Gaps = 61/425 (14%)

             IP EG+ D+   K      +  ++   T++    V G P P++ W      +R + G ++

             +       +L        D+G Y  T  N+ G+   +  ++V         + V E++  

              + V  +  +I+G   ++   V+     R +W         +  T E       + +   

                  +   AEN  G         + +   +R +     V  S+   P+      DLKV 

               S+ + ++   G   P       G+ I     DF  E+   Q    SL +Q    + T 

                 T+   A N  GE  T + +TV    D   P    K        A    +  +   I

              G P P+V W +    L  DT    V  +    TL++   Q   AG+Y I LKN  G   

Query: 805   CQVSL 809
Sbjct: 20066 GTISI 20070

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 33/131 (25%), Positives = 47/131 (35%), Gaps = 11/131 (8%)

             PAF L      +  G   K +    G P P VTWH++  P+    R   +        L 

             I     ED G Y  + TN +G    T+ + V        G   + +   D  +       

Query: 153   PSIWGECPPKF 163
                WG  PPK+
Sbjct: 22262 ---WG--PPKY 22267

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

             RD  VV  G   R +  + G P P + W + D+ I ES   +I  + D    LI+ D   

Query: 1824  DDDAKYTCKAVNSLG 1838
              D  +Y  +A N  G
Sbjct: 23691 IDGGQYILRASNVAG 23705

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 22/83 (26%), Positives = 37/83 (44%)

             +  K G        I+GRP P+VTW    + L+ + RVS++       L +    + D G

              Y   + N +G  + S  + + G

 Score = 38.1 bits (87), Expect = 0.081
 Identities = 58/270 (21%), Positives = 103/270 (38%), Gaps = 43/270 (15%)

             PV    W+ +N +PI+  +   E GV        +P+        A NA+G         

                 + S  SE ++   P  KPT  +      D+ V++G ++++ V     P P V W  

             +G E++ S+    +       L + +    D G YT    N  G       V  +  P  

                P    K   +T S       SC +  +P       P +H++ + +   + T +  V+

               E+  +  +K + P     + +   N+VG

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 51/198 (25%), Positives = 74/198 (37%), Gaps = 45/198 (22%)

             G++A FE  V   P   +T W ++G  I      RF+ D   R    L I  V   D G+

             YTC    G+  +  T +L VE                                 E P +F
Sbjct: 11188 YTCVLRLGNKEKTSTAKLVVE---------------------------------ELPVRF 11214

                L   V V +GQ    SC++    +  V W K G + ++   R+       M+ L I+

               +  D G YT  V N +

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 7/92 (7%)

             PT  + L    D +KV  G  V +   V+G P P++ W  N   I++  D          

             +   +  L I +   ED GTYT  A N  G V

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 20/73 (27%), Positives = 33/73 (45%)

             V++K G+  R    ++GRP P + W K    L+ +A++ +   +    L      + D G

Query: 230   VYTCLVVNGSGKA 242
              YT    N  G A
Sbjct: 21531 AYTLTATNPGGFA 21543

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

             +AP   L P+    + +  G T   E  +RG P P V W ++G+ +  +  R  +   I+

              T +LV+      D G+Y  + +N  G + + + + V

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 13/99 (13%)

             PS+ T PI ++        + D+K  D      G  + +   ++G P P + W  +G EI

             +E              L +++    DTG Y     N AG

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 20/83 (24%), Positives = 38/83 (45%)

             +  G+ L ++  V   P   + W  +G  ++    + ++      S+ +  A  + RG+Y

                AKN +G A+   +V V D P

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

             ++++ G   R    + G P P  VW K++  + + R   +  D  G  S LII D    D

               +Y   A NS G     A + V

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

             +T  +GQ++ I   + G P P + W ++GK L ++    +++Q+     L +K+      

Query: 790   GQYEILLKNRVG 801
             G+Y I  KN  G
Sbjct: 17977 GKYIISAKNSSG 17988

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

             G +  L  +V G P+P ++W  +G   +P +  +   +  +  L +     +D G YT  

             AEN+ G  S +  + V +K

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 9/125 (7%)

             VDP R+   P  +          + +  G + K +  + G P P + W +  Q +++  R

               +      T SL +      D G Y  +A N +G R VTV + V        G  V+S 

Query: 139   TLGDR 143
Sbjct: 22649 VTAEK 22653

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 81/409 (19%), Positives = 147/409 (35%), Gaps = 65/409 (15%)

             V+   + +      G P PE+ W        R+EG    +V  + G +Y  L +      

             D+G Y     N+ G  S   T++V       + LAV EV    + ++ +  +I+G   V 

                +      R           YA  + +       +++        +  +AEN  G   

                 V V    + + +E   P  P K T            + D SQ + ++       PE

                 H+G           + +GT+         +C   V    +G    +  +A+N  G+

                + +       D T QP       + +   G+ + I   + G P P + W++DG+ L 

             K T    V +      L +K+      G+Y +   N  G  +  +S+++

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

             D S +    +A+E+   +P F   S+  + L V  G++        G P P V+W K D 

              +R   +       D   SL I +   +D  KYT    N L  A+ T  L+V+ ++

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

             P   + ++ G+  K +  + G P P+VT  R+G P+ +  RF  +       ++ +    

               D G+Y   A N SG  +  + + V        G  V+S

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

             G+S+ I   + G P P V W +DG  + K   + E+       +L ++     H G Y +

               KN  G    ++ + +Q++  + +

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 87/433 (20%), Positives = 147/433 (33%), Gaps = 79/433 (18%)

            +  H G        + +   P      + V V EG+    +C+V+  P   + W LNG+ 

            ++ +K   +  +G +  + I      D G  K  A+N  G  E   ++ +       S  

             +APE    RP+  +      + +     +P   T  K  +  +  +    +KV   ES 

Query: 1256 ELFGKVTGT------QPITCTWMKFRKQIQESEHM-------------------KVENSE 1290
            EL  K          + IT   +K RK+ +  E +                   K   +E

             G K+TI         L+   E    +  +    +G    A   + VV KPDP       

                       WY +            IE  D     W E   C      ++D+  +   

               V+AIN+ G +        Q  +L T  ++ ++     KD +   + +  EP V  + 

Query: 1452 VTINTEQKVSDFY 1464
                 E    D Y
Sbjct: 2208 YKDGMEVHEGDKY 2220

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 57/266 (21%), Positives = 95/266 (35%), Gaps = 45/266 (16%)

            P+ V E + K+   Q+ DFRSVL            + P P+   P+F     GK +   +

                  +T   K V   K             + + K  E  + + +     T +    A 

                LKS  K+E  +++      +  H     T+ EK++   E + T P FK        

                    +++Q   V +G     + +V   P     W  NG K  ++ +      E ++

            C + I     ED       A N AG+

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

             G  + +   VSG PPP V W  N NE    ++   E      S+ I+       G Y+  

             A N AGE +   ++ V
Sbjct: 16597 AKNEAGERKKTIIVDV 16612

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

             T RD+  V  G   R   +++G P+P++ W K+ +  +RE R   +D  +D     L I 

             +    D  KY   A NS G A  +A

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 7/107 (6%)

             V  E+  VK    K + DL+      V  G   R +  + G P PEV W KD  +   +R

               ++  D   + S   ++     D  KY   A N+ G     A + V

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/92 (23%), Positives = 40/92 (43%)

             + +  G ++ +   V G P P   W    +E+  S      +  +   L I++V  +D+G

              Y+  A NS+G    +  + V +     QP F

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

             + +  G + R    I+G P PEV W K D  IR++    +        SL++ +V   D 

Query: 1827  AKYTCKAVNSLG 1838
              KYT    NS G
Sbjct: 23009 GKYTLTLENSSG 23020

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

             P     +   EVV+   G++ +    I G P P + W+KDD+ ++ +    ++   D   

             S++I D    +   Y  K  N++G A+ T

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

             V  + G   +    I+G+P P + W K +  LQ +A V V     +  + I   ++ + G

              Y   + N  G A  SA + +Q LD

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 17/77 (22%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

            ++P + + ++D+ + EG      C+    P+ +  WF++ + ++     + + +   +  

            L I+DV  +D  +YTCK

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 3/108 (2%)

             RF A   E R  +     PK  T    +VV  G+           P+ +  W K N PL 

                  + +E+   ++LE     + D G Y  ++ N  GKA     L +

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

             V+EG       KI G P P +TW K   P +P  +  V   +  N + V     L I   

              + D G+YT   VN  G AS    L++ G

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

             G    L   ++G P P++TW    +     AR       ++L I++A  ED G Y+   E

             N  G  + S  V V +K
Sbjct: 17293 NPAGSKTVSVKVLVLDK 17309

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 37/151 (24%), Positives = 56/151 (37%), Gaps = 10/151 (6%)

             A+N  G +S  +  T   +    K EY  P     PT          L +  G  + +  

             + + G P P+  W   G +I+ S+        T   L I+    +D G YT  A N  G 

                   +TV +      P  IS   +  A+L

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

             V  GS + + + +SG P P+V    +G  ++ +  F+ E      ++ ++E    D G Y

                A NS+G  +    ++ +  P   T P  IS

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 5/109 (4%)

             +AF   + +E P ++P    T    +++    GS    D  I G P P+V W  ++  ++

             E+    I   +D   +L + D    D  +Y     N+ G  T +  ++V

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

            F K + D  + +G     +    G P   V W K+  ++  S+   I   E  +  L I 

                +D  +Y C   N+ G+ +C+A++++

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

             NC+    G  D    N K S      P      + L+DV V  G+     C++S +    

             + W L GK L+ +  ++   EG + ++++     ED G  +  AK+

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 2/90 (2%)

             SG PKP+V+WF +   V  ++    +     +  L  +KA+  DSG Y     N+ G   

                 + V       V P SF  V KD  VI

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

             ++  + G++  +   + G P PT+ WLR  K + +++   E+   +    L++K      

              GQY +   N  G  S  V++

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

            P F   +  L VV G  A     IEG     V W K+ ++ IRES + +I + E+   +L

              +     +  KY C+  N  G     A L+V

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

            + V  G+    +C + G P+    WFKD + +  +S+H     ++  +  +  +++   D

               Y+ +  NS+G++ CT  + V

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 37/186 (19%), Positives = 66/186 (35%), Gaps = 32/186 (17%)

             T S ++  + E    ++  +A N  G  + ++ L V                + D    P

              ++ R S+ G+           + VK G+       +TG P P++ W K    ++     

                 +  VS       L I    ++D G YT    N  G    +  + +    S  R+  

Query: 261   VRETKA 266
             V + KA
Sbjct: 15506 VTDIKA 15511

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 1/75 (1%)

             G +V     I G P PT  W  DG  + K   H+ V  +     L +K       G+Y+I

Query: 795   LLKNRVGECSCQVSL 809
              + N  G  +  V L
Sbjct: 17584 TVSNAAGSKTVAVHL 17598

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

             EAP  +L P     L IK G T       + G P P+ +W + G+ I       +     

              +   + +A  + D G+YT  ATN  G +   V++TV

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 25/100 (25%), Positives = 39/100 (39%), Gaps = 16/100 (16%)

             G +  ++  V G P P +TW    Q ++  +       A    L+I + +  D G Y   

             A N +G+V     + VH+              P  PT PI
Sbjct: 21140 ARNIVGEVGDVITIQVHD-------------IPGPPTGPI 21166

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

             I+ G + +    ++G P P+V W +    I      ++D     T SLV+  V+  D GK

             YT    N SG +   V + V

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 3/91 (3%)

             P+  LP     +K     K +   +G P+  V W ++GQ +    R  +      T SL 

             I    +ED G Y    +N +G+  +TV +T+

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

             +G P P V W KD++++     + I+ + D +  L I  V  +D  KY     N +GE

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 20/106 (18%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

             +T    ++  +G  P  +    D+ + EGK L + C  + +P   + W+  G+ + + + 

                 +     L ++ I     +D GLY     N+ G    +  + +

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 47/231 (20%), Positives = 82/231 (35%), Gaps = 56/231 (24%)

             F + L ++ V+E   + L C+VS  P A +IW    + +  T    +  EG    + I+ 

             A  ED G Y C                                 R P S         +D
Sbjct: 12524 AHLEDAGNYNC---------------------------------RLPSS--------RTD 12542

               VK            +  + I  P++ ++  GE  E    ++  +     W +  K ++

               +   V        L +  A  +  G Y ++V    G+ +A  +LTV++K

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 16/82 (19%), Positives = 37/82 (45%)

             ++ ++ G+    + + +G+P+P+V+W K    +    R  +        LE     + D 

             G Y  +V N +G      ++++

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 25/96 (26%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

             KP   + L G+  L V  G  + +   V G P PEV W    +  ++  S     + R  

                  + +    D G Y   A N+AG     A + V

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 31/122 (25%), Positives = 47/122 (38%), Gaps = 9/122 (7%)

             +  +A+NA G +S  +  T      + K E  LP     P      +    + V  G   

              +   V G P P + WL    EI+ES     +    +  L +++    D G Y   A N 

Query: 701   AG 702
Sbjct: 23704 AG 23705

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 104/516 (20%), Positives = 179/516 (34%), Gaps = 49/516 (9%)

             + +K G   K    + G P P ++W ++G  I    R  +      T  L +      D 

             G+Y     N +G R V V   V        G   ++    ++ S     P  +    I  

                 K  T      + EG++   SCK+T         LKGN  +            +P  

              V++   +   V      LEI  V ++ + +  C     S   S  +   I+  +  +  

             +VR  K    D+R + T +      E ++ +  AA  S     S   R   P +     P

              PP + K+ +S K +   A   P+    +          + +       + S  G E   

                   A +  R      +G+ D  S +++ +I  E + +  F       ++  VK   +

                     G P P V W    T +R +   ++  +   S  L +  A   DSG Y+ T  

             N     S +  ++V          +   V K+ AV+

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

             + V++G + R +  I G+P P   W K    +   A ++ SE +    L I   ++ D G

              Y  ++ N  GK ++  ++ + G

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

             P  +  +R   V  G   RF   ++  P  EV W+ +   ++ES   +I Y +  G  +L

              I D   DD   Y     N  GEA+  A L V

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

             F   + D++V E   A+F+C++   P     W K  Q I     F++  D   + S++I 

Query: 1820  DVCGDDDAKYTCKA 1833
                 +D+AKY  +A
Sbjct: 11900 SAAFEDEAKYMFEA 11913

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

             R+VV  G + R    ++G+P P VTW      L   A +  +  +   V  I    +   

Query: 229   GVYTCLVVNGSGK 241
             GVY+ L  N +G+
Sbjct: 16591 GVYSLLAKNEAGE 16603

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

             ++ G   +    VRG P P+VTW + G    +  G   L+D        LVI     +D 

             GKY+    N +G + V V + V

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

             L V  G+    D  + G P P V W KD   ++ +   ++    +  C+L +  V   D 

               YT  A NS G  + T +L V

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

             VA     AP + L+GL DL  +  + S   + + + G P P V W    + +        

             E      +L + +    D G YT    N AG +  T ++  V +P   T P

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 24/99 (24%), Positives = 38/99 (38%), Gaps = 10/99 (10%)

             D + AP +   P+I          K G  +V        +  I G+P P+ +W K    +

             +PS    ++      +L I    + D G YT    N  G

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

             +V    G ++ +   I+G P P V   RDG  L K T  F      +  T+ LK+     

             AG+YEI   N  G     +++++

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

             V+++   ++ V+K  A   G    L+  + G P P I W  + + +Q     C      +

             A + I+DA   + G Y     NA+G  S +  V + +K

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 18/82 (21%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

            ++V  G  A  +  + G P+ +  W+KD + +  S+ ++I + ++    L        D 

             +YT +  N +G ++C     V

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 46/173 (26%), Positives = 63/173 (36%), Gaps = 19/173 (10%)

             V   P+    W   G PV   +  +   E+ G  Y             Y   A N QG  

               S  T +++ +   E    F  V  L    V  G    L  +V G P P+ITW      

             + Q  R T E     + + I D+   D GTY   A N  G+ +    V V +K

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 16/67 (23%), Positives = 28/67 (41%)

             G    +   + G P P + W+    E+  +     +      SL +++    D+G Y  +

Query: 697   AWNSAGE 703
             A N AGE
Sbjct: 22618 AKNVAGE 22624

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 25/106 (23%), Positives = 42/106 (39%), Gaps = 4/106 (3%)

             +SK ++   P+  + +   P+    P+ ++   V   +T +   +V G P P + W L G

                  +    E+        L +  A   D G Y   ASN  G  S

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

             ++  AT +    ++G PEP+V W +    +T   +      +  +F+ LVI  V   D G

             +Y     N SG++   V + V

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 23/93 (24%), Positives = 35/93 (37%), Gaps = 1/93 (1%)

             +KP          V      + D   +G P   V W KD Q+++E+    +   +    S

             L I +   +D   Y     NS G  T    +IV

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 47/193 (24%), Positives = 71/193 (36%), Gaps = 18/193 (9%)

            P+  K  +N+++      R+   +A     R  W K G  + A  R   +A + G +   

              R     +      A      +D S A +  V E    V    SK     +V+ GSA  

                 +G     + WFK ++ +       I   E    SL +  V   D   YTCK  N 

Query: 1837 LGEATCTAELIVE 1849
             G   C+A L V+
Sbjct: 4284 AGGVECSANLFVK 4296

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

            K S    T  L  E++E  E   + F E V+  +  +      T I+D+E   V++ + A

             F+  I+  YP+ ++ W+K  + +  S  F+I  D D

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 45/214 (21%), Positives = 87/214 (40%), Gaps = 40/214 (18%)

            +R+  EE ++  +V ++  + ++ +K S   + E+ ++ ++PA          E+M F +

            + + +V    P+   E   E K+H          P+  +     A +  +  P+P+KV P

            P P  P+       KK +P E             V   +P +  + P  P KPV   K  

              +     A PA+  +       +E +   ++ E

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 35/139 (25%), Positives = 57/139 (41%), Gaps = 25/139 (17%)

             V K       A   + RP   GE PP              KF  ++  +++ E    G  

               F C ++  P   +T W+K   N+   P  R     K+  + L I  V   D G YTC+

             +  G+ + + +A+L ++ L

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

             ++D  V E     F+C++      +  WF+++++I +S  + I   +D   +L I D   

             DD A Y     N  GE     A LIVE

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 33/146 (22%), Positives = 56/146 (38%), Gaps = 11/146 (7%)

             +A PK ++  Q   V   + +         PK E  WF E  P+  +  +I+   +  S 

                +L+A+  D G Y     N  G+      L+       V  L V E      S+  + 

              + +G   ++   V    + R TW+L

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 10/116 (8%)

             G+  L   S  +K  +S DPS +   PLT   AF+ P  +L   K+G        +    

                GYP P  TW    + + +G R  +   +     LVI      D+G YT +  N

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/85 (24%), Positives = 33/85 (38%), Gaps = 2/85 (2%)

             G + VK G   R    + G+P P+V W K      L  S RV +  +       +    +

              D G Y     N +G     A +++

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

             S+  + + V  G +AR     +G P PE+ W +++    +    ++  ++  N + +  D

              C  +DA KY  K  NS G

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 6/109 (5%)

             P  V    + E P + L  R    + +++G   +    ++G P P   W + GQ I+   

             R ++      T  LVI      D G Y     N  G + V +++ V GS

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

             +    G  + I   ++G P PTV W  + + L ++     +       ++V+K  Q  H 

Query: 790   GQYEILLKNRVGE 802
             G Y +L KN  GE
Sbjct: 16591 GVYSLLAKNEAGE 16603

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 30/120 (25%), Positives = 47/120 (39%), Gaps = 26/120 (21%)

             +RG PVP   W  +G  I   ++     +   + L I++ L  D G Y     NA G  +

              +  +TV +              P  PT PI         ++D +   MT  +S  PP +
Sbjct: 17594 VAVHLTVLD-------------VPGPPTGPI--------NILDVTPEHMT--ISWQPPKD 17630

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

             G A R +  + G P P + W KD + +  +   +I    D + +L+  D    D   YT 

Query: 1832  KAVNSLGEA 1840
              A N  G A
Sbjct: 21535 TATNPGGFA 21543

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 20/116 (17%)

             +P+ V   P  E    +LPP         + + I+   T +    ++G P P+V W R+ 

                   G  L    I  T S   L++  V+  D GKY     N SG++   V + V

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

             + +  G  + + V + G P PEV W     EI+++         T  SL +  V   D+G

Query: 692   TYTCEAWNSAG 702
              YT    NS+G
Sbjct: 23010 KYTLTLENSSG 23020

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 4/108 (3%)

             +++ P  V  + +T E     +P   + ++ G     E   +G P+P ++W ++G P+  

                F+         +L I    +E  GKYT    N     ++ V +TV

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 17/109 (15%)

             + E++AE    ++P     I DLE+ +          G++ R    + G P P + W K 

              Q I  +    ID  E  +  LI+  V   D  KYT +A N  G+ + T

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 34/132 (25%), Positives = 49/132 (37%), Gaps = 3/132 (2%)

             KE+  E++ F   +   V+   V EEE  +H  ++      +      K P VP K VP 

              K   P  +       K+P E      E +     +  KP     P  P KPV   K   

Query: 1034  TLKPMGNAKPAE 1045
              +     A PA+
Sbjct: 10020 PVPKKVEAPPAK 10031

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

             F   + D  V EG  A F C++  +    VVWFK+D  +  SR   I   E     L + 

             +V  DD ++   +    + E + TA+L V

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

             F   ++D+   E  +A F  ++  + +  V WFK+DQ +  +R   +  DE    S+   

             D+  DD ++   +A+    EA  T

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 20/72 (27%), Positives = 32/72 (44%)

             TG P+P  TW  G+  L+   RV +   +    L I    + D G+YT  + N     S 

Query: 245   SAELSIQGLDSA 256
               ++++    SA
Sbjct: 13479 EIDVNVIARPSA 13490

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 27/116 (23%), Positives = 45/116 (38%), Gaps = 9/116 (7%)

             S IS+  ++ DP           P   L   ++ + EG         R  P P V+WH++

             G+ + +  R  +          V  +V   D G YT    N  G+   ++ + V G

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 24/99 (24%), Positives = 37/99 (37%), Gaps = 5/99 (5%)

             G    L+  VRG P P + W  +       RS        A  ++  +  A   D G Y 

               A N  G     A V V +K    ++  ++ V+  + T

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

             + L ++ G T +    V+G P P++TW +    +    R  LD  I+ T F   +    V

             ++ D GKY     N  G ++ T+ + V

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 36/123 (29%), Positives = 48/123 (39%), Gaps = 8/123 (6%)

             VK V     S  S S DP         E P F +     + L +K GA+       RG P

              P V W +    + +  R  +D     T SL I   +  D GKYT    N   A  +T+ 

Query: 121   LTV 123
             + V
Sbjct: 26272 VKV 26274

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 25/88 (28%), Positives = 35/88 (39%), Gaps = 7/88 (7%)

             S + K   V  G  F +    RG PVP + W    +P    R+       +    L I++

             A   D G YT   +N L   S +  V V

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

             L V  G+  TMTV   G P P V+W     +++     + +   ++ SL I+     D+G

Query: 692   TYTCEAWN 699
              YT    N
Sbjct: 26254 KYTLTIQN 26261

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 50/246 (20%), Positives = 84/246 (34%), Gaps = 53/246 (21%)

            G  KL+     +  +LSV+  ++           I   R+L   E     FE  +  +  

              V W+   + I    ++ ++   +  + L +  + ++D GKYT  A    G    + +L

            TV G          +SK L D+                            V E Q   F 
Sbjct: 2616 TVAGG--------AISKPLTDQ---------------------------TVAESQEAVFE 2640

            C++   P  +  WL+    L  +  +        + L I     DD+G YT  V      

Query: 242  ASMSAE 247
            A +  E
Sbjct: 2700 AKLKVE 2705

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 32/135 (23%), Positives = 51/135 (37%), Gaps = 17/135 (12%)

             S T  +++E    + ++ +  L+ +++ K  VK              PYF+  + D   V

             E       C++    D  V WFKD + I  S  + I  D      L I      D  +Y 

Query: 1831  CKAVNSLGEATCTAE 1845
             C       +A  T E
Sbjct: 11733 CDCGTDKTKANVTVE 11747

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 30/150 (20%), Positives = 49/150 (32%), Gaps = 11/150 (7%)

             K EV W L    V  Q    ++  +   H L +   + RD G Y   A + + +      

                     +  AP   +  +D  V  G+   +       P     W    +P+       

              A      I +A   D G Y  + +N  G+

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

             + V  G+ + +   V+  P   I W+ N   + K T  + +++E      +   +SI KA

             + ED+G Y   A N  G    +  V V D P+

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

             R+  +  G   R    I+G P P+V W K+D+        +ID    G+  L I +   +

             D   Y+    N  G  T + +++V

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 19/115 (16%)

             +D  V++ G+   +   + G P+P I+W  +G  I+  R+  E    + H    ++D + 

              D G Y    +N  G  S +    V +K             P  P  P+ + GL+

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

             ++ GA+ +     +G P P   W +    ++       D     +FS L +   +  D G

             KYT    N SG++ +T  + V

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

            + D +V EG   + + K+      E VW KD Q ++ S    I  D+  +  L+I D+  

            +D   Y+   + +LG +T

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 27/93 (29%), Positives = 37/93 (39%), Gaps = 3/93 (3%)

            F K + D  V  G +   +    G     V W KD  +I  S    I   E   C L I 

            +    D  +Y+C+  N  G   C A  +V T+E

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 50/218 (22%), Positives = 85/218 (38%), Gaps = 16/218 (7%)

            W   E+ E V   + R  E  +  E  + + EV +     ++ +K+   +      K + 

            AE  +     ++++  KPK  ++ EE       +   + V  KK  +  P  EKVPPPK 

              P+       +KK+P +      E L AK  E    ++  +          A P A   

            +    A P E    LKP    +P   +    K  +K++

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 76/338 (22%), Positives = 111/338 (32%), Gaps = 62/338 (18%)

             +V  K V E++  V +P++V+       +   K        TPVP+KV  P P  P  R 

              +     LP E      E +    V   + L   +   P +     +  E L       P

              E   P       E  +   +EE+  +VK  V                      P  K+K

             + +  V   KK          PPA +            K IIL +E  +  V +      

                 E+ +PE+    +            V K    +A       V+  PA  + K PE K

                P  K   PP    E    V +K     P K A+PP

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 22/88 (25%), Positives = 33/88 (37%), Gaps = 8/88 (9%)

             G ++ +   +   P     W  +GK  K  K  +        L    +   + I +    

               G Y   AKN AGQ   +C+V V D P

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 3/68 (4%)

             GS    D  + G P+P+++W K D+ +       + Y   G  +  +   C   D  KYT

Query: 1831  CKAVNSLG 1838
                 N+ G
Sbjct: 29120 LTVKNASG 29127

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

             ++LE++EG  A F C I  E +P   V W +DD+++     + +  D      L++ D  

               D   Y    V  +G A   A L V

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

             P+      AP  + L     L +  G    +T + SG P P+V W  +  ++ E +  H 

               + T  +L ++++  +  D+G Y     NS G

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

             KD  +++ G+ F L+  V G P P + W  +G+ ++   +  E  +A+    L  +D+  

Query: 576   EDHGTYTCLAENALG 590
              D G YT  A N  G
Sbjct: 21527 RDSGAYTLTATNPGG 21541

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 26/126 (20%), Positives = 51/126 (40%), Gaps = 25/126 (19%)

             G +  +   + G P+P++T   +G P++          AE   +++++++  D G Y   

             A N+ G       + V ++             P  PT P+ +  +++  V          

Query: 636   DGSQVT 641
Sbjct: 26598 GGSQVT 26603

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

             P   + L+    +K   G+ V +   +SG P P + W  +  E+Q +     E      S

             + I++    ++G Y  +  N+ G     A + VQ

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 1/87 (1%)

             +P + + +  G   +    + G P P  +W   G  +    R  ++   +    L I   

                D G+YT E  N +G    T+++ +

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

            F++ ++D+   E  + A F+C+    P  +V W+KD   + E   +++  D   +  L I

              +   D   Y+C  V      T TA+LIVE

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 21/119 (17%)

            W K G  V+        I + S M +I  ++  K   G+ +  + A  L +   VS   +

            + +              ++D+ V+EG+ A  +CK+       V W+ +D+ I+     Q

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

             ++R L +V  G   R    + G P P+V W K   D  +R+    Q+D   D    L+I 

             +   DD  KY+   VN  GE

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

             R++    G S+ I   I G P P V W +D   L K+  + E   N + FT L++ +   

             +  G++ + ++N  G+ S  V++ + ++    L

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

             +D+ VV  G     +  I G P P+VVW KD + + E+             +L++ D   

Query: 1824  DDDAKYTCKAVN 1835
              D  +Y  K  N
Sbjct: 24774 TDGGQYILKLSN 24785

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 38/175 (21%), Positives = 68/175 (38%), Gaps = 15/175 (8%)

             K G+    +  + G P P+VTW      +    R  +    +   +L +      D G+Y

                  N +G +  +V + V G      G   VS          + E+    WGE      

             T++   +V++ + G  + ++      R Q +VT L     ++ S RVS   + G+

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 3/79 (3%)

             E S  R    I+G P P V W K +  +       ++     N +LI+ D    D  KYT

Query: 1831  CKAVNSLG--EATCTAELI 1847
                 N  G  E T + +++

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 19/80 (23%), Positives = 30/80 (37%)

             V   +T     ++ G P P+V W  +G  +      +E+        L +      D G 

             Y    SN  G  S   T++V

 Score = 31.6 bits (70), Expect = 7.6
 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

             G    +   + G P P+V+W  +G E++E+     E + T  + +L +++    D G Y 

Query: 695   CEAWNSAG 702
              +  N  G
Sbjct: 24781 LKLSNVGG 24788

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 8/91 (8%)

             EK +P  +   K V + +  A   E   ++ V+     E  + PE + R P + +P VL 

              +     KK P P      A PP++ + P++

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 8/112 (7%)

             NC+   + T    K  E    A  F  K Q++ + EG+K    C +S +    + W  + 

             KTL++     +  +G    + ++ A  +D G Y  +     G A  +  +TV

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

             R L V  G + R    I+G P PEV W KD+ +++   + +   + +    LII +    

Query: 1825  DDAKYTCKAVNSLGE 1839
             D  K+     N  G+
Sbjct: 20841 DTGKFVMTIENPAGK 20855

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 14/78 (17%)

             L V  G  + + V + G P PEV W      L N   I+ +E F          L I E 

                DTG +     N AG+

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 16/69 (23%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

             G   + +  + G P P V W K DQ +++++  +++++     +++ I++    D   Y 

Query: 1831  CKAVNSLGE 1839
               A N +GE
Sbjct: 21138 LTARNIVGE 21146

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

             +V    G++  +   ++G P PT+ W +DGK L + T   E+   +    LV K      

Query: 789   AGQYEILLKNRVG 801
             +G Y +   N  G
Sbjct: 21529 SGAYTLTATNPGG 21541

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 2/75 (2%)

             RD+ VV+ G   + +  I G P P + W KD   I E    +I    D +  L + D   

Query: 1824  DDDAKYTCKAVNSLG 1838
              D  +Y     N  G
Sbjct: 25855 RDTGQYVLTLKNVAG 25869

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 19/71 (26%), Positives = 30/71 (42%)

             V V+ G   +    I+G+P P+VT  +  VPL+ + R +         + +      D G

Query: 230   VYTCLVVNGSG 240
              Y     N SG
Sbjct: 26546 RYEITAANSSG 26556

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

             G++ R     +G P P  VW K D ++      + D     + S +  + C  +DA KYT

Query: 1831  CKAVNSLGEATCT 1843
                 N+ G  + T
Sbjct: 28428 LTVENNSGSKSIT 28440

 Score = 31.2 bits (69), Expect = 9.9
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

             V +G    L   ++G P P   W   GQ I + A         EL I++A   D GTY  

Query: 584   LAENALGQ 591
             + EN  G+
Sbjct: 30208 VLENKCGK 30215

>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  295 bits (755), Expect = 3e-79
 Identities = 217/812 (26%), Positives = 353/812 (43%), Gaps = 130/812 (16%)

             AP FK++L++++V       L C+V+  P   + W   GK +     K+ I   +G    

             + I     +D  +Y+  A N  G    +  + V+                          
Sbjct: 24682 LIIASVTDDDATVYQVRATNQGGSVSGTASLEVE-------------------------- 24715

                             P K  +P  +        +R GE V +    +G      TW K 

             +  I  + H +V  + + + L       ++  G Y +  +N+ G  Q  V L V D PDP

             P G    SD+   S+ L+W   + DGGS + +Y +E   +  + W  +   R T + V +

             L     Y+FRV A N +G S+PS+ SE T   E      +  E  D+     EV     +

              ++ +++ + Y I E LG G+FG V R VE  ++K +  KF K     ++  +++EISI+

             N   H  ++   ++FE    +VM+ E +SG ++FERI    FEL ERE + Y+ Q+ E +

             +++H   I H D++PENI+   +  + IK+I+FG AR+L+   + ++LF  PE+ APEV 

Query: 1634  NYEPIGYATDMWSIGVICYIL--------------------------------------- 1654
              ++ +  ATDMWS+G + Y+L                                       

                         +R+  ++ LQHPWL +  + +  K +   + ++Y      +K  N V 

             +  R+S    I      +S  G   + +    +E    VS   + AV EE  HVK     

                           + CKIE Y    +V W+   + +  S  ++I Y EDG   L + D+

                DD  Y CK VN  GE +  AEL V+ + E

 Score =  164 bits (416), Expect = 6e-40
 Identities = 162/691 (23%), Positives = 267/691 (38%), Gaps = 79/691 (11%)

             +VTW+++G+ +   G F       GT+ L I+ + E D+G+Y CE +   G  +  ++  

              +            S  K+  Q     T+  +    A E   S      P   T L    

             V    + +F+ K TG P+P   W K    +    +  +SE  G   LEIH  +  D G+Y

             TC V N +G  S S +L+I+ +       V   K +       + V++E++    +  ++

                EA ++         SK   S +   S   +          +K     +  RT  +  

                 T  SI  +  R+  +    G         GV   + EE +        T   +Q  

                + +   +SK     +  +      +  S  P F S+P+SQ + E Q V F CE+SG 

             P PE+ WF    P+     ++ +      + L +  A   DSG Y+  A N +GQ  CS 

             T  +  L ++E  PS   VL+        D  LQ S             + Q +Q + S 

              EA  +      A       +  ++  ++        ++S S+++ +        S   +

               A  +   P      SD+ + +G  +T+    +G P PEV W   G +I  QE   FH 

             E      +L I +V  +D G YT    N  G

 Score =  158 bits (400), Expect = 4e-38
 Identities = 188/837 (22%), Positives = 311/837 (37%), Gaps = 176/837 (21%)

            G+   VA  + S  +L V+          E P  +   + + ++ G  A+F   + G P+

            P+++W++  Q +++G +  FL D      ++L++     ED   YTCEA N  G    + 

             L+VE                      P V +        PP   T L   V  EGQ  R

            F C+++G    +V+W   +  ++PS    +++      LEI     +D G YT +  N  

            G+ S +A LS  +Q LD          +++  DVR+   +    +S     E+    K  

             S Q G S  +                         +  V +  S S    AA VQ    
Sbjct: 3428 KSFQ-GSSYEY-------------------------EVQVFESVSQSSIHTAASVQDTQL 3461

                 L  ++ S E  K  A  + +T    +  L  QDV  K  +               

                          T +F C +      +V W  EG  +   E  ++  ++    +L + 

              +  D G YSC   N  G+ + S        AV+ V  +  S+L +             

                    RI   +  +  +++ S   A    LH  +  L + + T   L+E+       

                 V+  K   + E          T PIF++ +S+  +  G   T++V V G P P++

             W  NG  +  S D+ F   G  HSL I     ED G YTC A N  G+    A L +  

              E H  T+                 P F+ + + +  + G   +    + G+P PTV W

             ++ K LC    +  +       T ++   Q   +G Y    +N +GE +C   L++

 Score =  134 bits (336), Expect = 1e-30
 Identities = 111/435 (25%), Positives = 200/435 (45%), Gaps = 41/435 (9%)

             S    +  P   +  S+ P   +  Q   V  +   KF  + +G P+P   W  +G  + 

              Q G  ++ ED G  +L + K  T DSG Y+CT  N+ G +S S  L ++          

                 +KD    E Q    Q +   TP  +   ++  +  Q A  + E  ++E   Q+ L 

              ++  +   ++E      + S   + VHE+  K+S+ SE +   A  K  +       + 

             + + +G ++ +   ++G    +V W+ NG E+  SE++ +   G+  +L I++    D G

               TC +    G V+ Q  LT+ +      P FIS+PRS   + GQ+VL +C I+G+P P 

             + W ++   +   + +  + ++ +V++L ++      +G+Y I  KN  G+CS   SLM+

Query: 812   QNSSARALPRGREPA 826
                    LP   EP+
Sbjct: 26919 -------LPLVEEPS 26926

 Score =  122 bits (306), Expect = 3e-27
 Identities = 158/734 (21%), Positives = 285/734 (38%), Gaps = 96/734 (13%)

             G  + ++  I G PFP   W ++G+ + K      +  +E    LV+K+     +G Y++

             +L+N+ G+ +  + + +  S     P G  P   +D+    V       AD GG+D  G 

             +          W   +    VRG        +++ E   R     Q      L  +  V+

              KT L+  +    P E +D   +       +   +   +V +   ++ +     K    +

             KT +   +       PD       + ++ A+N    +ET  A + V    P       G 

             L+ +  +K + TL   KP     K             D   K ++KE +K          

                        +N+    R    T  + K   + G AP  +++++DV    G+   L CQ

             +   P   I W   GK L  ++   +S +G   ++++     ED G+Y C+A N+ G+ E

              S ++ +   P                                    P  P K       
Sbjct: 24311 TSSKLLLQATPQFH---------------------------------PGYPLK------- 24330

                 E      G ++ L     G      TW   +K +Q SE++ +EN+E+ + L +   

              R+ H G Y + + N  G+  A +++ + DKPD P G      +  +S  +SW   + DG

             GS + +Y +E  ++     W+ +++  S T+  + +L  +  Y FRV A N +G S+P +

Query: 1418  ESELTTVGEKPEEP 1431
              S +  +    E+P
Sbjct: 24507 VSSVVIIKSPFEKP 24520

 Score =  118 bits (295), Expect = 6e-26
 Identities = 175/807 (21%), Positives = 305/807 (37%), Gaps = 149/807 (18%)

            T P  + GL ++ V++G  VT+   +SG P P V W     +I+ S DF    +     L

Query: 681  CIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQE-------------------------- 714
             I+E F ED+G +TC A N AG V T   L VQ                           

                           P +   P+FI+KP       G SV+  C + G+P P V+W + G 

             L   TG+ ++V  N+      LV+       AG+Y I+++N+ GE S   SL L+ +  

              L + ++    +      V        + G   PG+  +  +   E+E     + + K 

             V  R + E+    QE     F + L K++     KT  E+ L+E   E+M    +    

            V+    S  + ++ + + ++   V      S  P+P        +++   +    DF   

             R+ L     LP + G  +A   N K         NA  SG     P  P+G      TL

            +P+   +   +L P   ++    +  A     +         +       +    S+ + 

               P F  K       EG+      +V   P     W  +G+ +    T  +++ ++G+ 

             S+ I  A P D G +  VA+N AG++  S  +TV+                        
Sbjct: 1468 -SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---------------------- 1504

                                +  + P  ++  ++  ++ G  +E+  + TG       W+

            K    I   ++  +++E ++  + L I +   +    YT    NK G  + + +VN+ V 

Query: 1328 VDKPDP------PAGTPCASDIRSSSL 1348
              +P+P      P GT  A +I +  L

 Score =  115 bits (288), Expect = 4e-25
 Identities = 94/394 (23%), Positives = 168/394 (42%), Gaps = 26/394 (6%)

             + E Q +  +  ++G    +V W L G  +   E     Y  +GS     +K A  RD G

               +C +   +G + C + L + +   +  AP+F S  +   + EGQ+ +  C + G P P

              I W  N  PI  + +        V  L I++A   D G YT  A+N  GQ S +A + V

                         LP+   +P+  + L+   D   + GS  + +VQ+S +         + 

             +      +  F     Q    +QE F E + +      N   ++ +     ++    G  

             P   + P  ++   G+ + ++CA  G+P P V W   G+ +  ++ G F +   +D+ TL

             ++  VQ    G Y + L N  G  S  V++ +++

 Score =  115 bits (287), Expect = 5e-25
 Identities = 164/743 (22%), Positives = 263/743 (35%), Gaps = 170/743 (22%)

            F +++    + EG    F CK++G P P++ W K         R+   E+  M  L+   

                             G+AS+   + +   +    +F    K           N I   
Sbjct: 1298 ----------------DGRASLRIPVVLPEDEGIYTAFASNIKG----------NAICS- 1330

             KL  +E AA           G+P +    +P     S++ S   SPR+  ++P+     

                    R+ P   +P           R  PA   PA      PG   ++       R 

                       P F  KP S +  E QT +F  +V G P PE  WF +G  +        

            V ++ G+  L ++ A   DSG ++  A N  G+ S S  L VE +   +V P F   LK+

              + EG    ++    G P P I WL N     P +Y +   E   G A L I   + +D

               YT  A N  G+    C   V V   +   + + ++P          AP         

                          K   P F + L+ L++          +++  G+P   V WLH+G  

            ++ +            SL     +  D+G  TC A N  G   T A L V++        

Query: 715  ------------------PHDGT------------QPWFISKPRSVTASLGQSVLISCAI 744
                               H+G             +P  +  P  V    G++    C +

             G P P V+W  +G+ L + +  F V + + +  L +   + +  G+ ++  +N  G   

             +V L +Q        L R  EP

 Score =  113 bits (282), Expect = 2e-24
 Identities = 211/1044 (20%), Positives = 358/1044 (34%), Gaps = 249/1044 (23%)

             +K S RK E L     +   AP     +   +V  G      + V   P  EV W HNG 

Query: 662   EIQESE----------------DFHFEQRGTQHSLCI----------------------- 682
             E+QES                 D H +  GT  ++C                        

Query: 683   ---------QEVFPEDTGTYT-----------CEAWNSAGEVRTQAVLTVQE----PHDG 718
                      + VFPE T T              EA +S  EV++Q   T +      H  

Query: 719   TQPW--------------------------FISKPRSVTASLGQSVLISCAIAGDPFPTV 752
             +                              ++KPRS+T   G+S   SC   G+P PTV

              WLR G+ L     H +V   +   T  +  VQ    G Y ++++N  G+   + +L +Q

Query: 813   NS------------------------SARALPRGREPASCEDLCGGGVGADGGGSDRYGS 848
              +                        + ++  R + P                 +++   

             L    P +   +L+ E  +++          VL+ +  T     + +++    Q  +   

                ++    L+E D    + EI  E    + NLQ   +  K++ E+  K+   ++ D + 

Query: 955   --SVLAKKGTSKTPVPEKVPP--------------------------PKPA---TPDFRS 983
               S + +K   K P P    P                          P+P    T D ++

Query: 984   VL-GGKKKLPAENGS---------------------------SSAETLNAKAVESSKPLS 1015
             +  GGK KL  + G                            SS+  L  KA++ ++   

              + Q +  + P   A   E +     A  +E +K M  AK  E L   + ASK    EE+

             KK     +     H   T   + SE   T    K     + + EG++L+L+  ++     

              + W LNG  L  ++       GS  +++I++A   D G+  C++K   G  +C   +T+

                       + E+                SDA                 P  I  P  Q
Sbjct: 26822 ----------SKEL----------------SDA-----------------PAFISQPRSQ 26838

              +  G++V    +++G       W K    I  S ++ +  S N   L I  A     G 

             YT+  +N  G   A  +L V+   + P+          +SL  S+   S    ++ Q  S

                + S++ +   +   +  S + Q +    E    + + +  G S  +Q     S++  

              G +   PK E   SD    E +V

 Score =  112 bits (279), Expect = 4e-24
 Identities = 200/914 (21%), Positives = 315/914 (34%), Gaps = 183/914 (20%)

            +N  I EG    F  ++ GYP P++ W+++G+ I  G R+ +D    G  SL I  V  E

            D G YT  A+N  G    + +L VE   A  LG P    TL      R  +P   +R  I

Query: 156  WGE------------------------------------CPPKFATKLGRVVVKEGQMGR 179
                                                     P F  K       EGQ  R

            F  K+ GRP P+  W   G   +       V +++G Q L I      D G +T +  N 

            +G++S+S  L+++ ++      FV + K  N          I + S+L+    A  + N 

                      W  NS    P    + ++E  K        + V Q               

              T   + ++    +PEP      ++ P G  R K  A P   P      Q      D+ 

             K   ++           P F+ K  S  +K      F C ++  G P   V W  +G P

            +      + +  + G   L    A +RDSG  +C A+N  G    S TL           

Query: 503  -----------QVERLAVMEVAPSFSSVLKD---------------CAVIEGQDFVLQCS 536
                       ++E L  M    + + V  D                 V+EG+    +C 

            V G P P++ W LNGQ I+ ++       G+  L I D    D G     AEN  G +  

               + + +++  R    +L  AP  +P   +   G    +V    +   T +       E

            V+ L     I      +ESE+    F++R  +            S    E + E      

             E  +   E+  +    + E    T P F                  + +S T   G   

                 + G P P   W ++G  + +    +     ++V  LV++ V    +    +   N

Query: 799  RVGECSCQVSLMLQ 812
              GE S    L++Q
Sbjct: 2110 IAGETSSHAFLLVQ 2123

 Score =  111 bits (278), Expect = 6e-24
 Identities = 67/201 (33%), Positives = 103/201 (51%), Gaps = 4/201 (1%)

             +PP+I+  PE   ++AG+ + +   V G    TC W K   ++  S H+ V  +++ S L

              I    ++  G Y+L  EN  G+   ++ + V+D P PP      SDI + + +LSW+  

               DGGS + +Y +E  D +   W   LA+   TS  V  L+P  EY FRVRA N +G SE

             P    ++        P EPK+

 Score =  110 bits (275), Expect = 1e-23
 Identities = 73/206 (35%), Positives = 104/206 (50%), Gaps = 21/206 (10%)

           AP+F+  L+   V+EG     +  + G PVP ++W  +GQ I  +     + +   G A+

           L I      + G Y+  A N  GQ + +A + V       K+E     AP     P F+Q

            L  + V  GSQV + V+V+G P P V +  +G EIQ S DF   Q G  +SL I E +P

           ED+GTY+  A NS G   + A L VQ

 Score =  109 bits (272), Expect = 3e-23
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 57/306 (18%)

           T+AP F  P +++ + EG+TA FE  + G+P P+V+W R+GQ I++        G++ +F

           S     L I AV + + G+Y+ +ATNGSG    T EL V+   A                

                          PP F  +L  + V++G   R   ++TG P P V + +    +Q S

               +S++  +  L I     +D G Y+    N  G+A+ +AEL +QG            

           + +A  S  R+T+     +   +  ++ + E  +D   AA +     +P R   PP   +

Query: 312 SQPQPP 317
             P PP
Sbjct: 264 RSPTPP 269

 Score =  109 bits (272), Expect = 3e-23
 Identities = 65/193 (33%), Positives = 101/193 (52%), Gaps = 3/193 (1%)

            V+AG  +EL   VTG      TW K    +++ + + +EN    S +TI+ +++   G Y

             +   N  G   A V + V+DKP PPA     +D+ + S  L+W     DGGS + +Y +

            E   + ++ W +L +T + T+F    L+P+ EY FRV A N+YG  EP Q S +T   + 

Query: 1427 KPEEPKDEVEVSD 1439
             P  P   +E SD
Sbjct: 7576 DPPGPPTRLEPSD 7588

 Score =  105 bits (262), Expect = 4e-22
 Identities = 101/411 (24%), Positives = 157/411 (38%), Gaps = 48/411 (11%)

            +F    +  +V E +   F CEVS  P   V W  +   ++  +  I++ ++   H L +

               R  D+G Y+  A            +   +L V        S+ K+  VIE Q  V++

              V    V    W  +G  I +      +   E  +  + I +    D G YT +A    

                            +R S  L   AP  P     LQ L  + V  G        +SG 

            P P++ W      +       F   G +++L + E FPED   YTCEA N  G   T A 

            L+V+ P     D   P +    I+  +    S GQ     C ++G       + +D K  

             K +  F + Q ED + L + +  P   G Y  +  N VG+ S   +L L+

 Score =  104 bits (259), Expect = 9e-22
 Identities = 102/419 (24%), Positives = 172/419 (41%), Gaps = 48/419 (11%)

            P+   + Q   V+  +  +F   +SG P+P+++W+ E   +       +   D   + L 

            L++A   D+  Y+C A N  G  + S +L VE   V+          P+  + L+D    

            EGQ    QC V GT + +++W    +   P ++ R T      +L I +A PED GTYT 

            +A NA+GQVS +A +++  +        K  R+S     VA S  T         ++K  

             GS     VQV  +     I  H    +Q+++          H+  + ++      +  C

             A  S GE                 P      + VT   G +    C +  D F  V W 

             +G A  +++   +  QN ++  L +  VQ    G Y  ++ N  GE +    L ++ +

 Score =  102 bits (253), Expect = 5e-21
 Identities = 57/185 (30%), Positives = 97/185 (52%), Gaps = 7/185 (3%)

             +++ E  K RAG SV+L   ++G    T  W K  K++Q +  + VEN+ + + + I  A

              + + GCY L + N +GS  A + + ++DKP PP G      + +  +TL W   + DGG

             + +  Y +E  +++   W    + L  C  T+  +   +  +EY FRVRA+N YG  EP 

Query: 1417  QESEL 1421
             +   +
Sbjct: 20748 ESDSV 20752

 Score =  101 bits (252), Expect = 6e-21
 Identities = 76/249 (30%), Positives = 112/249 (44%), Gaps = 8/249 (3%)

             +PP +   ++  E   V+AG +V     + G    T  W     +I+  EH  VE     

             S LTI    +   G Y + V N  GS+   V+LTV+D P PP G     D+    +T+SW

                  DGGS V +Y +E  D+   TW  +++  S T   +  L    EY FRVRA N  G

                P  +S  T    K  P  P  +  V+D  E    V +     +    ++ +Y +E R

Query: 1470  LGSGKFGQV 1478
               +GK+ +V
Sbjct: 11439 EVTGKWVRV 11447

 Score =  101 bits (252), Expect = 6e-21
 Identities = 58/205 (28%), Positives = 104/205 (50%), Gaps = 6/205 (2%)

             PP+ +M P+   + +   V AGES ++   + G    T  W+K  +++  +  +++++++

               + L++  A +   G Y L  +N  G R   VN+ V+D+P PP G    S + +   TL

             +W     DGGS + +Y +E  +++   W  + A  ++ S  V  LL  +EY FR+ A+N 

             YG  EP +   +        P+ PK

 Score =  101 bits (251), Expect = 8e-21
 Identities = 78/253 (30%), Positives = 112/253 (44%), Gaps = 15/253 (5%)

             F +   VRAG S+ LF    G    T  W K    +  S    +  +++ S LT+    +

                G YTL VEN  GS+     + V+D P PP G     D+   S TL W     DGG+ 

             +  Y +E  +++ ++W+ ++  C    F V DL     Y FRV A+N YG  EP +  E 

                 E+P  P+  D V+ S         +P+ D         +   QK SDF+ +E    

Query: 1472  SGKFGQVFRLVEK 1484
                   V RLVEK
Sbjct: 22294 KQLTFTVERLVEK 22306

 Score =  100 bits (250), Expect = 1e-20
 Identities = 133/588 (22%), Positives = 220/588 (37%), Gaps = 101/588 (17%)

            +V W+   + + S  +F  L D   + T++LVI  V+ ED +G+Y CEA N SG    + 

            +LTV    A     PV+ +                           K+  + V  G + +
Sbjct: 4520 KLTVVKRAA-----PVIKR---------------------------KIEPLEVALGHLAK 4547

            F+C+I   P  +  W K    +  S + S+     +  LEI      D G YTC   N  

            G  S +A L  ++ G +   R  + E K    + ++EV   +V+ K  + +  +   K  

            +    P     PP      P+P  E ++ +     R  P+   + +   +I L A   +P

            +P A    +  P  E    P    P T P       ++    +AA  + P++G       

Query: 415  KFES-----KPQSQEVKENQTVKFRCEVSGIP---------------------------- 441
              E+     +P S   K      F  ++  +P                            

             P  A   W  +G+ + R+        D     L ++  +  D+G Y+C       + + 

            +  L VE L V  V     ++ ++  V++GQ   L C +       + W  +G+ +    

                 GV      L I DA   D GTYT   ENA   + CS+ V V E

 Score =  100 bits (250), Expect = 1e-20
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 20/255 (7%)

             ++F +   ++AGE+  L   V+G  P T  W K  K+++ +  ++++ ++  + L    +

              +   G YTL   N  G  +   N+ V+D+P PP G    +++ S    LSW+    DGG

             + +  Y ++  +++   W  +A+  + T   V  LL  +EY FRV A+N YG  EP +  

              +  V     P+ PK+ EV     D        P+ D  +  IN        Y +E R  

Query: 1472  SGKFGQVFRLVEKKT 1486
               K GQ +    KKT
Sbjct: 15390 -DKAGQRWIKCNKKT 15403

 Score =  100 bits (249), Expect = 1e-20
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

             V AGE +++     G      TW K    ++++  +  E++EN S LTI  A +E  G Y

              + + N  G     +N+ V+DKP PP G     ++ + S+TLSW    YDGGS++ +Y +

             E  D++  TW+ + AT   T+     L    EY+FR+ A N YG S

 Score =  100 bits (248), Expect = 2e-20
 Identities = 76/305 (24%), Positives = 116/305 (38%), Gaps = 60/305 (19%)

            V   F S +K+  ++EG      C + G P+P+I W  +G+ I    +Y     + G A 

            L I   LPED G YT  A N  G   CS  + V          Y   L PV+  +  +P 

Query: 624  -------------------------------------------------IFLQGLSDLKV 634
                                                             +F+      K 

            ++G      ++V G P PE  W H+G +I    +     ++ GTQ SL I    P D+G 

            +T  A N AG      +LTV+      +P F+ K ++V    G  + +     G+P P +

Query: 753  HWLRD 757
Sbjct: 1542 VWLKN 1546

 Score =  100 bits (248), Expect = 2e-20
 Identities = 191/884 (21%), Positives = 315/884 (35%), Gaps = 165/884 (18%)

            G+V   A++  S  +L     +V  +PL     FI P  ++ + E   AKFE  V   P+

                W +  Q IT   RF L+  G + +  +   A  +E +  +  E  + SG       

Query: 115  --------RQVTVELTVEGSFAKQLGQPVV----------------------SKTLGDRF 144
                    + VT +      F  +L    +                       KT    F

               +++    I  E                P F  KL      E       C+I+    P

             V W K    ++PS    +      ++L +    + D+G YTC    G+ K S   ++  

                      S++ +++    F  ET+ +  D+            +     I +E K+ S

            L       NC   Q GG    AAN +       K      L   KD   TA +T      

             S         L+  +++P  +      + P  E +      R      +    G   + 

            +K       +  +      +F    + Q V+E  T    CEVS     +V WF  GT + 

            + +   E+  D     L +      D  TY+C A + +   SC+       L V+     

            F   L D  V E +    +C +      ++ W  +G  I+  +      +  V  L I  

             L +D   Y+C    A      S  +TV E+++                  +F + L+++

            +V +   + +  +VS  P  EVIW     EI E+  +     G +  L IQ    ED G 

            Y C   +S    RT   + V E        FISKP+++    G+     C+I+ + FP V

             W RD K L +    ++V+ +     LV+K       G Y +++

 Score =  100 bits (248), Expect = 2e-20
 Identities = 66/237 (27%), Positives = 109/237 (45%), Gaps = 19/237 (8%)

             MPP I    E  +V  G +V +  K+ G    T TW K        ++ +    H+    

              ++   L I  +R+   G YT+   N LG+   ++ L V+ +P PP G      + +  +

             TLSW+    DGGS + +Y IE  ++  KTW  +++  +  ++ +  LL  HEY FR+ A 

             N YG  EP        +  +PE  ++   V  + D      V   ++T+N E+   D

 Score = 99.8 bits (247), Expect = 2e-20
 Identities = 106/466 (22%), Positives = 176/466 (37%), Gaps = 63/466 (13%)

            E  + +K    PQR  S P       +P     P E+ +++             ++KT+ 

              T +   V   PR       SP     K   P             G +  ++ +A   +

              E    S+  K     ++  VK ++T   R      P P+   F +     + E  +EV

             ++ G   + +     R+          A+   +      VE   +    P+  S LK+ 

             VIEG+   L+C + G P P +TW      I+ +   + T ++G+A L I++A  ED G 

Query: 581  YTCLAENALGQVSCSAWVTVH-----EKKSSRKSEYLLP--------------------- 614
            +TC A N  G VS S ++ V      EK+++  +E                         

               P +P AP F+      K+++G  V    QV GNP P V W  +G  +     +   +

             ++  +  L I   F +D G YT    N  GE    A L  +  ++

 Score = 99.4 bits (246), Expect = 3e-20
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 4/189 (2%)

             P+ +M P+   F +   V AGE+  L   V G    T  W++  K+I+ES   +++N++ 

              + L +  A +   G Y L   N  GS+   VN+ V+D+P PP G    + + S   +L+

             W     DGGS +  Y +E  +++   W  +A+   + S  V  LL  +EY FR+ A+N Y

Query: 1411  GTSEPSQES 1419
             G  EP + +
Sbjct: 17495 GVGEPLESA 17503

 Score = 97.8 bits (242), Expect = 9e-20
 Identities = 80/318 (25%), Positives = 131/318 (41%), Gaps = 41/318 (12%)

             +E   VK+ C++    +  +V W+     +   E     YED G   L +      D GT

             Y C   N  G+ S                 C  T++      + + ++E  P F+  L +

                  G++     ++   P P +TW  +GQ I+   +        + G+ +L I     +

             D   YT +A N  G+ SC A +TV           L P        P+F + L++ +  +

             G  V   ++VSG PPP + W  +G  +    +      G   ++L I++  PEDTG Y  

              A N+AG    QA L V+

 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 55/168 (32%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

             VR G +V L     G    + +W+K    ++ESE ++   +EN   L+I  A++EH G Y

             T++++N +      + +  +  P  P G     +I++ S+ LSW     +GG  +  YSI

             E  +++   WK + ++   T+F V +L+ D EY+FRVRA N YG S+P

 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 134/595 (22%), Positives = 226/595 (37%), Gaps = 60/595 (10%)

             P+   ++    V  GQ  RF   +  +P  +V W    V LQ S+++  +  +G+  LEI

                + DD G Y  +  N  G+AS  A L + G D    +  R  +     V  E+T    

               +S   K   +EA++  +   S     +    + S  +    ++++S     ++  +  

               +K  +++   AAR+  +PR+    +    GE  +          PT    L    V+S

              +A  ++     + +   +  S   S E     V EN   K   E +  I K  V     

              +P R +     V           +K+  R  S   S   + +  +   + T +V+ L V

                 P  +  LK  A    +   L C V  + +    +TW  +G+ ++    +       

             G  EL I +    D G Y C      G      Q    A+ ++HEK        KS +K+

                     ++P AP       + + GL D  V   S     V+ +G P P  IW  +G  

             I +   +   +      L I +    D+G YTC   NSAG V +   LT++   D

 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 56/168 (33%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

             V+AG +V L   V G    T +W K    ++ +E +K+    N   L + +  ++  G Y

             T+  EN  GS+ A + L V+DKP PPA     + + S    LSW     DGGS + +Y +

             +  +++   W ++ AT   TS +V+ L+  HEY+FR+ A N YG  +P

 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 114/507 (22%), Positives = 189/507 (37%), Gaps = 105/507 (20%)

             K +    I+KTS + +  R  +    E  AF      + I EG     +  + G  +  V

              W  NG  +T+   +    G+ G+  +L I      D G  TC +    G  +   +LT+

                          SK L D   APA  ++P                  + EGQ   F+C+
Sbjct: 26822 -------------SKELSD---APAFISQPRSQN--------------INEGQNVLFTCE 26851

             I+G P P++ W K N+P+  S+ VS+S    +  LEI   +  D G YT    N  G+ S

              +A L +  L                 V +    V+ + S   SL+   +++S   S+ +

             +  S    ++S      E K  S      ++ Q   ++ +SSS                +

             G+ + +  E                    S   + KA  R IP         PK E+ P 
Sbjct: 27000 GISNMTQLE-------------------SSTSKMLKAGIRGIP---------PKIEALPS 27031

                + E + +   C  +G P PEV W   G  +  QE G   +        L ++  + +

             D G Y+ +  N  G  S +  + +  +

 Score = 96.3 bits (238), Expect = 2e-19
 Identities = 57/211 (27%), Positives = 97/211 (45%), Gaps = 7/211 (3%)

             P T      PP + + F +   +R GE+  L G+ +G      +W K    + E +   +

             + +     L  + A++   G Y ++VEN  GSR+    + VVD+P PP G     ++   

              + +SW     DGGS + +Y IE  +     W  + +  + T+  V  LL   +Y FR+ 

             A N+YG S+P     +       V + P++P

 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 69/265 (26%), Positives = 127/265 (47%), Gaps = 11/265 (4%)

            +G    + + +    K P      P I     D  V  GE + +          T +W K

              K+++ S+ + ++N    + L +  + +   G YT+ +ENKLGS  A +N+ V+  P P

                  ASDI  SS  L+W    +DGG+ +  Y +E  ++  +T+  + +  +  S+ V+

            DL+P+ EY FRV+A+N  G  E   E +   + + P++P D   +VEV +   +   + +

            +    +   K+  +  I E++  G+

 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 85/332 (25%), Positives = 138/332 (41%), Gaps = 31/332 (9%)

             ++A +E+ P    ++      EG      C +       ++TW    + ++ +     T 

             E GVA L+++D    D GTY C   N  G+ S  A + V               KK  R+

             ++ + L   P + T P++     +     G  V   V ++ +P P V W  +G +I+  +

             +   + FE     + L I  V  +D   YT  A N  GE   +A LTV     P D T +

             P F     +     GQSV     ++G P PT+ W +DG+ L        + +  D + L 

             ++   P   G Y +   N  G  SCQ  L ++

 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 65/220 (29%), Positives = 111/220 (50%), Gaps = 17/220 (7%)

             ++AG+++ L    + G      +W K  K I+ S+  ++ ++   S LTI  A ++  G 

             YT+   N  G++   V +TV+D P PP G    S++ +   TL+W     DGGS ++SY 

             +E  +++   W    +++ +CR  +     L+  +EY FRV A+N YG  EP Q   +  

             V    P  P ++ EVS+       V   T T++ ++ V D

 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 64/231 (27%), Positives = 105/231 (45%), Gaps = 5/231 (2%)

             VRAG S+ +F  + G      TW K    I       +EN+E+ + L I    +   G +

              + +EN  G +   VN+ V+D P P       +DI   S+TL W     DGGS + +Y +

             E  ++  K++    T C   ++ V  L    EY FRV A N YG  EP++ +E     E 

             P  P D + + D  +    + +     +   K++ +    +R GS ++  +

 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 4/186 (2%)

             PP+  M    ++F +   V+AGE +++   + G      +W K   +I+E    ++ +++

             N + LT+    +   G Y L ++N  G+R   VN  V+DKP PPAG    + + +   +L

             SW     DGG+ +  Y +E  ++++  W       + TS  V  LL  +EY FRV  +N 

Query: 1410  YGTSEP 1415
             YG  EP
Sbjct: 19658 YGVGEP 19663

 Score = 94.4 bits (233), Expect = 9e-19
 Identities = 65/215 (30%), Positives = 105/215 (48%), Gaps = 12/215 (5%)

             +RAG S+ L   V+G  P   TW K  + I  +    ++ +E+ S L +    +   G Y

             T+  EN+ G + A V + V D P P        ++   S+T++W   + DGG+ V +Y +

             E  ++A + +K + T C  T + +  L+    Y FRV   N+YG  EP + S+   V E 

             P  P  ++EV D       V   TVT+  E+ + D

 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 58/184 (31%), Positives = 91/184 (49%), Gaps = 4/184 (2%)

             V+A E +++     G    T  W K  + ++E+  + V +S+  + L+I  A +E  G Y

              L V N  GS    + + V+D+P PP G     ++   S+T+SW    YDGG  + +Y +

             E  ++ + TW  ++     TS  +  L    EY+FRV A N YG S  S+ S    V E 

Query: 1428  PEEP 1431
             P  P
Sbjct: 19278 PFSP 19281

 Score = 93.2 bits (230), Expect = 2e-18
 Identities = 60/199 (30%), Positives = 97/199 (48%), Gaps = 12/199 (6%)

            +AG  + +   + G      +W    K +K +++  H      ++E +EN S + I   +

            + H G Y++  +NK G + A   + V+D P PP      SDI   S  LSW     DGG 

             ++ Y IE      K W ++   C ST+F V DLL + +Y FRVRA N +G   P +  +

Query: 1421 LTTVGEK--PEEPKDEVEV 1437
             TT  +   P +P  ++++

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 146/682 (21%), Positives = 239/682 (35%), Gaps = 63/682 (9%)

            + P F     +L +K    A FE R+   G P   V W  +G+P+ +  R  +     G 

             SL     +  D G  TC ATN  G    +  L V  E S  ++   P   K L      

              +    ++ G       +  P        V V EG+  RF C++TG PQP+V W     

             ++ S R  V   +G+  L+I      D G       N  G      +L IQ  +   RS

             +R       +        +  E  K+D      ++K     +R          +     

             SK +   +       T V  K+          ++             + EE+K  A   

              T PT +P              +I +    ++  PK   + QSQ V +     FR  V 

            G P PE  W+  G  + R +     + +     L +      DS +    A N  G+ S 

               L V+   ++    +F+  L+D    E             P  ++ W  +G  +    

              R   +  V  L I      D   Y+C              V V ++     ++ ++  

            A  +     F++ L D++V +     +   VS    PE I   W HN  E++ +  +   

             R  + +L +++V  ED G Y+

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 58/210 (27%), Positives = 105/210 (50%), Gaps = 6/210 (2%)

             P A++ P+   + +   V AGE+  L   + G       W K  K+++E+   M+++++ 

               + L +    +   G Y L + N  G++   + + V+D+P PP G    + + +    L

             +W     DGG+ +  Y IE  +++  +W +++T  ++ ++ V  LLP +EY FRV A+N 

             YG  EP +   +T     KP  P    EVS

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 7/197 (3%)

             T +  TV+      T   + MP + I  P      AG  VEL   + G  P   +W    

              +++ESE + VE     +KLTI        G YTL ++N  G+    + + ++DKP PP 

             G     +I ++S+T+SW     DGG+ +  Y +E  D+    W  ++ +   ++F    L

                +EY FRV A N +G
Sbjct: 23592 TEGNEYVFRVAATNRFG 23608

 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 76/236 (32%), Positives = 105/236 (44%), Gaps = 16/236 (6%)

            +P+T  P  +   +N+ + EG +   E  + GYP P VTW+R    I S   F +     

            G   L+I     ED G++TC A N +G    +  L V+ S   +     V++   T   R

            F  S   V T  S+  E         P F TK     + EG    F C++ G P+P V W

             K  VPL    R  VS +++ G   L I     DD G YT +V N  G+ S SA L

 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 64/227 (28%), Positives = 106/227 (46%), Gaps = 6/227 (2%)

             +AGE V++     G  P T TW K  K +       +EN+++ S LTI    +   G Y 

             L +EN +G  + + V++ V+D P           +   ++TL W     DGGS + +Y I

             E  D+  +TW  ++  C STSF + DL     + FRV A N  G  EP + +E     E 

             P  P  ++ + D  +    + +     +    ++++  + ER G G+

 Score = 91.7 bits (226), Expect = 6e-18
 Identities = 50/166 (30%), Positives = 86/166 (51%), Gaps = 1/166 (0%)

             V+ G+ +++   ++G    T TW K    ++++  + V +S + + L+I    ++  G Y

              + V N +G + A + +  +DKPDPP G     D+ + S+TLSW    Y GG  + +Y +

             +  D+    W  + AT   T+  V  L    EY+FR+ A N YG S

 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 59/183 (32%), Positives = 95/183 (51%), Gaps = 10/183 (5%)

            KV+AGE V +   VTG       W K    I++          +V  SE  ++L+I  A 

            +E  G YT+   N+LGS    V++ V D+P PP      +DI++ S  L+W     +GGS

             +  Y I+  D++ K   W+E+  T     + +  L+P+ +Y+FRVRA+N YG S+  + 

Query: 1419 SEL 1421
Sbjct: 9283 DKV 9285

 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 63/190 (33%), Positives = 89/190 (46%), Gaps = 7/190 (3%)

             P P        PP++I       +Q ++ G+++ L   + G      TW K  +      

              + V  +  GSKL I  A  E  G Y+L VEN  GS+   V + V+DKP PP      S+

             IR  S  L+W     DGGS + +Y +E  D A+  W  L AT +  S   + L   ++Y 

Query: 1402  FRVRAINVYG 1411
             FRV A N YG
Sbjct: 11076 FRVAAENQYG 11085

 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 65/207 (31%), Positives = 101/207 (48%), Gaps = 10/207 (4%)

             PKA    +PP+I    + +KV   RA  ++ LF  + G       W   R   +  +   

             +E++ + + L +    +   G Y L VEN  GS+ A VN+ V+D P PP       ++  

             +S+TL+W     DGGS +++Y +E  +S  K +  +AT C  TS+ V  L     Y FRV

              A N YG   P++ +E     E+P  P

 Score = 90.5 bits (223), Expect = 1e-17
 Identities = 84/289 (29%), Positives = 126/289 (43%), Gaps = 32/289 (11%)

             V AG  + +   V+G  P T TW M  R   QE+    +E +   S + I   ++ H G 

             Y+LL +N+ G R+  + + V+D P  P GTP  A ++ + S  L+W+    DGGS + +Y

              IE  +S  + W  +  T    +  VQ L+    Y FR+ A N  G     + SE   + 

             E    PE P+D +EV        EV   TVT+       D       Y +E RL G+ KF

                     K T      + +     KE +     +S +N +   K   C

 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 55/184 (29%), Positives = 93/184 (50%), Gaps = 4/184 (2%)

             +RAG S+ LF  + G       W K   +I+++  + V +S   + L +    +   G Y

             TL +EN  G++ A V + V+D P PP      ++I   S++++W     DGGS +++Y +

             E  ++  K++  + T C   S+ +  L     Y FRV A N YG   P+Q ++   V E 

Query: 1428  PEEP 1431
             P+ P
Sbjct: 16826 PQPP 16829

 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 67/250 (26%), Positives = 113/250 (45%), Gaps = 15/250 (6%)

             P   P      +++++P+   D++ + G  V   G +  T PI       C W K  + I

               S+   +  SE  ++L I  A +   G Y L++ENK G +   + + V+  P+ P G  

                DI+  S+ +SW   + DGG+ +  Y +E  +     W  + +  R TS  V+ L  +

              EY FRV A N +G S+P +  E  T       PE P +  EV D  +    + +     

Query: 1455  NTEQKVSDFY 1464
             +   +V+ +Y
Sbjct: 24051 DGGSRVTGYY 24060

 Score = 89.4 bits (220), Expect = 3e-17
 Identities = 55/193 (28%), Positives = 93/193 (48%), Gaps = 5/193 (2%)

           AP F Q L  + V++GS  T    +SG P PEV W  +G  I  S            +  

           L I  V   ++G Y+ +A N +G+  + A L V+   +   P F+ + +S+T   G  V 

           +   + G P P V + RDG  + + +  F++ Q  D+++L++ +  P  +G Y +   N 

Query: 800 VGECSCQVSLMLQ 812
           VG  +    L++Q
Sbjct: 182 VGRATSTAELLVQ 194

 Score = 89.0 bits (219), Expect = 4e-17
 Identities = 94/390 (24%), Positives = 154/390 (39%), Gaps = 52/390 (13%)

            Q++   P     P+   V E +T +FRC V+G P+P+V W+L G  +R+ +     Y+  

            G HYL ++  ++ D+G    TA N +G +     L++++         F SVL+      

             +  V     LQ  V+    P        +  L   + I + +   E+   EL  +    

             + G Y  +              E  L +       W      E+K +   E  + +   

            KP          AP   + +    V  GS     V+V G P PE  W  NG +I+ S+  

            + +        L I++V  ED+ +   +A N AGE  + A L VQ     T   F  + +

             V A    ++        +PF  V W +DG

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 62/207 (29%), Positives = 97/207 (46%), Gaps = 11/207 (5%)

             PK  + P  I      +    VRAG  + LF  V G      TW K      +++ +   

             V+  +  + L I  + ++  G Y+L + N  G +   VN+ V+D P P +     SD+  

             +S  +SW     DGGS V  Y +E  ++  KTW  +    + TSF+V +L+P +EY FRV

              A+N YG   P+   +     +   EP

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 11/211 (5%)

             P   P    P  I+  PE +          +RAG ++ L+  V G  P   TW K    +

             ++   + +++++  + L      +   G Y L +EN  G ++  + + V+D P PP    

                +I   S  ++W     DGGS + +Y ++  D+  K+W  + T C  TSF V +L   

               Y FRV A N YG  +P +  +     + P

 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 66/230 (28%), Positives = 106/230 (46%), Gaps = 15/230 (6%)

             PP+I    + +KV   RA  ++ LF  + G       W K    +  ++  ++E + + +

              L I    +   G Y L +EN  GS+ A VN+ V+D P  P       +++  S+TLSW 

                 DGG+ + +Y +E  ++  K +  +   C  T+F +++L     Y FRV A N YG 

               P++ +E   V E P  P     V        +V   T TI  E+  SD

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 56/184 (30%), Positives = 89/184 (48%), Gaps = 4/184 (2%)

             VRAG S  +     G      TW   R++ + ++ +++E   N ++L+I    +   G Y

              L +EN  GS+ A V + V+D P PP       ++R  S  L W     DGG+ V++Y I

             +  +S  K +  +++ C  TSF V++L     Y FRV A N +G   P +  +     E 

Query: 1428  PEEP 1431
             P  P
Sbjct: 17908 PSPP 17911

 Score = 87.0 bits (214), Expect = 2e-16
 Identities = 46/168 (27%), Positives = 85/168 (50%), Gaps = 1/168 (0%)

             ++AGE +++   V G      +W+K  + ++++  + VE +   + L I    ++  G Y

             T+   N  G+    +++ V++KP PP G     ++ +  + +SW   +Y GG  + +Y +

             E  D+   TW  + AT   T+  +  L    EY+FR+ A N YG S P

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 64/210 (30%), Positives = 99/210 (47%), Gaps = 11/210 (5%)

           P F    QS  V E  T  F   +SG P PEV+WF +G  +       +++    G   L

            +      +SG YS  A+N  GQ     T   E L   E A P+F   L+   V +G   

            LQ  V G P P + +  +G  IQ +   + + E  +  L I +A PED GTY+  A N+

           +G+ + +A + V   E+  ++K++ ++  A

 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 60/221 (27%), Positives = 94/221 (42%), Gaps = 31/221 (14%)

            P F+L P +    EG TA+F+ +V G P P+  W  +GQ I +     +     GT SL+

            I      D G++T  A N +G   ++V LTVE                       AVE  
Sbjct: 1471 IVPATPSDSGEWTVVAQNRAGRSSISVILTVE-----------------------AVE-- 1505

                 +  P F  KL  V +KEG       + TG P P + WLK +  + P    ++ + 

               G   L+I      D   YT   +N +G+ +   +++++

 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 46/155 (29%), Positives = 76/155 (49%), Gaps = 1/155 (0%)

             + G    + +W K    +     + VE+S   + L +   ++   G YT+ ++N  G+++

               +++ VV KP  P G     ++ + ++TL W     DGGS + +Y +E  DS N  W  

              A+  + T+F V  L    EY FRV A N YG  E

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 53/182 (29%), Positives = 87/182 (47%), Gaps = 4/182 (2%)

             PP+I    FP     VRAG ++++   ++G      T  +    ++ +     E +    

              + +  +     G Y +   N  G+ +A +N+ V+D+P PP G    SDI   S+TL W 

                YDGGS V +Y +   +++   W E+ AT   T   V  L    EY+FR++A N +G 

Query: 1413  SE 1414
Sbjct: 20348 SD 20349

 Score = 83.2 bits (204), Expect = 2e-15
 Identities = 49/183 (26%), Positives = 90/183 (49%), Gaps = 5/183 (2%)

             P I++F  +      +++GES+ +   V G      TW K   +I++  +M++ +    +

              L +  A ++H G YT+  +N  GS +A++ + V D P    G    ++I    +TL W 

                 DG + +  Y IE  +++   W  +   C + S+    L+  +EY+FRV A+N +G 

Query: 1413  SEP 1415
Sbjct: 21830 GRP 21832

 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 112/474 (23%), Positives = 180/474 (37%), Gaps = 54/474 (11%)

            H EE+  QQ   +  +++    ++S   ++E   +  PA +      + + VKP+ +   

            SE   K    + +   S + K     T     V   P+ A+P F      K  +P     

              A    +      K LS    +   + +  +  A T+KP      AE   L     A  

             +  KS +  E+KK+V   +       GTT  E+R E                       

            T P     L++V V EG+ + L+C +S  P  T+ W      ++++    ++ +  +  +

             I +A  ED G + C A N+AG    SC   V V +    E T   E  +   K  +   

                +D ++ ++ A    P A   P  I  P  QK+  G SV    +V G       W K

                +      KV  N + G  KL I     +  G YT++V NK G   A  +L

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 94/368 (25%), Positives = 148/368 (40%), Gaps = 59/368 (16%)

            ++G++ +   K + +P         Q+V E   V+   +VS +   E  W  +G  V+  

            +  + +  D  SH L +      D+G YS T       L  S + +V   +V  + P   

              LKD  VIEG   VL+C V    V  + W LN + I+     ++  +     L I    

              D G Y  +    +G+V  +  ++V + K                     ++GL DL  
Sbjct: 2463 ASDEGPYKLI----VGRVETNCNLSVEKIK--------------------IIRGLRDLTC 2498

             +   V   V++S +   +V+W     EI+ S  +  E  G  + L +  +  +D G YT

                  AGE  T   LTV           ISKP    T +  Q  +  C +A +P     

Query: 754  WLRDGKAL 761
            WLRDGK L
Sbjct: 2606 WLRDGKHL 2613

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 101/443 (22%), Positives = 165/443 (37%), Gaps = 57/443 (12%)

            D E R++ +   AP  K   QD+ V  GK L +     + P A   W    + L T    

              +++ S   +  +K    D+G YK V +N  G+AE    + V D P             

                   PV   E   T   +               +    ++ +  G S ++ G V   
Sbjct: 6787 -------PVRNLEVTETFDGE---------------VSLAWEEPLTDGGS-KIIGYVVER 6823

            + I   TW+    + +  E       + G +     + +   G    +  +N + +R   

                  D P PP      +D+    ++L+W    YDGG+ + +Y IE+ D  +  W    

            T R+   S  V D++   EY FRVRA N  G  +PS  +    V +  E P   V ++  

            D+ +  V  +      +        I ER   GK   +    +LV + T KV       K

            +    SA+ K  +     I+  L

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 53/185 (28%), Positives = 85/185 (45%), Gaps = 4/185 (2%)

             V+AG S  +     G       W K    ++   +  V+ +++ + LTI  A +   G Y

             TL ++N L +    + + V+D P PP       D+   S  LSW     DGG+ V++Y I

             E  +++ K W  +   C   S+ V +L     Y FRV   N +G   P++  E   + EK

Query: 1428  PEEPK 1432
             P  P+
Sbjct: 20070 PSPPE 20074

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 62/203 (30%), Positives = 92/203 (45%), Gaps = 4/203 (1%)

             E + S  SE + P +     AP F + L +L V   S  T+  +V+G+P P V W   G 

             EI  +   +  ++ +G  H L I  V  +D   Y   A N  G V   A L V+ P    

              P  +    +V A  G+ V I    +G P P + W + G+ L  + GH++V+      +L

             V    V+   AG Y +  KNR G

 Score = 82.0 bits (201), Expect = 5e-15
 Identities = 70/273 (25%), Positives = 106/273 (38%), Gaps = 32/273 (11%)

             R D+M L E P  F LP  N     G   +F   +  +PEP VTW+++GQ I  G    +

             +  +   +G + L I++V  +D  +YT  A N  G      +LTV       L  P    

             TL                    P F   L     +EGQ   F  +++G P P + W K  

              PL     +  + E      L I     +D G Y     N +G  S  A L ++ L    

             + F +  +     V+K++   +     L   E+

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 59/221 (26%), Positives = 100/221 (45%), Gaps = 7/221 (3%)

             V+AG+++ L   V G       W K +    +  S  +K++   + SK ++  A++   G

              Y +   N  GS  A   + V+DKP P        D+ S   T+ W     DGG  +Q+Y

              +E  ++    W    AT  +    V  L+  +EY FRVRA N  GT  P++   +   T

               +KP  P D  EV+   ++E  V +     +  + ++ ++

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 53/193 (27%), Positives = 89/193 (46%), Gaps = 4/193 (2%)

             AP   + + D+    G    ++ Q+ G P P++ W   G E+ +S  +     G  H+L 

             +     ED G YTC A N  GEV T + L +Q       P +  K +   A +G ++ + 

                 G P P + W   G+ L +++ +  +   E    LV+K VQ   HAG+Y++ L N  

Query: 801   GECSCQVSLMLQN 813
             G     + + +Q+
Sbjct: 24404 GTVDAILDVEIQD 24416

 Score = 81.3 bits (199), Expect = 8e-15
 Identities = 94/402 (23%), Positives = 159/402 (39%), Gaps = 55/402 (13%)

            F  + Q    KE  T+  F CE S  P  +V W+ +G  V   +    ++ D   H+L +

            L   T D+  YSC     +   + +      +L V      F   L+D  V E     L+

            C V    +    W  N   ++       T   G   L ++D   ED G Y+ + +     

                       KK++ K +        KP     LQGLSD KV +G  V + V+VS    

             E +W+ +G E+Q S+  H       H L I+++  ED G Y+        +++G V   

            +V              I+  + V    G   ++ C ++     +V W  + + + K    

             + +       LV+ +      G Y++++  RV E +C +S+

 Score = 80.9 bits (198), Expect = 1e-14
 Identities = 171/811 (21%), Positives = 301/811 (37%), Gaps = 112/811 (13%)

            + E ++  F  E+S    P   W L+G  + R   + E+  + G  +L L K +   +G 

                A NA         +    L V E+   F+  LKD  V E +    +C +  T    

            + W      I+ +         + HI    D+  +D G YT   E    + S   +VT  

              K                    F+  L D  V +G   T   ++S +    V+W  N  

            ++  S        G  H L ++EV  +D      +      E+ + A L V E      P

            +F  K    TA     + + C ++ D    V W +DG+ +      + +  +     L +

            KK      G+Y          C C       N +  A L +  +P    ++  G      

             +    D +G     W  +GQ      D E +    K  +         T + + +A   

            +    L  ++L    +    LS  D+K    ++  F   + R+  PKT     R +   Q

            ++  D R  L K GT  + V +       A   F +      +    +G    E +  K 

            +   K ++  +    +  V  +     +K   N +   T + + + + +    S + ++L

              D  + +  +    G +   K +  +G  P F  KLQD    E  +++LQC++S    A

             + W  +GK +K +K  ++  +G    + ++KAL  D G Y C    D G  + S ++ +

            +D          E+K  RP  S+  V+ TE+
Sbjct: 5798 EDR---------EIKLVRPLHSV-EVMETET 5818

 Score = 80.9 bits (198), Expect = 1e-14
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 9/209 (4%)

             PPKA +  ++    +   +RAG  + L   V G       W K  K++   E + ++ + 

               +   I    +   G YTL V+N  G++   V + V+D P  P G    S +     TL

             +W     DGG+ +  Y +E  +++   W  +   C + S+ V  L+ ++EY FRVRA+N 

             YG      SEP       T+   P  P++

 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 1/163 (0%)

             +AG+++++   V G    T TW K  + +++++ +  E +   + L I    +   G Y 

             L   N +G     + + V D P PP G     ++ S  +T SW     DGG  + +Y +E

             +  + + TW ELA T   T++    L    EY+FRV+A N YG

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 39/112 (34%), Positives = 62/112 (55%), Gaps = 1/112 (0%)

            EED  +     ++E +  V+  F   I++  ++EG    F CK+ GYP P++ W+KD + 

            I+    +Q+D+ +DG  SL I  V  +D+  YT  A N  G A C+ +L VE

 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 157/770 (20%), Positives = 278/770 (36%), Gaps = 117/770 (15%)

            P +++  P  EAP      ++  + +G+ A F  RV G P+P+  W++NG  I    R  

                      LVI  V  ED      +A N +G       L V+   AKQL         

                                  F  +L  VV KE   M  F C+ T  P  +V W K  +

             +    +  +     +  L I  ++  D   Y+C++V        +A+L ++G   A   

            FV+E +          E+  ++S E+       + +E  +  K   + +RG       + 

              +   E       K  +CK   +  P   +LQ  S     +   VQ E +       GV

                G+E  +P+         +   L  +D+  + A      IP  G   S      S  

                +K+   ++       C+VS      V W+L    + + +  ++         L + 

            +    D G Y        G++  +  L VE++ ++         L+D    E Q+ V + 

             +  + +  + W    + I+ +   +      + +L + + + +D G YT  A    G+ 

              S  +TV               A SKP        L+D  V +  +     +V+ NP  

            +  WL +G  +  + +   E  G +  L I     +D G YT +   S    +T A L V

            +          I K  +++T +  Q  + +  +       V W+++G  L

 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 57/207 (27%), Positives = 88/207 (42%), Gaps = 10/207 (4%)

             P+F     ++     + V+F   ++  P+P V W+  G  ++  +   +     D G + 

             L +    T D   Y+  A N  G+ SC   L V          + P F  +L +    EG

             Q    +  V G P P + W  +GQP+    +      G+    LHI+D LPED G Y   

             A N  G  SC A + V E+   +K E+

 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 68/246 (27%), Positives = 109/246 (44%), Gaps = 42/246 (17%)

            +P+  TPP  A+ P  I  P+       +V+ G+ + L   ++G+   T TW+K      

Query: 1277 -----------------QIQESE--------HMKVENSENG-SKLTILAARQEHCGCYTL 1310
                             ++QE E         + ++NS+ G S+L +  + +   G Y +

             VEN  G  +A   ++V+D P PP       DIR +S+   W     DGGS + +Y++E 

             D    +  W  + +T R   ++V  L+   EY FRVRA N +G   P     L  V + 

Query: 1428 PEEPKD 1433
            P  P D
Sbjct: 8594 PFGPPD 8599

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 164/786 (20%), Positives = 281/786 (35%), Gaps = 119/786 (15%)

            I P +++ + EG  A  E +V       V W+ N + I    R  +   ++GT   LVI+

              H  D G Y        G  +    L+VE                              
Sbjct: 2460 RTHASDEGPYKLIV----GRVETNCNLSVEKI---------------------------- 2487

                   K    L  +   E Q   F  +++      V W   +  ++PS++  +     

            +  L +  + +DD G YT      +G+   S +L++ G  + ++    +T A + +    

             EV N  SK   L   +    + N  S   G        A           K+ + K S 

            +   +   ++KT  ++T+   +          P   G+     GV+  S E+        

              +   +   +  + V      R +    +      K   KP+     EN TV F   VS

                P V WF +   ++  +    +  +   H L L      D+G Y+       GQL C

               L VE L +       +  +K+  V E +    +C V    VP + WL NG  I+ + 

                  +  + +L I +   ED   YT +  N   QVS +  VT                

                   PI +   L D+   +   +T  V V+        WL NG EI+ ++      +

               HSL I+ V   D   YT      AG+  + A L V+  H      F    + +    

             +  +  C ++ +P  TV W++D + L + T   ++ + + V  L++   +   AG+Y +

Query: 795  LLKNRV 800
            +    V
Sbjct: 3084 VAGGNV 3089

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 56/212 (26%), Positives = 97/212 (45%), Gaps = 7/212 (3%)

            P T   A + P   +  F +  +V     + +    TG    T TW    K ++  + +K

            ++     ++L I  + +   G YTL +EN++ +   ++++ V+ +P  P       DI  

             S+ L+W     DGGS +  Y +E  + + KTW K +       F V DL+   EY F+V

             A N  G  EP+   E   ++T    P+ P++

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 69/335 (20%), Positives = 137/335 (40%), Gaps = 41/335 (12%)

             PA  ++L  V  ++   +L   +   D  + I   L     K + F + +      + ++

             E+ + +    ++  AKNDAG +E                         P+ +   V+   
Sbjct: 22301 ERLVEKTEYEFRVKAKNDAGYSE-------------------------PREAFSSVI--- 22332

                 +K+     T     +  Q+I        +AG    +   ++G      TW     +

             ++E++ + +  +++ + LT+  + +   G Y L +EN  G +   V + V+ +P P  G 

                S + + S  LSW      GG+ + +Y +E  +S    W+ + ++ + T   V  L  

               EY FRV + N +G S+P + + +  + E P  P

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 85/361 (23%), Positives = 146/361 (40%), Gaps = 24/361 (6%)

            S+DVV    +      G  + A P F +KP  Q++ E  +V F C+V G PKP V W   

            G P+       +   +  G   L +      D+G Y+    N  G+ S S +L +E    

              +  S   +L    V     FV +  V G   P   +    +  +  ++     +A+  

            + ++  + +     +   E  + ++      T  E+  +   + +  + ++ S+     F

               + + ++++G  VT   ++SG P P++ W  +G  I+  E +   F Q G + SL I 

             V PED G YT  A N  G       L V+       P +I             PRSV+ 

Query: 733  S 733
Sbjct: 1367 S 1367

 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 81/346 (23%), Positives = 127/346 (36%), Gaps = 63/346 (18%)

             P  K       V  G+ L ++  +S  P  TI WT +G  LK T  I ++    L ++SI

             ++   +D G Y     N  GQ   S ++   D P  +  K P                  

              D + +       PP      QI  +   ++                   T  W      

             +  +  +KV   + G++             + +  EN+ G   A  +  +V      +P 

             PP GTP A+ I   S+ + W+    +GGS V  Y +E       +W   NKT        

              T F  Q+L    EY+FRV A N+ G  + S+ SE     +  + P

 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 85/383 (22%), Positives = 150/383 (39%), Gaps = 47/383 (12%)

            F + L+D  V E    +  CQ+S +  A + W  NG+ +K  K     ++GS+  + I+ 

               +D   Y C  ++   +A    + + V+         +AP ++     E+   +    

Query: 1207 --KSSLPPVLGTESDAT-----------------------VKKKPAPKTPPKAAMPPQII 1241
              ++++  V G +                           + K    +   + A  P+I 

               +D  V  G+ + +             W K  + +       ++ +   +   IL A+

            +   G Y ++++NK G  +  +NL V+D P P       ++     ++L+W     DGGS

             +  Y +E  D   KTW  LAT R+ S  F V  L     EY FRV A N  GT EP + 

                    K + P   + V+  D

 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 43/138 (31%), Positives = 66/138 (47%), Gaps = 2/138 (1%)

            S TG+       E L   E  V++        E P   P     ++++ V+EG +   +C

             I GYP P V W+++D  I  S  FQI + + G   L+I +   +D  ++TC AVN  G 

             + +  L V+  EE E E

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 129/604 (21%), Positives = 220/604 (36%), Gaps = 74/604 (12%)

            K   P+    L D    +G  V +T  ++     EV W      +   E F   Q    +

            +L I +V  ED  G Y CEA N +G+  T A LTV +      P    K   +  +LG  

               +C I   P     W + G+ +  ++    +  ++ + +L + + Q    G+Y     

            N  G  SC  +L +         R L   R+P   E++                S+    

            P   +  +E +  E V    K+         + + + EV  +  R+   +K+   T   +

                IP    + +   + +V   KP  V  E   + +P  V    V+ KK  +K P  E 

              P  P       + G  KK P+   +   +       E      P +    + PLK V 

              K     +   +G++   E L     A     K   N++ + K     D K+       

                   +  C  + G+   T   K    +      K   ++V V +G+ L L C+++ +

                ++W  +GK  ++    I+    G + +++I  A   D G Y    +N A   ECS 

Query: 1184 QVTV 1187
             V V
Sbjct: 4992 CVKV 4995

 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 89/411 (21%), Positives = 156/411 (37%), Gaps = 69/411 (16%)

            N++P ++LK   +E +  D +  +  +  +A G ++  + SE+         P    +  

            D+ V EG+KL +     + P  T+ W  +GK +K +  + +  +     + + K++  D 

            G+Y    +N  G A  S  V V   P        ++K+              SD T    

                 PP+                             G  PI   ++  R++     ++ 
Sbjct: 8192 KLTWEPPE---------------------------FDGGTPIL-HYVLERREAGRRTYIP 8223

            V + EN    T+          + +   NK+G  +     N  +   P  P   P   ++

             +    ++T++W    YDGGS +  Y IE      + WK    C        ++  + L 

               EY+FRVRA N  G SEPS+ +  T   +  + PK      +EV   DE

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 90/389 (23%), Positives = 159/389 (40%), Gaps = 47/389 (12%)

            VKE Q V F CEV+     +  WF     +      I + +D   + L +  A   D   

            Y+ + +N +G+ +  +  L VE   +  V P     LKD   +E +     C V    V 

             + W  NG+ + +            H   I+D    D G Y                VT 

             + KS   +E L+  AP++     F++ L D  V +      + Q+S      V W  NG

             EI+E + + FE+ G+ H L I++   +D   Y C       + +++A L V+E P +  

            +P     P+ +  + G  V+    +  D    V WLR+   + +   H +++    +  L

             +  ++P   G+Y  + K++      +++

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 82/367 (22%), Positives = 148/367 (40%), Gaps = 49/367 (13%)

             V+V  G  L +   +S  P   +  + +G  LK T            ++++++++  D G

              Y+  A N +G  +    + V D P                   P V+   TE   T+K 

             +P PK    + +   I+       ++   S  ++ +V+ T  +  T MK  K     E+ 

                 +EN                    + + + S    V L     P PP+ TP  +++ 

               S+T+ W+    +GGSAV  Y +E+ D  +  W++      R+T F V  +     Y+F

             RV A N  G  +PS  SE     +  E P++ V ++D  +    + ++    +   K++ 

Query: 1463  FYDIEER 1469
              Y +E R
Sbjct: 20497 -YIVERR 20502

 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 33/91 (36%), Positives = 56/91 (61%)

            P+F K ++ +   +G  A F+  + G P P V WFK+++ +  S ++ I ++ +G+ + I

            ++D   +D   Y CKA N LGE+TC AEL+V

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 12/174 (6%)

             R+++ ++    +++   G+ L +   ++     + +  EN+ G      S +     T +

             + P+PP+  P   D+  SS++LSW     DGGS V  Y IE  +++   W         +

             T + V  L+PD EY+FR+ A N  G SE S  SE        +KP +P  E+E+

 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 5/197 (2%)

            P+ PP   +    +      ++ AG+++ +   VTG    T  W K   ++ + + + ++

            N    S+L I  A ++  G Y +   N  GS+ A   + V D P P          R   

            L L+W     DGGS +  + IE  D+   TW++      +  ++  LL   EYKFRV A 

            N +G   P +   +  V

 Score = 71.6 bits (174), Expect = 7e-12
 Identities = 42/114 (36%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

             +D P PPA    A D   SS+TL W    YDGGSAV  Y +EI     + W  ++T    

             R+T + V +L P   Y FRV A+N  G  EP + +E     +  E P+ +++V+

 Score = 71.2 bits (173), Expect = 9e-12
 Identities = 52/180 (28%), Positives = 81/180 (45%), Gaps = 19/180 (10%)

            P T  W++  K   +    +V+   N  K             + +L EN  G  +   + 

              + + D  DPP   G P   D+  +S+ L+W    +DGG+ ++SY IE+  +    W  

            +A    +T   +  L+   EY FRVRA+N  G SEPS+ S+     EK  P  P   +EV

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 70/286 (24%), Positives = 121/286 (42%), Gaps = 28/286 (9%)

            G+  +VA +   ++S+SV  + V+++     P F+   +N+ IKEG+  + + R  G P 

            P + W +N   I      +  ++ G +G  +L I +   +D   YT  A N +G      

            ++ VE  FA+   +  +    G       +AP +E     +G              +  P

             F  KL  + +K      F C++T  G P   V WL    PL+ + R+ +  + G   L+

                   D G+ TC   N  G    SA L ++      +S V E++

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 65/250 (26%), Positives = 97/250 (38%), Gaps = 23/250 (9%)

            SE +GT P F +++ +  ++ G    L   V   P   I W  NG  L  +       +G

               S+ I     ED G Y C+A ND G+  CS  + +       N+K    K        

                 TE+++ V K       P    PP  ++  +  +   G        V G    T T

            W K  KQ+  S +  + ++ NGS   I+   ++E  G Y    EN LG       L V+ 

Query: 1330 KPDPPAGTPC 1339
            +      TPC
Sbjct: 3860 EDTDMTDTPC 3869

 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 92/386 (23%), Positives = 152/386 (39%), Gaps = 75/386 (19%)

             V V  G  + L+      P  +I W  +G  LK ++F+  S+  +  ++SI+ A  E  G

              Y  +  N        C++ V   P +  T  P  K + P                    
Sbjct: 21328 KYTVILDNAV------CRIAV---PITVITLGPPSKPKGP-------------------- 21358

                           I+F E +     +SV L   V    G   ITC  ++ R+  Q +  

             M   + +    K+  L    E+   + +  EN+ G  Q  V+  +V K     P PP G 

             P   ++ S  ++L+W    YDGGS V  + +E  +  +  W+++ T       +    L+

                +Y+FRV A N  G S PS  S+  T+   P +P    +  D       V   T+T+ 

Query: 1456  TEQKVSD------FYDIEERLGSGKF 1475
                 + D       Y IE+R G+ ++

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 172/805 (21%), Positives = 281/805 (34%), Gaps = 128/805 (15%)

            G+V   A + I+   L+V    +D         F +P +++ + E   A+FE  +    E

              V W +    I S  +F +    +    LVI+    +D G YT E              

             VEG            K    R     +            KF + L    VKEG+   F 
Sbjct: 5253 -VEG------------KKTSARLFVTGIRL----------KFMSPLEDQTVKEGETATFV 5289

            C+++   +  V W K +  L  S  V +S +     LE+  V  DD+      V     +

             S +A+L +   D      + +  A   D       V K+V     K+            

            K D L    K K      +G      G+    AN   +  R  K+E     P    +  V

             +     I L    V  + +  G  + +    E               Q G+ + +V  +

            AAN +      +    P     P S  +V E    KF CEVS  PK    W L+GT    

             +   E+ +D   H + +  A   D   Y   A +              +L +  +   F

             + LKD    E +  V    +    + R+ W  N Q +   RS        + +QD    

               T+  L+ +   Q+   A            SE  L V       P F   L D   ++

              +V +  ++S    P V W  +G EI+ S++   +  G +  L +++    D G YTC+

                 G  +T   L +++     +   +    SV     ++      I+ D     +W  

             G+AL + T   E+ +   + +LVL

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 79/335 (23%), Positives = 125/335 (37%), Gaps = 54/335 (16%)

            L  + V  G K+ L   V+  P   I WT     LK  K I +       +V+I  +   

            D G Y   A N  G+A    +V V D P                   PP     +D T +

                   PP+     +I  +  +++    E                 W K    ++++  

                      K T L   +E+   + +  EN  G     Q + +T   + DPP G P   

              SDI   ++TL+W     DGGS +  Y +E  D     W        + T++ V+ L  

              +Y+FRV A N+ G  +PS+ +E   + +  + P

 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

            P F++ ++ + V+EGS A F+  I G+P PEV WF+D Q I  S     QI +  DG   

            L I  V   +  +Y+ KA N  G+AT TAEL+V+

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 94/414 (22%), Positives = 156/414 (37%), Gaps = 55/414 (13%)

             ESD  V + P      P TP   A+    +     + V  G S  +   +   +  +  W

              K  K I      K +N E G +             + +  EN +G  +A  N       

             DP  P GTP    ++ + +TL W    YDGGS +  Y +E  D  +  W + +      T

              F V  L  D  Y+FRV A N  G  S+PS  +   T  ++ E P        +D + V+

               +    E D     + T + +    +IEE          F+  L+ K   ++  G++  

             +A +    ++    + +++    P+  VQ      EK ++     +  GG      + E 

              E       +   E +    +++   EG EY+ +            IM VNK G

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

             GC   Y +  EN  G         ++   DP     P   P   D   +++T++W    +

             DGG+ +  Y++E   S +  WK  + + R T + +  L    EY FRV+++N  G S+PS

               S+     E+ EEP  +++

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 104/480 (21%), Positives = 172/480 (35%), Gaps = 84/480 (17%)

             E     S  ++EVT +   E + +  + A +  + S+ +     R  SP +         

                S+PQP  E + ++ + SP     TP                +  PR+P     SP  
Sbjct: 25984 LIRSRPQPAEEYEDDTERRSP-----TPE---------------RTRPRSP-----SPVS 26018

              ER      R A F   +R   + +     K + R+  +  Q+       P+   + +S 

              V   Q  +F   V   P  EV W+  G  ++ +   I     +G   L +L   T DSG

             TY    +N +G+ S   TL V                       G D+    S R    V
Sbjct: 26138 TYRAVCTNYKGEASDYATLDVT----------------------GGDYTTYASQRRDEEV 26175

             PR  +    +   YA S+       EA  +   ++  + E   + +    +A  ++  +A

                 ++ EK ++RK +  L        A   L     + V +G     +    G P P V

              WL  G  +  S          + +  I  V   D G Y+    NS G+   +  LT+Q+

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 90/366 (24%), Positives = 127/366 (34%), Gaps = 79/366 (21%)

             L  AP   L  R+  +  G   +F   V+  P  +V W+ NG  +    +        G 

Query: 89    FSLVIHAVHEEDRGKY---------------TCEATNGSGA------------RQVTVEL 121
              +L I   H +D G Y               T + T G               R V  EL

Query: 122   TVEGSFA----KQLGQPVVSKTLGDRFSAPAVETRPSIWG-------------------- 157
             T   ++A    K+  +   S ++ +   +   ETR S+                      

                           +  TK   + V EG+  RFSC   G P P VTWL+    L  SAR 

              V+        EI  V   D G Y+ +V N  GK      L+IQ      ++ V E KA 

              S  R     V S E ++ S EA    K   SP+    P       P   + +  E  + 

Query: 328   SPRTAP 333
              P +AP
Sbjct: 26407 LPVSAP 26412

 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 55/191 (28%), Positives = 77/191 (40%), Gaps = 11/191 (5%)

            EV W+ E   V   E   +  +D  ++ L + K  T D  G Y C A N  G+ + S  L

             V    V   AP     ++   V  G      C ++  P  R  W   G+ I Y    C 

                  ++ L I      D G YTC A N  G VSC+A +TV      +K   LLP    

Query: 619  KPTAPIFLQGL 629
            +P   + L+ +
Sbjct: 4637 EPKEEVVLKSV 4647

 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 84/348 (24%), Positives = 127/348 (36%), Gaps = 66/348 (18%)

             P    KL  V  V  G  + L+  V   P   + WT +      T+   + +        

              S+ KA   D G Y   A N AG       V V D P    N K  ++ S R        

                    TV   P P+      +   I++  E +++                     W  
Sbjct: 12008 ------CTVCWDP-PEDDGGCEIQNYILEKCETKRM--------------------VWST 12040

             +   +             G+ +T L    E+   + +  ENK+G+     +  V+ K   

                  PDPP  T  + +     +T+ W    YDGG ++  Y +E  +  +  W  +  + 

                    VQ+LLPDHEY+FRV+A N  G  EPS  S    V + P EP

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 81/389 (20%), Positives = 141/389 (36%), Gaps = 63/389 (16%)

             P+ +      +V   ++L +       P AT+ W  +G+TLK T  + +S   ++ S+SI

             ++A  ED G Y+    N AG       + V D P                   PP     

              + +         PP+     QI  +  ++K                +  + TW    + 

             +  +  +K+     GS+             + +  EN+ G      +  VV +    P  

             P GTP       S++ ++W     DGGS V  Y +E       +W  ANK          

             T   V  L     Y++RV A N+ G  + S+  E       P +P  + EV++   K   

             + +     +   K++ +      L  G++

 Score = 68.6 bits (166), Expect = 6e-11
 Identities = 60/294 (20%), Positives = 118/294 (40%), Gaps = 57/294 (19%)

             S+    APAF  + +  ++ EG+ +L  C++S +P   I W  N   +  +  + +S+  

             ++ S+ I  A   D G Y   AKN  GQ   +  + V    + P+ E             

               ++++ +M + + ++S      + + +  + K A  +    +                 

                                 +PP+I   P D  +  G+ + +    TG      TW    

             ++I  QE     +EN+++ + L I+  +++  G YTL + N+ GS  A VN+ +

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 86/356 (24%), Positives = 138/356 (38%), Gaps = 82/356 (23%)

            P   Q+LQ V V  GK       +S  P   I W    + L T    KF+   QE +L  

            +   +A PED  +Y C AKND G A  S  ++V+          PE+ S  P   +P   

                                  PP II   +D     G+      +V+GT  +  +W   

             K+I+ S   ++   E+  +L I  A  E  G YT +  N +G   +  NL++ V   D 

             +      D+R S+ +                     S+ GSSY+       Y +++++S

             ++      +   T+ +VQD    H          +  ++E S+E    + GE P+

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

            S +  S A L   AE  P   P F + ++ + V +GS  R   ++ G P P V +++D  

             I+ S  FQI  + D   SL+I++   +D   Y+  A NS+G AT TAEL+V+  EE

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 78/330 (23%), Positives = 117/330 (35%), Gaps = 66/330 (20%)

             ++ + V  G  +     +   P  T  WT +G  +KT +   +  +     ++I+  L  

             D G Y+    N AG    +  +TV D P              P   +  +  T    T+ 

              +P    P      P I    E Q  R     + +G V+                     
Sbjct: 11320 WQP----PKDDGGSPVINYIVEKQDTRK----DTWGVVS--------------------- 11350

                    +GS  T L       GC   + +  ENK+G      +   V K    P  P G

              P  +DI  ++ T+SW     DGGS +  Y +E       W   NKT           F 

             V  L   + Y+FRV A N+ G S+PS  S+

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 76/322 (23%), Positives = 120/322 (37%), Gaps = 60/322 (18%)

             V  G  + L   V   P  T+ W  +G  LK  + I ++ + +LC++ +     +D G Y

                A+N +G    + ++ V D P    + K  +M S R   S  P L   G+E    +  

             K     P  A                         +V+ T PIT   ++  K I+  E+ 
Sbjct: 13122 KRETSRPNWA-------------------------QVSATVPITSCSVE--KLIEGHEYQ 13154

                                    + +  ENK G          + K   DPP     P  
Sbjct: 13155 -----------------------FRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVI 13191

             S+I    +T+SW   + DGGS +  Y +E  ++    W ++        +     L    

             EY+FRV AIN  G  +PS  S+

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 82/367 (22%), Positives = 139/367 (37%), Gaps = 64/367 (17%)

             G +D    S+ Q      ++ L D+     K L+++   S          P   ++W+  

                L+T  ++  +   S  S++IE A   D G Y    +N    A  +  V V D P   

                             PP   T  D T +          A +   +   PE+        
Sbjct: 19975 ----------------PPTNITVQDVTKES---------AVLSWDV---PEND------- 19999

                     G  P+    ++ R   + S+   V  + N ++L+      +    Y   V  

             EN+ G     + +  + + +KP PP      S I   S++L+W    +DGGS +  Y +E

               +   K W + A  +ST   V  L  + EY FRV A N  G S+P +      + E+ E

Query: 1430  EPKDEVE 1436
              P+ +++
Sbjct: 20168 PPEIDMK 20174

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 79/316 (25%), Positives = 128/316 (40%), Gaps = 54/316 (17%)

            + +  GK L +   V+  P  T +WT     L   + +++   G+   + I+ AL +D G

             Y   A N  G    + +V V D P              P   L PV+ T     +    

             P+    + +   II+  +D K+            T  QPI            E+E  K 
Sbjct: 8914 DPEDDGGSEITGFIIE-RKDAKMH-----------TWRQPI------------ETERSKC 8949

            +       +T L   QE+   + ++ +NK G     ++  +  VD   PP        ++

               S++TL W     +GGS +Q Y IE        ++ +    C +TSF V++L     Y

            +FRV+A+N  G SEPS

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 74/315 (23%), Positives = 115/315 (36%), Gaps = 53/315 (16%)

             G+   L+  VS  PP T+ W+ +GK L+ T  + +       ++  + +   D G Y   

             A N  G A+    V V D P              P      V    S+  V     P   

               A +   I+Q  E  ++                     W     ++Q ++         
Sbjct: 15278 GGAKIDHYIVQKRETSRL--------------------AWTNVASEVQVTK--------- 15308

               K+T L    E+   + ++  NK G  +   +  V+       PDPP   P  + I   

             S+ + W     DGGS + +Y +E  D A + W +    T     + V  L   HEY+FR+

Query: 1405  RAINVYGTSEPSQES 1419
              A N  G S PS  S
Sbjct: 15425 MAENAAGISAPSPTS 15439

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 40/122 (32%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

             QE C  Y  +L EN+ G     +   ++   ++P PP G     D+  +S++LSW    +

             DGGS +  Y +E+    +  W   AT + T   +  L+   EY FRV A N  G S+P Q

Query: 1418  ES 1419
Sbjct: 15830 LS 15831

 Score = 65.9 bits (159), Expect = 4e-10
 Identities = 41/116 (35%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

             P PP+  P   D    S++L+W    YDGG+ +  Y +E+ +     W  +   AT R+T

              F V DL    +Y FRV A+NV G SE S+        E+ E P  ++E++DD +K

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 62/258 (24%), Positives = 96/258 (37%), Gaps = 37/258 (14%)

             +AP F    RNL ++  + A    +V G+P+P V W+R G+ I + G ++ +     G  

              L+I +V ++D   Y   ATN  G+   T  L VE      L                  

                        PK    +G V    G++       +G+P P +TW KG   +  +    V

                     L   +GV + D G Y     N  G    + EL +  +    R          

             SDV ++  N+   E   D

 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 71/342 (20%), Positives = 124/342 (36%), Gaps = 55/342 (16%)

             P+ K       +  G+ L ++  V   P   I W  +G+ LK T  + + +  +   + I

             ++   +D G Y   A N AG A  +  V V + P                   PPV    

              D  +         PP      QI  +  +++                   T TW     

              +  +  +K+   + G++             + +  EN+ G      +  V+      +P

              PP GTP  + I    + + W+    DGG+ +  Y +E  +  +  W +L     + T F

                 L    EY+F+V A N+ G  +PS+ SE     +  + P

 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 67/307 (21%), Positives = 118/307 (38%), Gaps = 39/307 (12%)

             S+ + + SL  + S    +  T A   +  PR++ + EG +A+F     G P P VTW R

              GQ +++  R  +     + TF   I +V   D G Y+    N  G ++    LT++ + 

Query: 127   -FAKQLGQPVVSKTLGDRFSAP---------------------AVETRPS-------IWG 157
                K +  P   K+   R  +P                       ET+P+       +  

               PPK    L     KE  + + +C +        +VTW K    L+ +         +G

                L+I+ + + D G Y C +    G +  + +   Q   S +    + ++   SD +  

Query: 275   VTNVISK 281
              + V  K
Sbjct: 26528 ESTVTRK 26534

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 6/189 (3%)

             VR G+++ +  +V G      TW K  K +   + + +       +L I  A +   G Y

              +  +N  G  Q    + V+D+P P       +++   + T+SW     +GGS + ++ +

             E      K W  +A+  +      +LL ++EY FRV A N  G   P+ E++   +    

Query: 1426  -EKPEEPKD 1433
              ++P EP++
Sbjct: 11793 IDRPGEPEN 11801

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 66/229 (28%), Positives = 97/229 (42%), Gaps = 25/229 (10%)

             G +S+  V + P   P  PP    PP I+    D       SV L     K TG  PIT 

               ++F  R  +      K        K+T L    E+   + ++  N  G  +  +    

             V   DP  P G P   +I  +S+TL W    YDGG  +  Y +E  D  +K+W +     

                 +F V DL+   +Y+FR+RA N  G  S PS+ +E     ++ E P

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 5/118 (4%)

             QE C  Y  +  EN+ G     Q    + V + P PP G     D+  +S++LSW    +

             DGGS +  Y +E+    ++ W E A  +S    + +L    EY FRV A+N  G S+P

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 95/427 (22%), Positives = 150/427 (35%), Gaps = 53/427 (12%)

            E   ES G AP     LQDV V  G      C +  D    + WT  G  ++ ++ +  S

            Q G++  ++I      D+GLY C+  ND G+   S  ++V+ AP S      E     EM

            K                +    S +   L   S++ V   P      K    P  I+   

            +  +  G+   L   V G       W      +  S   K     +   L IL  + E  

            G YT +  N  G       L +  K +    T   S +  S   L      +        

                G  A+  Y++    +   TW    K+L T            S +F V D   +   

             +  +A N+ G S  + E     E T + + P + K   E  +D  + P        +++

Query: 1457 EQKVSDF 1463
            EQ+++ F
Sbjct: 3897 EQEIATF 3903

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 57/224 (25%), Positives = 89/224 (39%), Gaps = 19/224 (8%)

             S+ TV + P  K P     P   +   +  +V+  E +   G +V G      +  +  W

             +K  K        K    E G +     + +   G         +G         V   P

               P G P A  +  +S+TL W   +YDGGS +  Y +E  +     W + +      T F

              V  L+ DH Y+FRV A N  G  SEPS+ +   T  ++ + P+

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 78/337 (23%), Positives = 129/337 (38%), Gaps = 55/337 (16%)

             G  + L+  +S  P  TI W  + K L+T   + +     L S+ I+ A   + G Y+  

              +N  G A  + +V + D P              P   +     T    T+  +P P   

               A +   I++  E  +V                     W         SEH++    E 
Sbjct: 20689 GGAKITHYIVEKRETSRV--------------------VWSMV------SEHLE----EC 20718

                 T +    E+   + +   NK G  +   + +VV K     P PP G P  + I  +

             S+T+ W     DGGS +  Y +E  D  +  W ++   T R T   V  L  + +Y++RV

              A+N  G    S+ SE     +   P  P  ++ ++D

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 33/95 (34%), Positives = 48/95 (50%)

            P   + I+   V +GS A F  ++ G PDPE  W+K+   I  S      + ED  C L+

            I DV  +D A    KA+N  GE +  A L+V+  +

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

            P  P   P   D   SS++L W   + DGGS ++ Y +E+ +     WK        + T

            C     N+++L    +Y+FRV+A+N  G SEPS  +      +  EEP+  +++   D

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

             + KP PP   P A D   +S+ L+W    +DGGS +  Y +E     ++ W+       +

             C  T + V  L     YKFRV A+N  G S+P+   E   V ++ E P+

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 110/471 (23%), Positives = 168/471 (35%), Gaps = 95/471 (20%)

             K V +S PLS   P   L+     K + TL           L P+  G AK D  + S  

             +EE   D   + +  +  +    G  + +K                 E++G   A +Q L

                    + + +  GKKL ++  V   P  T  W      + T+  + + +  S   + I

             +    +D G Y   A+N +G      +V V DAP                   PP  +  

              ++DA       P     + +   I+   E   V  G+ V     VT T        +  

             K I   E++    +EN              G    L   K+    AQ    V  +P    

              T    D     + ++W     DGGS +  Y IE       +W  AN T       RST 

             +    L+   EY FR+ A+N  G+S PS+ +E  T    P +P  + EV D

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 11/210 (5%)

             +EG   K+  ++  Y +  QVTW+   + + +  ++ +     G   L +  + + D G 

             Y C+  N  G      EL V+G   +++      +T+  +      +T   +  E PP+F

                L       G+  RF   IT  P+P VTW K    ++P     + +     G+  L I

             + V  DD   YT +  N  G+ S  A+L++

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 58/249 (23%), Positives = 97/249 (38%), Gaps = 12/249 (4%)

            D EK+ +     P FK+KL  + +        +C+++   DP   + W  +GK L+    

            + +  E   CS+    A   D G+  C A N  G    S  + V D    E +   E + 

               +  L  +   E  A         T  K    P I+ +PE  +V  GE+     +VTG

                   W    + I++S+  +V   +    L I+  +    G   +  EN  G  + +V

Query: 1324 NLTVVDKPD 1332
             L +  + D
Sbjct: 1880 KLEIQQRED 1888

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 40/111 (36%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

             KP PP   P   DI  SS+ LSW    YDGG  +Q Y +E  D +   W           

             T+  V+ LL  HEY FR+ AIN  G  E +       V EK E P  ++++

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 92/399 (23%), Positives = 152/399 (38%), Gaps = 56/399 (14%)

             +VV+ G   R    I GRP P+VTW K N+ L+  A +  +E     +L I   N+ D G

              +   + N +GK   S  ++++ LD+      +R T  T   V              +TN

              I ++   ++     A  K   C+    G S          A N     +P   ++    

              ++P       ++  T S+++L      P+P+  G   ++    E +R    +  T  T 

               GL               Q +   +A R  P E      +  +  P+ + +   Q++  

              K    +K    V G PKP V W  +G  + +Q   +     A S  L + +    DSG 

             Y  TA N  G++    T+QV  +      P  F  V  D

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 61/234 (26%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

             AP     +KD     G+   L C + G P+P I W   G+ +  +R    + +     L 

             +     ED G YTC+A N +G+V  S             S+ LL   P   P  P+  + 

                +    GS + + V   G P P + W H    +Q SE+   E       L ++ V  +

                G Y  +  N  G V   A+L V+      +P   + P  + A L  S +IS

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 14/152 (9%)

            PP   + L  V V EG+     C I+G P P VTW + +  ++ S    ++ ++G+  L 

            I     +D G +TC  VN +G  S S  L++Q     +  F +ET A        VT   

            + E K  ++S +      + +  Q G   P A

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

             +++      + V +       TI    + H   + ++ +NK G       + +    +  

              P  P   P  S +  +S+T++W    YDGGS V  Y +E+ D+ +K WK +      A 

                 S+ V  L+   +Y+FRV AIN  G    S  S+  T  +    P

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 77/340 (22%), Positives = 133/340 (39%), Gaps = 57/340 (16%)

             + V  G+ + +  +V   P   I WT  GK L   K + L Q+     + I++A+  D G

              Y   AKN +G A+ S  V V D P              P  +L     T+ + T+    

                            + P D                G   IT   +++RK  Q+   +  
Sbjct: 11717 --------------WENPLD---------------NGGSEITNFIVEYRKPNQKGWSIVA 11747

              +         L A  E+   + +  ENK+G      ++   + +  +D+P  P     A

              D   + + L W    YDGGS   SY +E     +  W+ +   + + T + V   + + 

              Y+FRV+  N  G S+  +  E+  V E  ++P  ++++S

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 25/182 (13%)

            T+  E   +++   P F Q+LQ + V +G ++ LQ +V+  P   + +  +G  ++++  

              +SQEG L S+ I +A PED G Y   A N  G+A  + ++ V   ++ PA +      

              +  E +  R +  +       S ATV+             K  P+ PPK    +  PP

Query: 1239 QI 1240
Sbjct: 270  SI 271

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 35/96 (36%), Positives = 46/96 (47%)

            KP F       + +EG  ARFD K+ G P PE  WF D Q I      ++   EDG  SL

            II      D  ++T  A N  G ++ +  L VE +E

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 44/140 (31%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

             + ++ EN  G  +       +  +D  DPP G P   +I   ++TL W    Y GG  + 

             SY +E  D  N  W     +      F V  L  D  Y+FRV A N  G  S PS+ S+ 

              T  +  E PK +V+V   D

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 91/388 (23%), Positives = 134/388 (34%), Gaps = 60/388 (15%)

             PAFK       V  G+ L +       P   + W  +   LK T  +      +   ++I

             + A  ED G Y     N AG+A  +  V V D P                   PP    +

              D  T         PP               K   G S+  +  V      T TW     

                         S   ++ TI A R +  GC   + +  EN+ G S       TV   P 

                 P GTP  +     S+ + W     DGGS V  Y +E  +  +  W +L       T

              F    L    EY+FRV A N+ G  +PS+ SE   V   P +P    E          +

              ++  T +   K++ +   ++ L  G++

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 82/331 (24%), Positives = 122/331 (36%), Gaps = 60/331 (18%)

             P +K  +  VH  E  K+     +   P  TI W    + L  T  + +       S+S+

             + A+  D G Y   AKN AG+   +  V V D P       PE          P V+   

             S  T +K      PP       II +  +++    E+  L   V     Q ++C      

                      KV     G++ T           + ++  NK G  +   +  VV K     

             PD P   P  + +   S+ + W   + DGGS +  Y +E  D     W            

               V  L+ +H+Y+FRV A N  G SEPS  S

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 45/169 (26%), Positives = 67/169 (39%), Gaps = 12/169 (7%)

             W+K  K   +    K    + G +     + +   G         +G         V   

             P  P G P A  I  +++TL W   +YDGGS +  Y +E  D  +  W +        T 

             F V  L+ D  Y+FRV A N  G  SEPS  S   T  ++ + P   ++

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 9/134 (6%)

             AQ+  TV D P    G P  S+I  +S+TL+W     DGGS +Q Y +E  +  +  W +

             + + R    T F V  L   +EY+F V A N  G    S  S L    E   P  P   V

Query: 1436  EVSDDDEKEPEVDY 1449
             +V+D  +    +++
Sbjct: 21956 KVTDTSKTTVSLEW 21969

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

             P  P   P  +D   SS++L+W    YDGG+ V+ Y +E+ ++A   W    TC      

             +   F V  L  + EY FR+ AIN  G  EP+         E+ E P+ E++

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 72/342 (21%), Positives = 133/342 (38%), Gaps = 65/342 (19%)

             +HV  G+ + L   ++  PP    W   G  L+ ++ + +     +  ++I +    D G

              Y    KN  G    + +V + D P                    P+   E DAT   + 

              +P P+    A +   +++  +  +          G +  ++ +T +  KF +  + +E+

             +            + A  +   G Y   +++++   ++ + +     P PP  T    D+

                 +TL+WY    DGGS V  Y +E        W   NK    +   RST      L  

               EY+ RV AIN  G+ +PS+ S+     +      KP+ P+

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

             P PPA  P   D   SS++LSW   +YDGGS +  Y +E+  + +  W         + T

              F V  L+ D +Y+FRV A+N  G S+PS

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

             +   ++P PP       D   SS  L+W    +DGGS +  Y +E+    +  W E    

             +  +F V+ L+   EY+FRV+A N  G SEP +      + E   EP

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 76/349 (21%), Positives = 134/349 (38%), Gaps = 48/349 (13%)

             P    + +    K  +  +  C++ G P P++ W+  G  +  Q    ++  D  +H L 

             ++     D G Y+C A+N  G++  S  L ++  A  +  P +    K    + G    L

                  G PVP +TW    + +Q + + T E      H+  ++   + H G Y     N  

             G V     V + +K             P KPT PI ++ L          +  +  +S  
Sbjct: 24404 GTVDAILDVEIQDK-------------PDKPTGPIVIEAL----------LKNSAVISWK 24440

             PP +    W+ N      E +E  ++         + C      E+ G Y    A N+ G

                 +   +V+ ++ P +  +P    KP ++TA        SC +A  P

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

             P++  P  +   ++  +   + AKF  +  G P P   W ++G+ IT GG++ L    +G

              F L IH     D G YTC   N +G+   + +LT++

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

             V KP PP G P   D   SS++++W    YDGGS +  Y +EI       W+ +   A  

             ++TS+ +  L  + EYK R+ A+N  G  EP+

 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 48/176 (27%), Positives = 72/176 (40%), Gaps = 16/176 (9%)

             W K  K +     MKV   + G               Y +  EN  G  +   +   V  

              DP  P G P  ++I   S++L W    YDGG+ +  Y +E  +  +  W +      + 

             T F V +L  D  Y+FRV A N     SEPS+ +    V +  E P+  ++V   D

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

            EK    P F K + + ++  G  A     + G P P++ WF +   +  S  ++  +D D

             + SLII     +D+ +YTC A N  G+  C+A L + +  EG  + E E

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

            +E P   P     ++D    EG  ARF C++ G  D +V W+  D+ I+ SR F++   E

            D    L I++   +D+  YT  A N++G+ + TA L +E    + +  G++  E

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 75/315 (23%), Positives = 117/315 (37%), Gaps = 29/315 (9%)

            ++ + DS     + +P ++   E++ +    EVS         +L+ TPV +   S  V 

            ++     L   + +  +S + S T   A  ++      + E   + E  P   + L D  

              EG    L  S+  T    + W    + +   +  +   +     L I     EDH G 

            Y C A N  G+ + SA +TV                  K  AP+  + +  L+V  G   

              T ++   P     W   G EI ES+           SL I      D G YTC+A N 

             G V   A LTV  P
Sbjct: 4607 YGSVSCTATLTVTVP 4621

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 71/338 (21%), Positives = 128/338 (37%), Gaps = 62/338 (18%)

            W     T+K TK  +    EGSL              +++  A+N  GQ++ +    ++D

            +  +++T           +  PP      D T +       PPK      I ++  ++K 

            R G                  W+K  K      + +V +   G+++      +   G   

                  +G       +  ++ P  P   P     +D     + ++W     +GGS +  Y

             +E+     + W  + +   +   F V++ ++PD EY  RVRA+N  G SEPS+ SE   

              +   +P  ++E  D    E E     V +R V + T

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 75/315 (23%), Positives = 112/315 (35%), Gaps = 53/315 (16%)

             V  G+   L+  V   P  TI W    K ++ +    +        + ++ A+  D G Y

                A N AG       V V D P              P      V G  S+    K    

              +PP       I  +  +++    E+  L   V  ++ +T                    
Sbjct: 17435 WSPPLQDGGSDISHYVVEKR----ETSRLAWTVVASEVVT-------------------- 17470

               N  K+T L    E+   + ++  NK G  +   +  V+ K     P PP      ++I

                S+T+ W     DGGS +  Y +E  D +   W +    R T     V  L  DHEY+

Query: 1402  FRVRAINVYGTSEPS 1416
             FRV A N  G  EPS
Sbjct: 17586 FRVSAENAAGVGEPS 17600

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 155/774 (20%), Positives = 290/774 (37%), Gaps = 128/774 (16%)

            V E +  +F C ++   +  V W  +G  + +     ++  D   H L +  ++  D G 

            Y+   +  +G+ + +      RL V  +   F S L+D  V EG+     C +    +  

            + W  N   +  +R+   +   + H  +           + E  L  +S      V E  

            S+ + + L          P F   L D   ++  ++T+  +VS + P  V W  +G EI 

             S  +  +  G +  L I++   +D G Y C+     G  +T+A +TV+      +   +

             KP   V   +G++      ++    P VH  W   G+ L   +   E++++     L+L

               Q    G+      N     + +V       +   S  +   +          REP +

               L G     +  G DR+  ++ G   +    ++    ED    +    +  +HT    

              E IR + +  L  +D+  K+    V T  LS D+++      + +  N QR    ++V

            S ++E K HS   + F+  L+   TS+  V                 +  + KL    G 

               + +  +   VE  + +   + S    PV   K  + +KP  NA              

               +K+  K+    LKK +K+D+       GT     + + +       + L  V V E 

            +    + ++S D      W L G+ L  T    + +EG + S+ +     +  G

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 72/338 (21%), Positives = 118/338 (34%), Gaps = 53/338 (15%)

             R E      +   K +DV V   G+  +L+  +   P   ++W+ +GK L+ T   + + 

                   ++ ++  +  D G Y     N  G       V V D P              P 

                  V G  ++        P     A +   II+  E  ++                  

               +W +   ++Q   +          K+T L    E+   + ++  NK G  +   +  V

                   KP  P  TP  S I   S+ ++W     DGG+ ++ Y +E  D     W +   

              T       V  L   H Y+FRV A N  G  EPS+ S

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 56/243 (23%), Positives = 88/243 (36%), Gaps = 34/243 (13%)

             EAP      +++  K G  A+   ++ G P P + W+R G+ +    ++ +    R T +

             L +    +ED G YTC ATN  G  + + +L ++ +     G P+  K  G         

                                     G   R      GRP P +TW  G   LQ S  +++ 
Sbjct: 24336 ----------------------AVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIE 24373

                    L +  V  +   G Y   + N  G      ++ IQ   D      V E    N

Query: 269   SDV 271
             S V
Sbjct: 24434 SAV 24436

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

             +KP  P G P  + +   S  ++W   + DGG+ +++Y +E  +     W  + T   R 

             T F+V++L+   EY+FRV+  N+ G SE S+ SE       P  PK +V +     KE

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 49/175 (28%), Positives = 74/175 (42%), Gaps = 22/175 (12%)

             P FK+ L +    EG+ +  + +VS  PP T+ W  +G+ L     I +  EG    ++ 

             I   LPED G Y+  A N AG   C   + V+      +  K+ E   R  +  +   L 

                   GTES            +A V  KPA  T   K     +I +  E++K+R

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

            PYF       ++VEG +  F C++ G P P V W K    +     +++ Y+ + G C L

            +IS    DD  +YT    N  GE + +A L+ E

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

             + ++ EN+ G       +  V   +PP+  G    +D+  +S +L W    +DGGS V  

             Y +E+     + W  +A  +  +  V  L    EY+FRV+A N  G S+P

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

             ED  +A L       P    ++P F + + + E  EG +  F+ ++ G P P + W KD 

             Q +    + +I ++     +L I D   +D   Y   A N+ G  +C A L VE +   +

Query: 1856  GEGEEEEE 1863
              E + +EE
Sbjct: 25588 QEFKSKEE 25595

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

            P   + ++ + V  G  ARF   I G P P++ W+K++Q +  S  F+  +  DG   +L

            ++ +   +D A YTC+A N  G AT +A L VE  E

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 41/118 (34%), Positives = 56/118 (47%), Gaps = 8/118 (6%)

             V KP PP       D   +S+TL+W    YDGGS +  Y +EI  +  + W+ +      

             R T F +  L    EYK RV A+N  G  E +  S   TV  KPE+  +  E+  D E

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 3/119 (2%)

             QE C  Y  +L  N+ G    A+    V V +P  P G     D+  ++ T+ W     D

             GGS +  Y +E+    ++ W      ++    +  L    EY FRV A+N  G S+P Q

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 83/362 (22%), Positives = 140/362 (38%), Gaps = 34/362 (9%)

            E+MD  +  Q+ V+P T  E E K + S ++V + +V ++ K    TPV + V     + 

                 S+   ++K  + + S + E    K  E+   L   +  GP+   P+ +    E  

                   + NAK             DE  K    +     V + VN +  H G       

                 T  + K +  +  AP  K+K++ + VA G      C++ S P     W   G+ +

              +    +     + S+ I +    D G Y C A N+ G   C+  +TV   P  E    

              +  R+P+     VL     + ++K+P    PK  PK     +    PE    +  E V

Query: 1256 EL 1257
Sbjct: 4685 EV 4686

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 68/317 (21%), Positives = 120/317 (37%), Gaps = 58/317 (18%)

             V  G  + +   VS  PP T+ W +N +TL     I  +   S  S+ I+      +G+Y

               +AKN+AG+ + +  V V D P    T  P +       S                   

                       ++  F PED                G  PIT  ++  +++        V 
Sbjct: 10329 ----------KLTWFSPEDD---------------GGSPIT-NYVIEKRESDRRAWTPVT 10362

              +      T+    Q     + +  EN +G      + +A V    +  P+ P       

             ++  +++TL+W    YDGGS + +Y +E      + + ++      S  + V+ L     

             Y++RV A+N+ G  +PS
Sbjct: 10482 YEYRVSAVNIVGQGKPS 10498

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 66/316 (20%), Positives = 112/316 (35%), Gaps = 53/316 (16%)

             G  + ++  V   P  T+ W    + LK T+ +      +   ++I + +  D G Y   

             A+N  G+      + V D P                   PP    + D            
Sbjct: 14835 ARNIVGEVGDVITIQVHDIPG------------------PPTGPIKFDE----------- 14865

                 +    + F  D     G        V   Q  + TW++    +       +  +  

              ++LT     Q     + +  +N+ G      +  +V       P PP GTP  + +   

             S+T+SW+    DGGS +  Y +E  +     W+ +  A      F    L     Y+FRV

Query: 1405  RAINVYGTSEPSQESE 1420
              A N+ G S+PS+ SE
Sbjct: 15029 IAENMAGKSKPSKPSE 15044

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 74/390 (18%), Positives = 140/390 (35%), Gaps = 53/390 (13%)

             E L   ++ E +   KND        A ++   K  + + TA       Q +    G   

              +   +S  P   + W L    LK T  + ++      +++++ ++  D G Y    +N 

             AG    S  V V   P              P +    V    +++ V     PK      

             +   I++  E                      T  W      ++ ++           K+
Sbjct: 22468 ITNYIVEKRESG--------------------TTAWQLVNSSVKRTQ----------IKV 22497

             T L    E+   + +  EN+ G S+  +    + + P  P   P   +   + ++++++ 

             W    +DGGS +  Y +E  +     W  +    C   ++ V  L+   EY+FR  A+N 

              G S+ S+ S    + + P +     EV+D

 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 41/142 (28%), Positives = 62/142 (43%), Gaps = 13/142 (9%)

             P  P   P  +D    S +L+W    YDGG  +  Y +E     ++ W +  T    R T

              F V DL    +Y FR+ AIN  G  EP+   ++  V         E E++ D E + E+

               RT+ +     +  F  I+ R

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 4/130 (3%)

            P      +++E  E ++   A      ++K   KP        + V+EG  ARF C++ G

            YP P+V W+ + Q IR+S+ F++ Y  DG   L I D    D  +    A N  G     

Query: 1844 AELIVETMEE 1853
             +L ++  E+
Sbjct: 1879 VKLEIQQRED 1888

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

             GC   + ++ EN+ G  +       V   + P PP       DI  S+++L+W    +DG

             GS +  Y IE     +  W  + T +     V++L    EY F+V A+N  G S P +ES

Query: 1420  ELTTVGEKPEEPK 1432
                 V E+   P+
Sbjct: 14747 RPVIVKEQTMLPE 14759

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 52/241 (21%), Positives = 83/241 (34%), Gaps = 46/241 (19%)

            AP F Q LQ V V EG     +  +S  P   + W  +G+ + T+    + +S       

            ++I      + G Y   A N +GQA  + ++ V    A                      

                                  PP  +Q  +   VR G  V L  +VTG       + + 

              +IQ S   ++    +   L I  A  E  G Y++   N +G   +   L V  + + P

Query: 1335 A 1335
Sbjct: 201  A 201

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

             P   P+F + +R+L V   S A   CK+ G+P P V W++  +  I +   ++I   + G

                LII+ V  DD   Y  +A N  G  + TA L VE

 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

             P F    R   + EG    F C+I G P PE+ WFK++  I  S +  I    +   SL 

             I +    D  KYT KA N  G+ + TA L+V  + E

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 35/113 (30%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

             P PP   P  +D   SS  L W     DGGS V  Y +E  +   + W++      R T 

               V  L     YKFRVRA+N+ G  EP + +++  + ++   P  +++ S  D

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

             KP  P   P   D    +  L W     DGGS +  Y +E        W  +      R 

              +F V  L+  +EY+FR++A N+ G  EP + +E     +    P+ E++V+  D

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 60/243 (24%), Positives = 94/243 (38%), Gaps = 33/243 (13%)

             TES   + K    K  P    PP++ +  +++        E  G   +TG      +  +

               W+   K       MKV+N              +H   + +  EN++G  +  +    V

                DP  P G P      D    S+TL W    YDGG+ +  Y +E+       S ++ W

             K     A      F V  L  + EY+FRV A N  G   P++  E     E  E P+ ++

Query: 1436  EVS 1438
             + S
Sbjct: 12304 DAS 12306

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

             D+  S++TL+W    YDGGS +  Y +E   +  + W ++ T + T     V  L    +

             Y FR+RA N  G SEP +     TV

 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 65/266 (24%), Positives = 104/266 (39%), Gaps = 36/266 (13%)

             AP F   L++  V    +  L C V G P P + W   G+ I     +Y     + G  +

             L I     +D   Y   A N  G VS +A + V                P+K   P  L+

             G+  +  + G  V++ +  SG P P + W   G ++ ++   H++   T+    +  VFP

                  +D G Y   A N  G   +     V  V +P  G +   +S+       +  AS 

             G S + +  +         WLR G+A

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

            PDPP        I  +++ LSW     DGGS V  Y +E   WD   +  + W++     

                 F V+DL+   EY+FRV+A+N  G S+PS      TVG    ++P+ P

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 163/845 (19%), Positives = 282/845 (33%), Gaps = 134/845 (15%)

             + G + K    + G P P + W+++ + + +     L C +  T  L    + + DR   

             G Y  +  N  G+   T+ + +        G P+  KT+         E    +W     

                 K+   +V++ +  R    +      +        +KGN  +            +P 

                SV  KN        G+ +   +   +  VV     A   +++S   ++  D  +  +

              +  K T  D R++VT +              + + C+    G  P        +P    

             K     D P    +  +   T SSITL  ++   +      G  V    GEE +      

                  T +       PG+     VS    A +  P+E             P+        

              S   K  + V+      G P P V W  +     +  GS   Y  E+  S  L  +   

             TR D+G Y  T  N  G+   S T+ V         ++L V  V+    ++L D  +I+G

                ++   +      + TW +            +       + D   +    +  LAEN 

             +G                   E   PV  ++  API    + D               DG

               V     V      E  W H G  I ++ +    Q   Q  L  +     + G      

               + G +  + ++   E      P        VT  +G +V +     G P P++ WL+D

             G  L K++      + E+  TL +K  +  H G+Y ++L N V  C   V + +      

Query: 818   ALPRG 822
             + P+G
Sbjct: 21353 SKPKG 21357

 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 12/132 (9%)

             + +  EN  G  S       T+   P  P GTP   D+   ++TL W     DGGS +  

             YSIE     N+ W      +++ C+   + V  L P   Y+FR+ A N  GT S PSQ S

Query: 1420  ELTTVGEKPEEP 1431
              +    ++   P
Sbjct: 21640 GIIMTRDENVPP 21651

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

            +EAV  +   VKP F + ++++ + EGS      +  G P+P++VW K+   I   ++ +

            I  +   G  +L I      D A YT  A+N  G  T   ++ VE +E  E E E +

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 90/398 (22%), Positives = 150/398 (37%), Gaps = 53/398 (13%)

            G+ + +V  K  + R+ + G R     KF S  + Q VKE +T  F CE+S   K  V W

            F     +     ++ +  +  +H L + +    D                        +L

             V+E  P F+  L D   +E  +  L+C V    VP + W  +G+ I      S    G+

               L I+ A  +D G Y C      G     A VTV  +           +   KP    

                L  ++V  G      +++S  P     W   G  +  S D    + G +H L +  

                 TG  + +A N+    ++ A L V+E        FI+    V           C +

            + +P  T  WL+  + +  D   FE++++    ++V+K

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 82/353 (23%), Positives = 125/353 (35%), Gaps = 50/353 (14%)

             F+ KL    +  G+   L  + S  P   + W  +    L+  +  I +   +L    I 

             KA   D G Y  V +N  G  +  CQV V D P                   PPV     

             D   K        P        I     +K   G+ V +    + +   TC   K  K +

             +  +++   ++EN                Y +       S +A+    V D PD P  T 

                D    S  ++W    +DGG  + +Y +E  ++ +K W  +        T F V DLL

                +Y+FRV A N  G  +PS  S+     +   +P   V     D     VD

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

             +QL  PV++K L                   PP F        V  G+  +      GRP

              P VTW K NVPL+ + RV+        +L I    ++DVG Y   + N +G+A

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 44/77 (57%)

             V+ GQ  +    I+GRP+P +TW K  +PL+ + R++V++   +  L I   ++DD G Y

                V N  G+ + S E+
Sbjct: 16996 GITVANVVGQKTASIEI 17012

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 25/72 (34%), Positives = 40/72 (55%)

             ++ G+  +    + GRP+P ++W+K   PL+ + RV+V E     VL I   N+DD G Y

Query: 232   TCLVVNGSGKAS 243
             T    N +G A+
Sbjct: 18078 TVTATNSAGTAT 18089

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

             P F+  + +     G   RF   I  +P+P V W+K  Q I+     + +  + D+ G  

              L I+ V  DDDA+YT  A N  GE +C A+L V

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 42/120 (35%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

            +S +  + A L  V    P +K    + I  LEV  G  A+F C+I+  P+    WFK  

            + I ES    I   +  + SL I      D  +YTCKA N  G  +CTA L V T+  GE

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 84/388 (21%), Positives = 136/388 (35%), Gaps = 87/388 (22%)

             ++ G   R    I GRP P+V W K +  ++ +A + V+      VL+   VN+ D G Y

Query: 232   TCLVVNGSGKASMSAELSIQGLDSAN-------------------------------RSF 260
             T  + N SG  + SA ++++ LD+ +                                  

             V + +AT       VTN      K+D L+          A        P +   P   A 

               PQPP +  ++    +  +   T       S I      +Q +         R   L  

             +  +   GEE          K  + PR    P     + ++D+V +              

               P  +    S  V+  Q +K    +SG PKP + W  +G P+ +Q   I V +      

             L + +    D G Y  T +N  GQ + S

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 1/111 (0%)

             E  A E    KP     ++D  V   S A+F  K  G P P  +W KD ++I +   +++

               D+ G   L I      D   YTC   NS G  + + +L ++ +++ E +

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 89/404 (22%), Positives = 153/404 (37%), Gaps = 60/404 (14%)

             +VV+ G   R      GRP P++TW +       + +V + +      L I   +++D G

              Y   + N SG  S SA ++++ LD+         K    +VRK+   ++ +   +D   

               AK KN    +R  +    AN   +  + S K+E+  +                     

                      P + P    L    +TS+S+  +        R  G  V + P G E K   

                         GL S        KA N +         +P+  +  +  P  +    + 

              ++  + +K    V G P+P ++W  +G P+ +Q   + V E A S  L + +    D G

              Y+ TA+N+ G  + + ++ V       V P  F  V  D  VI

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/82 (29%), Positives = 41/82 (50%)

             +++K G+  R    + GRP P+VTW K  V ++    + +++  G   L +    +D  G

             VYT    N SG A    ++ +Q

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/92 (26%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

             P   K ++D+    G AA+  C+I G P P++ W++  + + +SR +++  D   +   +

             +++   +D+  YTC A N +GE   +++L+++

 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 48/199 (24%), Positives = 78/199 (39%), Gaps = 12/199 (6%)

             PT  +       + V  G  V + + ++G PPP   W   G++++ESE    E       

             L I+E    DTG YT E  N  G    T  V+ + +P   T P  I +    S+T S   

                 G + L    +         WL   +++ + T  F  L   + +   +     +  G

              Y   L++ V EC   + +
Sbjct: 23611 SY---LQSEVIECRSSIRI 23626

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

            AP FI  P    + EG +  F  +V G P+P V W ++G P+T+G R+ +    + G   

            LVI     +D G+YT    N  G    +  L  E  +

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 2/119 (1%)

             ++A+  +   D  Q  +  +A++   + P F        V+ G   + D    G P P V

              W KD+  ++++     +  E+ N  L I D C +D   Y  K  NS GEA  T  +IV

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 62/233 (26%), Positives = 97/233 (41%), Gaps = 22/233 (9%)

             K   P TP     PP+    P +       SV L     K  G   +T  +++ ++   +

                 H K + +     +T L    E+   + ++ +N +G S  +  +  VV     DKP 

              P      S I   S+TL W     DGG  +  Y +E   S +  WK+      +   F 

             +  LL   EY+FRV A N  G S P     S +++LT+ GE P   K+  +V+

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 8/183 (4%)

             P F+ + ++  V+        C+V+G PKP V W+ +G  +        + E  G ++  

             ++ + T D  T Y   A+N  G +S + +L+VE  A + + P     +     + G+   

             ++    G P P ITW   GQ +       +  V         P     +D G Y   A+N

Query: 588   ALG 590
Sbjct: 24801 RFG 24803

 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

             V +EG   ++ CKI    Q  QVTW  G   L+ S +  ++ ++G+ +L +  + + D G

              Y C VVN  G+ S  AEL ++G+      + R T

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 72/338 (21%), Positives = 111/338 (32%), Gaps = 54/338 (15%)

             ++ H+  G  L L   +   P   + W    +   T   I ++  GS   + I  A  ED

              G+Y    +N AG    S +V V D P              P+      +  +S     K

             +P                         G SV     V      +  W       ++  H 
Sbjct: 11027 EPLDD----------------------GGSVITNYVVERRDVASAQWSPLSATSKKKSHF 11064

                 +E    L  +AA            EN+ G          +   DP  P G P    

               D+  + ++L W     DGGS +  Y +E  +   + W +  T  +    V  L     

             Y+FRV+A N+ G   P     +    EK   P  E++V

 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

             L IK G + + +  V+G P P+VTW ++G  I       +   + G+ SL +     + R

             G YT EA N SG+ +  +++ V+ +  K +G    +   G++ +

 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 27/96 (28%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

           ++A P F  + QS  V++   V+ +  V+GIP P V ++ +G  + +     ++ ++   

           + L + +A   DSGTYS  A+N+ G+ + +  L V+

 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 18/153 (11%)

             W K  K +  + H KV     G               + +  EN  G          +  

             +D  +PP      +DI  +S++LSW   ++DGGS +  Y +E  D  +  W +       

              T F +  L  + +Y+FRV A N  G+ S PS+

 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

            +  P PP   P  +D  S+++ L W   +++GG  +  Y ++        W        +

               + V+++    +YK RV A+N  G   P  E++  TV E  E P  E++VS

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 71/323 (21%), Positives = 113/323 (34%), Gaps = 62/323 (19%)

             PP T+ W  + K L +     +    S   ++I +    D G Y    +N  G+ + S  

              V V D PA+      +  SR   + L  PP++   S   +  ++K+ A K         

                                            TW     +   +    ++ SE        
Sbjct: 21106 -------------------------------TWSVVSHKCSSTSFKLIDLSEKTPFF--- 21131

                      + +L EN++G  +       V   + PA     S  D   +S+ LSW    

             +DGGS +  Y +E      +TW      ++    V  L      +FRV A N  G S+P 

                 + TV E    P  EV++SD
Sbjct: 21243 TIGPI-TVKELIITP--EVDLSD 21262

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 41/157 (26%), Positives = 69/157 (43%), Gaps = 9/157 (5%)

             SE   K+T L    E+   + ++ EN  G   A     L    +P  P G P     +D 

               ++++L W    +DGG  +  Y IE+  +    W ++    C  T + V DL    EYK

             FRV AIN  G  +  + +      ++   P+ +++ +

 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

             G  P    + + VT  LG++  +SC I G P P + W R GK L + +  +++  +    

             TL +   +    G Y  +  N VGE      L+LQ

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 12/155 (7%)

            S P  E +     E P  F     L  + VK G        +TG+P+P++TW K ++ L+

               R+++        + I    + D G Y    VN  G+A+   E+++            

             D  N S +        D   ++TN + +    DS

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 10/118 (8%)

            P PP G P        S+ +SW     +GGS +  Y +E  +  +  W  ++        

             +   FNV  LL   +Y+FR  AIN  G   PS+ S+    G+   P  P    EV D

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 76/335 (22%), Positives = 109/335 (32%), Gaps = 60/335 (17%)

             G  + L   V   PP  I W+     L+    + +        +  E     D G Y   

              +N  G+ E +  V V D P                   PPV  T  + +         P

             P       II +   ++       +   K   T    C+   FR          V N E 

             G               + +  EN+ G          V     P G      +RS   SS 

             ++ W     DGGS +  Y ++     NK W+ +    S  ++ +DL    EY FRV A N

               G   P   SE+T V       +D+V   D D K
Sbjct: 13655 ENGEGTP---SEITVVA------RDDVVAPDLDLK 13680

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

             S +  +GQ + I   I+G P PT+ W +DG  L K T    V  + D+ TL +K+     

              GQY I + N VG+ +  + ++

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 83/373 (22%), Positives = 138/373 (36%), Gaps = 43/373 (11%)

             VV++     R    I GRP+P+V W K    L   A++ V+  +   +L I  V + D G

              Y   + N SG  S +A ++++ LDS +      +RE K  +          D   ++TN

              I ++ +      A  + NC+         Q G S  +   +  +       E+ +    

             + P  P  + T   +T   A ++ E        +  G  V   +    K     +  T  

                 GL  G + V   AA         R    P      E KP  +       VK  + +

             K      G P+  V W  +G  + ++   + V        L + +A   D GTY    SN

Query: 492   AQGQLSCSWTLQV 504
             + G ++   T+ V
Sbjct: 19167 SAGSITVPITIIV 19179

 Score = 49.3 bits (116), Expect = 4e-05
 Identities = 24/81 (29%), Positives = 40/81 (49%)

             + VK G        + G+P P V+W K    L+P+  + ++ +  +  LE+  VN+ D G

              YT    N SG  S + +L +

 Score = 48.9 bits (115), Expect = 5e-05
 Identities = 67/319 (21%), Positives = 114/319 (35%), Gaps = 50/319 (15%)

             W+  GK ++ +    ++   +   ++I+ A  +D G Y   A N  G      +VTV D 

             P                   PP     S+ + +K     TPP       I  +  +++  

               E+  L             W    + IQ   H+  +  + G++     +   H G    

                   G       + +VD+  P  P   P  S++  ++ T+SW     DGGS +  Y +

             E  +  +  W        +     V  L     Y+FRV A N  G   PS+ S+   + +

Query: 1427  K--PEEPKDEVEVSDDDEK 1443
                P  P     V+D  +K

 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 15/123 (12%)

             I++T++++ P    S P+T   A  +PPR          L +K G     +  V G P P

              V+W ++G  +    G +  +    R   +L + +V+ +D G YT  A N SG++  T++

Query: 121   LTV 123
             L V
Sbjct: 13078 LKV 13080

 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

             +  +D   PP     P  +D   +S++L+W     +GGS V  Y IE+       W +  

              C +T   +++    H     EY+FRV A N  G  EP++      V E  E P  E++

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

             + + PS        ++  G+D  ++  V G P P I+W+ +G+P+ Q  R   E  A   

              LHI++   +D G YT  A N+ G  + +  V V EK

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 19/126 (15%)

             +QLG PV+++          +E +PS+  E P  F T      VK  +  +      GRP

             Q  V W K    L+ + RV+VS    +  L I   +++DVG Y   V N +G  S++  +

Query: 249   SIQGLD 254
             +I  LD
Sbjct: 19176 TIIVLD 19181

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

             C  TN         ELT +  +  +    V ++   D  S P+  T P I  +   PP+ 

                +     +VVK G++ + +  I GRP P ++W K  + ++  AR  +   +   +L +

                 + D G Y   + N +G  S++    +

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 38/158 (24%), Positives = 63/158 (39%), Gaps = 9/158 (5%)

             AV +  + S M   S +   KS        L++ +  +  ++  A LE  + E+      

                T+        R + V EG +ARF C  +G P P V W +  Q +  S   Q+   + 

                +  IS V   D+  Y+    NS G+      L ++

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

            +++   KP+F K +  L +     A F+C++    DP +V  W  D + +  +   ++  

            +E G CSL        D    TC+A N  G    +A LIV+

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 9/182 (4%)

            G  P+T  ++  ++++      KV +     + T+    Q     + +   NK G  +  

                 VN+ T    PDPP       D  ++S+ L+W     DGGS ++ Y +E     + 

             W         T   V  L     Y +RV+A+N  G S+PS+ +E     +  E P+  +

Query: 1436 EV 1437
Sbjct: 7388 DV 7389

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 82/417 (19%), Positives = 152/417 (36%), Gaps = 61/417 (14%)

            K    ++    + G P P+ +W  +G   +  ++G  ++ EDA       S  + + + +

               +G YS TA N  GQ + +  ++V       + L V ++      +       +G D 

                 ++G  + + T  ++G+        C  G     + D L E    +   AEN  G 

                  V   ++ ++R      P+ P  P           +K+  G     TV +S  PP

                           + W   G + +     + ++   +    ++++       +  +A 

            N+AG  +  A +   +      P  I     +    G +V I   I G PFPT+ W +  

                D K       H   L  +D  TLV+ + +    G Y I   N +G  S ++ L

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 17/144 (11%)

             P D   +  +A NA+G +S            S+ S  ++     V P     P +  GL 

                +  G  + +   V G P P V W  +G EI++  +          SL +++   +  

             G YT EA N++G  + +  + VQ+

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

            +++P PP     +SD   SS+ L W     DGGS +  Y IE  +     W    +    

              ++ V  L   ++Y +RV A N  G S+PS+     T  +   EP  ++    D

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 7/133 (5%)

             +P++  T T L E A  Q    A   V+    S  S+ +  +A +  P   + +   S L

              V  G+ V +   V G P P V W  +G  ++ +E     +   Q +LC  E+F    +D

Query: 690   TGTYTCEAWNSAG 702
             +G YT  A NS+G
Sbjct: 13058 SGDYTITAENSSG 13070

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 25/82 (30%), Positives = 36/82 (43%)

             + KE    R    I G+P P V+W KG  PL    RVSV        L ++   + D G 

             YT  + N +G    +  + + G

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

             LT  P+  LP     I+ G   K E  V G P P ++W ++G+P+    R  ++     T

               L I   +++D GKYT  ATN +G     + + V

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 1/119 (0%)

             NA    S    S   +    E  P +  +  +    L +  G + R    ++G P P V 

             WFKD   I +  + +I  D  G+ SL + D   D    YT +A N+ G A    ++ V+

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 173/894 (19%), Positives = 314/894 (35%), Gaps = 157/894 (17%)

             I+ G+    +  V G PEP++ W +  + +    +  L   G R T   VI      D G

             KYT    N SG + V+V + V  S     G+  VS+   ++    +S P  +    I   

                +  T     V+ EG+    S  +T   +      +V  +    P  P     +  +N

                +    G+ ++   G    ++     ++    E+S   +D   +  +R T+       

              D R +VT+++               + C    R  +   A NS+P     S   SC++ 

                  P +AP+  V+  T  SI+L   +   +     +G +    E+           A 

              R   F      +G +     AA   + ++G  + +    E +P                

             ++  ++   +++    VSG P P + W  +G  +     S  + +   S+ L ++ K   

              D+G Y+  A N  G+ S +  ++V         + V EV+    ++  +   I+G    

                   G PV   I          +   T +       I   +      +  L EN  G 

                   S  V V E          +P+ P+K            L+V+D ++ T+T  ++ 
Sbjct: 23315 GEPCETSDAVLVSE----------VPLVPAK------------LEVVDVTKSTVT--LAW 23350

               P     L++G            + GT+  + +  + P   E T T   E       +R

              Q    V EP +      +   R             ++    G+ V +   IAG P P  

              W   G  L +++    V  +  V  L +++      G+Y + LKN  G  S  + +++ 

             +               A ++    EP   +    GG    G   ++  + RPGW

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

             P PP G P         + + W     DGG+ + +Y ++  +  +  W  +        T

                V  L+   +Y+FRV A+N  G SEPS+ S   +  E    P

 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

             V +   S  S++   ++P     +P  E    +   + + I+ GA+ +    V G P P 

             +TW + G  + S  R ++D        L++  V+  D GKYT EA N SG +  TV + V

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 70/343 (20%), Positives = 122/343 (35%), Gaps = 60/343 (17%)

            ++++ + +GS   E +    VES   +S  + S       V         K + +A  ++

              K   + KP E  + +S E   ++V   V  +    G    +         P     L 

            D    EG  + L   +++     + W    K + + +     Q+ +  ++ I+K   ED 

            +G Y C A ND+G+   S ++TV                                    K
Sbjct: 4501 QGEYVCEALNDSGKTATSAKLTV-----------------------------------VK 4525

            + AP    K           E  +V  G   +   ++     +   W K  ++I ES+  

             + +S+  S L IL  +   CG YT    N+ GS      LTV

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 100/477 (20%), Positives = 188/477 (39%), Gaps = 71/477 (14%)

            V+W  + K +  D   F+ LQ+++ +TLV+ KV    H G+Y     N  G+ +    L 

            +   +A  + R  EP    ++  G +           ++R  W   G+  + E D   +R

                     +L+ +V +  ++T +A  +         L      G+K   K L E   K 

             P E++  ++ L++   + +PK   ++  KV  P           ++V+  +V  ++   

            K P P KVP  KPA P           LPA       E   A+      P    +P+   

             PV    P    K    A   E  KP G   P + +   +   ++ + +       G   

              +     + +     F ++++D+ + E    G   + +C VS   P+T I  W  +G  

            ++ +   +FI   ++  L  + ++ +   D G Y CV +    +   + ++ V++ P

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 74/370 (20%), Positives = 134/370 (36%), Gaps = 58/370 (15%)

             EG  +   C++ + D    + W    + L+ ++   ++ E  +  + ++     D G Y+

             C   ND G+     ++ V         +  +   RR               T+KK K   

              T      PP+      ++    GE+V     +T       TW K  ++I+  ++ K   

              E+ +   +LTI +   +    YT++  NK G    +  LTV   P P            

                     G     +IR S +   TL W     DG       +IEI       +      

                + +++D LP+    +RV A N  G++      ++  +  K +E K + E     +K+

Query: 1445  PEVDYRTVTI 1454
              +   R   I
Sbjct: 25604 IDKTLRMAEI 25613

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 74/344 (21%), Positives = 131/344 (38%), Gaps = 46/344 (13%)

            P F+   + +   +G  A FE  V G P P VTW +  + + +   + +     G+ + +

            ++    ED G Y C+A N  G      EL V          P  +K+  +          

              PAVE   S       + AT +   ++K   +   + +++     +   L   +PL   

               S+ E++ +          +    + C  +NGS         S  L +Q + S  ++F

             +         ET+A  SD  K   + +S E +++SL         + P+ G  P     

            S  +PP  S L S  +    +P+   +  T+    +TLQ    Q

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 37/120 (30%), Positives = 50/120 (41%), Gaps = 11/120 (9%)

             GLG  D         IP+E Q     P  E   +  E   VK   TV+F   + G+P P 

               W  +G+ ++  E    V  D  S  L +     RD+G Y  T SNA G  + +  L V

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

             LP      KE +  + +  ++G P P V+W +   P+ +  R  ++     T +L+++  

              + D GKYT    N +G ++ T+ + V G

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 34/121 (28%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

             S ++  +  P+ P      E++    E V    + A  +    +K   SK I  L  VVE

              S  R           EV W+KD + ++E+ HFQ  Y  DG   L I+++   D  +Y C

Query: 1832  K 1832
Sbjct: 26487 E 26487

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

            L+DV+V EG K +L+C+VS     ++ W LN + +K    +    +G+   + I +    

            D G YK +     G+ E +C ++V+

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

            PHV+  F + + DL+V E   ARF+C++    + +V WFKD   I++ + + I   +   

              L+I+    DD+A+Y+C+

 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

             ++E  P +   L    +  G+   ++  V+G PVPR+TW  +G  I+   +   T   G 

               L ++DA  +  G YT  A+NA G       V V +

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

            E  H++  F K I+D++V+E   A F+C++   PD  V W KDDQ ++ +   +I  ++ 

             +  L+I      D  KYT  A    G    TA+L VE

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 97/438 (22%), Positives = 161/438 (36%), Gaps = 66/438 (15%)

            RQ TV+   EG+  K     V +   G     P  ET+P    E     A +L     G 

            + +  G+  R    +TGRP P   W K    L    RV +        L I    + D G

             Y     N  G    +A           L ++ + +  +  +        D   E+T  I

               K++K+ +    +E      + +    G    +   ++ +    PP E       D  

             P T+P+     ++T S+ITL       EPR+ G   +     E++R   P         

             PT    + + D         KA N        +P+    Q D   P    +   +  + 

            +VK  + V    +V+G+P P++ W    T + +   ++++ ++  S       L + KA 

              D GTY+ TASN  G +

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 36/144 (25%), Positives = 58/144 (40%), Gaps = 30/144 (20%)

             +V P+FSS     +V  GQD  ++  + G P P ITW  +G P++       T    +  

             L I++   +D G Y     N +GQ + S  +   +K             P  P  P+   

              +S            ++ +S NPP
Sbjct: 17029 DVS----------AESITLSWNPP 17042

 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

             +  G  + + + V G P P + W+ +G  ++++   + E+  T   L I+E   +D G Y

             T  A NSAG      +V+ +++P

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 168/821 (20%), Positives = 276/821 (33%), Gaps = 127/821 (15%)

             +K G   + E  V G P P + W ++G+ +    +  +      T +LV       D G 

             YT  ATN              G FAK +    V    G      +   V +   +    P

             P      K+   +V++ +  R +       + QVT LK    L+ +    RV    K G+

                     VL ++     D              +  C     S   S      ++  D A

              + +++  K T +D+R +V+ +    E +   +   A   +  SP            +P 

             PP   + L++ + S   A   P+    S           PE        P A GL   S 

             +          +   +     GLG   +V    KA +R +P E + D+   K  +     

              ++   T++    + G P PEV W  +       E   +   ++ S Y  L+       D

             SG Y  T  N+ G  S    ++V       + L V EV  +  ++  D  +++G   +  

               V      R       +      + C     ++   D L E    Y   LAEN  G + 

               A      K S R      P+ P K T            +MD ++   +V +S   P  

                 H+G           + +G+ + + C      E T T   +    +  V  Q    +

              +P   + P  I+K             + T   G+ + +     G P P V W +D   L

              K T        E+   L +K       G Y + L N  GE

 Score = 45.1 bits (105), Expect = 7e-04
 Identities = 57/219 (26%), Positives = 87/219 (39%), Gaps = 16/219 (7%)

             P  PP A   P++     +   +R  E         G   I   W+  K R  I   +  

             KV   E   K+T L    E+    Y L       + +A   +   +  D P G P  +D+

               S+++L W   +YDGGS V  Y IE   + +  +  W +          F V  L    

              Y+FRV A N  G  S+ S+ +   T  ++   PK E++

 Score = 44.7 bits (104), Expect = 9e-04
 Identities = 41/156 (26%), Positives = 64/156 (41%), Gaps = 6/156 (3%)

            W+ +G+ I+ES    F   G    L I +V   D G YTC       E  + A L V+E 

                  +  +    VT   GQ + +SC +  +    V W +DGK + +  G         

            +  L +       AG Y + ++N    ECS  V ++

 Score = 44.7 bits (104), Expect = 9e-04
 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 4/112 (3%)

             P  P G P   D+  S+++L W    +DGGS +  Y +E        W    T       

               +    L    +Y+FR  A      S PS+ S+  T+  +   P+ ++ V+

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

             L +K G T +F   +RG P P   W  +G  I +   + ++      FS  L I      

             D G+Y    +N +G++ V V LTV

 Score = 44.3 bits (103), Expect = 0.001
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 2/123 (1%)

             +EK  S   +  +PV A      P F    +   V+ G  + + V   G P P V W  +

                ++++   + E       L I++   ED G Y  +  NSAGE + T  V+ + +P   

Query: 719   TQP 721
             T P
Sbjct: 15940 TGP 15942

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 81/381 (21%), Positives = 132/381 (34%), Gaps = 74/381 (19%)

             V+V+ G   R    + GRP P+VTW K  +      +  V   + M  L I    +DD G

              Y+  +VN +G+ ++   + +      +     S V +T          +D   +VT+ I

Query: 280   SKESKLDSLE----------------------------AAAKSKNCSSPQRGGSPPWAAN 311
              ++ + D                                A        P     P  A++

               S+P PPR+ ++     +  T    P L+    K    IT      QP  R     V+ 

                        G++ K     R A   + P    G      V +A  + +P         

             PK    P+   +K  + ++    V G P P   W  +G         + V++   S  L 

             +     +DSG YS TA N+ G

 Score = 43.9 bits (102), Expect = 0.001
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

             PPK      ++ +K G+  R    + G+P P   W KG   +  S+ ++V + +   +L 

             I  V + D G Y+    N SG

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

            VK V ++ +SK S +V P    R D  P  +   F+       ++EG       +++G P

             P +TW +       N +P+   T   + ++D     T +LVI      D G YT  A N

              G     + L V G
Sbjct: 9896 NLGTASKEMRLNVLG 9910

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

            + +KT++++EV E   A F+C++  +  P  +W K+   I  S  F+I      +  LII

             +   +D A+YT    N    AT T   I+ T    +   EE++

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

            +EV EG+      KI+G P P + WFK      +++   + YD        D  C+L+I 

                 D   YT  AVN+LG A+

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 7/118 (5%)

             + V+ GQ  R   ++ GRP+P +TW K    L    RV + +      L+I    + D G

              Y     N SG A  SA +++  LD       +  K TN  V KE    IS E+ LD+

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 1/102 (0%)

             E V E K  + P        + +  G   R +  + G P P   W K +  +  S H  +

              +  D +  LII DV   D   Y+  A NS G  T   +++V

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 36/121 (29%), Positives = 49/121 (40%), Gaps = 7/121 (5%)

             NA  + SE   S   + A  E  P    + P +  TI    V  G + + D  I G P P

              + W K DQ +  +   +I    D   SL + D    D   Y  KA N  GE + T  + 

Query: 1848  V 1848
Sbjct: 16328 V 16328

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

             P PP      S +   S+TL W     DGGS +  Y IE  +  +  W  +         

             V+   L    EY++RV A N  G S PS+ S L

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 57/243 (23%), Positives = 94/243 (38%), Gaps = 58/243 (23%)

            +G    F ++LQD+ V E     L+C VS   P  I   W  N   LK+  K+ I S+ G

               +++++    ED+G Y  V                                       
Sbjct: 2274 RQ-NLTVKDVTKEDQGEYSFV--------------------------------------- 2293

              + G ++   +K KP P           I+Q   DQKV  G+ V+L  KV+  + +   

            WMK  +++Q S+ + +   +    L I    +E  G Y+  +     S   +V++  VD 

Query: 1331 PDP 1333
Sbjct: 2402 ITP 2404

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 10/98 (10%)

            F K I+D+ + E    GS+A F+C +   P   +  W KD  +IRES +H  I   +D  

              +I  DV   D  +YTC       E T TA+L+VE +

 Score = 42.7 bits (99), Expect = 0.003
 Identities = 33/143 (23%), Positives = 57/143 (39%), Gaps = 12/143 (8%)

             +  + TV G    Q  +  V++K      S P+  T P    +          PKF    

               +VV  G+  R    + G+P P + WL+G+  ++ SAR  +   +   +L +    + D

              G Y     N +G  S    + +

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

            +KS  K +++ K + + +N +  H G   +      + T+ A          F++ ++D+

             V E K+ + +C+VS +P  T+ W  + + L+ T  I + +E  +  + I      D G 

Query: 1168 YKCVAKNDAGQAE 1180
            Y  VA  +   A+
Sbjct: 3081 YTVVAGGNVSTAK 3093

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 2/79 (2%)

             +K G   R S  I G P P+VTW K +      AR+ V+       LEI     +D G+Y

             +  V N +G  ++S ++ +

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 21/72 (29%), Positives = 34/72 (47%)

             ++++ G   R    + GRP P++TW K NV L+    + +   +    L    VN+ D G

Query: 230   VYTCLVVNGSGK 241
              Y   + N  GK
Sbjct: 13458 KYILTLENSCGK 13469

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

             G  + + + V G P P V W      +++++  +FE   T   L I E    D+G Y   

             A N  GEV    V+T+Q
Sbjct: 14835 ARNIVGEVGD--VITIQ 14849

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 25/148 (16%)

             KD  V+  G+ F +   + G P+P I W+   Q +   AR   ++      L ++DA+  

             D G Y   A+N  G+ S    VTV+ K   R         P  P  P+ + G++  K   

                  + DG    +   V       ++W

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

             +P VKP FS       V  G   + +  I G P P + W KD   ++++    +  D   

               +L I +   DD  +Y     N +G+ T + E++

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

             + + I     G P  TV+W +DG+ L K+T    V  ++ V +L +K+      G YE+ 

             + N  G  +  +++++ +      P   +  SC+ +

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

            F + L+D  V EG   +L+C+VS +  A + W  NG + LK+ K+ I++ +G +  + I 

               PED   Y C    DA   + SC + V

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 49/222 (22%), Positives = 76/222 (34%), Gaps = 44/222 (19%)

            L E   F     N+ + E  T K    V   P  +V W++  + I   GR+ +    R  

              LVI   H ED G Y C   +     +V V                             
Sbjct: 6213 I-LVIQNAHLEDAGNYNCRLPSSRTDGKVKVH---------------------------- 6243

                     E   +F +K   + + EG+   F C I+    P V W + +  L+   +  

            V      +VL +      D+G Y  +V    G A  +A L++

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 27/87 (31%), Positives = 38/87 (43%), Gaps = 9/87 (10%)

            G+   +   V G P+P+I W  N   I+      +             EL I  A+ ED 

            GTYT  A N LG V  +  V V+++ S

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 26/93 (27%), Positives = 39/93 (41%)

             P+  + ++ +  L V  G+ V     + G P P   W  +G+EI+  E +  E       

             L I+     DTG Y     N+AG       LTV

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 80/404 (19%), Positives = 147/404 (36%), Gaps = 56/404 (13%)

             V G P P+V W   G     ++G +++ +     +L +  +   DSG YS T  N  G+ 

             +    ++V         L V +V  +   V       +G   V    V      R TW  

                    +  T E      H+ + +P +   +   A N  G       V     K    S

             + L     S+P  P         + ++ +++T         PP    L +G    +    

                E+     R T++S+ ++++    TG        +   A N+ G    +    V E  

             +   P  I  P  +T   G+ + I   + G P PT  W + G+     + H  V + +  

               L++K V    +G Y +  +N  G  + ++ +++ ++     P

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

             +T   G +V +   + G P PTV W +DG  L K     ++    ++ TL L  V    +

             G Y I  +N  G  S  + L

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

             VV+ G   R      GRP P   W K +  L  S R  +   +    L +   N++D G 

             YT  V N SG  S++  + +

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 13/142 (9%)

             +  LA+NA G +S  +  T      + + EY    AP K      L G  DL  +  GS 

             + +   V G P P++IW     E+   E    +  G + +  I+     D+G YT    N

             ++G   T+AV  + +  D   P
Sbjct: 22820 ASG---TKAVSVMVKVLDSPGP 22838

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

             T  D ++ P  E    + G+           V ++ G        + G+P+P++ W KG+

               L    +VS+          I   ++ D G YT  V N SG  ++S  + +  LDS

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 63/277 (22%), Positives = 106/277 (38%), Gaps = 59/277 (21%)

            +N+ + E  TA FE  V  +  P + W +NG  I    +F +   ++G    L+I     

Query: 99   EDRGKYTCEATNGSGARQVTV----------------------ELTV--EGSFAKQLGQP 134
            ED  +YT    N   +  +TV                      E+TV  EG   K L   

Query: 135  VVSKT---------------------LGDR----FSAPAVETRPSIWGECPP-KFATKLG 168
            V  K+                      GD     F A    +  +++ E    +F   + 

             + V E +   F C+++  P   V W+K +  LQ + R+ + ++  +  L I      D 

            G YT +    +G    +A+L ++G D   RS  +E +

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 78/373 (20%), Positives = 136/373 (36%), Gaps = 47/373 (12%)

            V + Q +   CE++   + +V W  +G  V  + G I          L +  A   D+GT

            Y+ T  NA   L CS  ++V    V  +       ++D  V      +  C +     P 

            I W      +  +P        +     L I++A+PED   Y    E         A +T

            + E    R+ E L P+               D+ + +    +   ++S    P   W   

            G  ++ S     +  G +  L + +V  +  G    +A N+     T A+LTV+E     

            +  F    + VT    +     C +  +    V W + G  + K +  F+++ +     L

Query: 780  VLKKVQPWHAGQY 792
            V+   Q    G Y
Sbjct: 5237 VINDSQFDDEGVY 5249

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

            F+K + ++EV E    +  C++   P  EV+W+K D+ I E+  ++I   E     L+I 

            +   +D   Y C+  +S  +      EL  E + + +     EGE+ E

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 12/122 (9%)

             A+  ISK S S  P  + +    E P   + P+    + +  G T + E  V G P P +

              W R  + I    R    C I+ T     L++      D G+Y   A+N +G++   V +

Query: 122   TV 123
Sbjct: 17409 KV 17410

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 8/105 (7%)

             ++VK G     +    GRP P V W K +  L+  A V  ++      L I   N++D G

              YT  + N    AS++  L ++ LD+        T  T  DV KE

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 1/90 (1%)

             +K  ++++ +  V G P P V WF +G  + ++  ++E+ +  GS  L +  A     G 

             Y+  A NA G       ++V+      V P

 Score = 41.6 bits (96), Expect = 0.007
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

             + P       D+ + EG      C   G P PEV W    + I  +E   F I+ + D  

              +LII DV   D   YT    N  G  + T  + + ++

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 24/96 (25%), Positives = 43/96 (44%)

            +C P    +   ++V EG+           P P V+W K    ++ S R+++   +    

            LE+    + D G+YT  + N  G A+ S  + + GL

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

            P+      D  VIEG+   +    R  PVP ++W  +G+ ++ + R T +     A L +

              ++  D G YT   EN LG  + S  V V

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 57/244 (23%), Positives = 94/244 (38%), Gaps = 35/244 (14%)

             VSK +    P + QR    P  + K +  EV+E   V    ++ G+P P + WF    P 

             ++ +    V  D   + L     C L   ++R  D+G Y+ TA N  G  S    L V  

                  V P  F SV  D   +       +G   +    +      R TW+ ++ +P    

                C   + +L     L      +  +A+N  G         +  +  + ++ + +P AP

Query: 618   SKPT 621
Sbjct: 10016 DKPT 10019

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 25/87 (28%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

             K I  L V  G+  RF   I G P P   W  D   I+   H+ ++ D   +  L I + 

                D  +Y     N+ G  T    L V

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 23/80 (28%), Positives = 36/80 (45%)

             +    G++ ++   I G P P V W +DGK L +     E+       TLV+K       

             GQY + L N  G  S  +++

 Score = 41.2 bits (95), Expect = 0.010
 Identities = 26/85 (30%), Positives = 34/85 (40%)

             V +  G  L+L   V   P   IIWT   K L   + + L   G   +  I+     D G

              Y    KN +G    S  V V D+P

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

            K SR +E +  V   + P   + ++ L+ L V  G+++ +   V+G P P++ W      

            +++ +    E    + ++ I +    DTGTY  EA N  G  R  AV+ V

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

            K +  L V  G+       + G P+P++ W K D  +++ +   I+ +     ++ I D 

               D   Y  +AVN  G AT   E+ V

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

            P PP      + I  ++  L W     DGGS + +Y +E  D   K W+ +  T + T  

             V  L     Y FRV A N  G S+

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 1/91 (1%)

             P  IL P  + IK G   + E  V G P P   W +    + +     +      +  L+

             I  V  +D G Y+  A N SG     +++ V

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 38/145 (26%), Positives = 62/145 (42%), Gaps = 18/145 (12%)

             ++  +A N +G +S    L V  +A  + + P+F  +     V+ G+D  +     G P 

             P +TW  +  P+ Q  R   E+    + L I+DA  ED G Y     N+ G+   +  V 

             V +K             P  PT P+
Sbjct: 15932 VLDK-------------PGPPTGPV 15943

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 20/81 (24%), Positives = 39/81 (48%)

             +VV  G+  +    I G+P P + W+KG+  L  +AR+ +   +    L +    + D G

              Y     N +G+ S++  + +

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

             ++ G   K E  + G P+P +TW ++G P+    R  +   +  T +L I   H++D G+

             Y     N  G +  ++E+

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

             ++P          +  G   + +  + G P P + W KD + ++++    ++ +   +  

             L I +   DD  KYT  A NS G AT    +IV

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/74 (31%), Positives = 33/74 (44%)

             Q+ + V   G P   V W  +G  ++E+   +     T  SL I+E   ED GTY     

Query: 699   NSAGEVRTQAVLTV 712
             NSAG +     + V
Sbjct: 19166 NSAGSITVPITIIV 19179

 Score = 40.8 bits (94), Expect = 0.012
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 14/111 (12%)

             +V EP + T P  +      PR          +    G+ + I+  IAG P P + W +D

             G  + ++    E++  ++   L +K       GQY + LKN  G  S  V+

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

            F+K + D  V EG+ A  +C++    + +V WFK+   I +S+ ++I  D      L+I 

Query: 1820 DVCGDDDAKYTCKA 1833
            D   +D   YTC A
Sbjct: 6040 DCTPEDIKTYTCDA 6053

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

             + ++ G T +   RV+G PEP +TW + G+ +    R  L   +     L I      D 

Query: 102   GKYTCEATNGSGARQ 116
             GKY   A N SG  Q
Sbjct: 11672 GKYIISAKNSSGHAQ 11686

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 79/398 (19%), Positives = 146/398 (36%), Gaps = 55/398 (13%)

             V+  QT++    V G P+P++ W  EG  + R E  +++ +D     L + +A   D G 

             Y  +A N+ G    S  + V       + L V  V     ++  +  +  G   +    V

                           +P Q   S   + V +  I+ + L  +   +   AEN +G      

               T+  K        +L + P  +P  P       +L + D  +  + ++       G  

             P   +  H    ++ S+D+    +G+  +    +          +  +  N  GE   V+

             T+ V+  +   D  +P    K   V T   G ++ +   + G PFP V W +D  A    

              +   ++    D     L K +    G+Y +   N  G

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

             VK    V     V G P P V+W  +GT ++  EG I++        L L     +DSG 

             Y+ TA N+ G  S +  L+V

 Score = 40.4 bits (93), Expect = 0.016
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 24/148 (16%)

             S++ G ++    +++ R+++    P F   +    V  G+ F L+  V G P+P I WL 

               + I+ + + CE       A L ++DA+  D G Y   A N  G  S    V V ++  

                        P  P  P+ + G++  K
Sbjct: 17414 -----------PGPPEGPVQVTGVTSEK 17430

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

             DP+ V    L     E P  IL     R   IK G T +    ++G P P+VTW +  + 

               +  R  +D    G+   + +A H ED G Y+    N +G++ V+V++ V

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 3/82 (3%)

             VK   T++    V G P PEVAW    + T + R    +++   A S    L KA+  D 

             G Y  TA+N  G      T+ V

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

             V V+EK  S      +P VA      P      S   V  G  + + V +SG P P + W

               +G  ++++   +        +L I+E   +D G Y     N  G+   +  ++T+ +P

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

             KD  V+  G+ FVL+  +RG P+P + W  +G+ ++   AR   ++ + +  L ++D + 

              D G Y     N  G  S    V V ++             P  P  P+ + G++

 Score = 40.0 bits (92), Expect = 0.021
 Identities = 87/450 (19%), Positives = 159/450 (35%), Gaps = 68/450 (15%)

             Q+  V+   +++      G P P   W     P        +++       L +      

             D+G Y+ T  N  G  S ++T++V         +   +V    ++++ D  +++G   + 

                V      R +W       Q     C   + +++              LAE       

              SA   V+E       E   P+  ++  AP        L V+D S+ +  +         

               WL   H+G            Q+  DF  E   T Q +  ++ +  +    +  +A N 

             AG    +   +   ++EP  + T        + +T   G    I   I+G P P V W  

             +   L K+T    +   +D  TL +K      +G+Y + L+N  G  +  V++++     

                 P      S E  +   G   DGGG++

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 33/107 (30%), Positives = 46/107 (42%), Gaps = 11/107 (10%)

            G  AKF   ++  P  +  W + G+ I    +    C IR +    SL I      D G+

            YTC+A+N  G+   T  LTV        G+  V K L +R   P  E

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

            S +D SQ  +EA+   +E K  V    PYF+  ++D   VE       C+I    D  V 

            WFKD + I+ S++  I  D      LI+      D  +YTC

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 8/110 (7%)

            PSR    + ++   EAP   L  +    L +K G   +    V G PEP++TW +    +

                R  ++  +    ++ I      D G Y  EA N  G     VE+ V

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 68/354 (19%), Positives = 126/354 (35%), Gaps = 56/354 (15%)

            V E + +        +P P V+W  +G  V+  +  + +  D  S +L + K+   D+G 

            Y+ T  N  G  + S  ++V       + +   ++  S   +  +    +G   +L   +

                  R T++    P+    +     V     +D +P     +   A N +G       

                        E   PV    P  P       D++V + +   MT+  +  PP     L

            ++G             +G +    C + + P    TYT +      E    VR +    +

             EP   T P     P          S+    G  + +  +I+G P+PT+ W++D

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 105/504 (20%), Positives = 176/504 (34%), Gaps = 76/504 (15%)

             L I+ G      GR  G P+P+V+W ++   +    R  +      T +L        D 

             GKY     N +G+R+   ++ V      + G PV   +    F     +     W     

                +K+   ++++ ++G+            V     +   + + +VS   +    +  IH

               N    G+   LV +     SM A+   +  D+ ++  V E    ++        D  K

              +TN I ++ +  S   A  +K+                C    R  +        P PP

              +   +K    K SP   P+       S  +T Q  R     +  G  V     G+E  R

              A   P + P T+    G +D    K     +   G+ D A        K   +P     

                  + Q +K   T++    + G+P P+V W  E       +  I+V    GS  L + 

              A   D G YS T  N  G  + S

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 23/81 (28%), Positives = 34/81 (41%)

             +VVK G   RF   I G P P   W      ++     +V   N   VL I    + D G

              Y   V N +G  +++  L++

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 29/123 (23%), Positives = 52/123 (42%), Gaps = 6/123 (4%)

             +++ A + +     +  P  V      EAP   L     + + ++ G +A+     +G P

              P++TW R     T   +  ++ G+  T  L I      D GKY  +  N SG++   V 

Query: 121   LTV 123
             + V
Sbjct: 17805 VKV 17807

 Score = 39.7 bits (91), Expect = 0.028
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

             V +  G  L L   VS  PP  I W+  G  L +   I  ++  SL  + ++K    D G

              Y   A+N +G+   +  V V D P

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 65/327 (19%), Positives = 119/327 (36%), Gaps = 37/327 (11%)

            P F    +SV    G +      I+G P P V W RDG+ +   T    ++  ++    L

             +  V   ++G+Y +   N  G+ +    L+++  +A        P   + L    +   

             G   R      G P     +    DG +++  L  ++            E         

             ++  + +G+  ST  L     +E+PA++     +   Q+     +  E+K+ +    D 

            RS+    +   G +   +P K PP  P  P  RS     +  K +L  +   S       

                S  P+ + +   P  PV +  PA

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 27/102 (26%), Positives = 38/102 (37%), Gaps = 1/102 (0%)

            E V  + P  KP       D+ V+EG            P P V W KD + ++ S    +

              D   +  L +      D   YT    N LG AT +  + V

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 34/126 (26%), Positives = 52/126 (41%), Gaps = 7/126 (5%)

            SV     ++ G+   +   V G PVP   W      +   R   +     +EL I+DAL 

            +DHG Y   A N+ G    +A V V +         +L + P      + L   SD +  

Query: 636  DGSQVT 641
Sbjct: 8919 GGSEIT 8924

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

            G  + I   I G P P   W  DGKA    KD  H        E  +N  V  +++ + +

              H G+Y I  KN+ G+   +C+V +M

 Score = 39.3 bits (90), Expect = 0.036
 Identities = 34/144 (23%), Positives = 58/144 (40%), Gaps = 9/144 (6%)

             D HFE  G    H    + +     G ++ E   S G +  +    V  P     P +  

                ++    G+S  +   I G P PT+ W++  + L  +T   E+   +   +L +K   

                +G Y +  KN  GE S  V++

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 31/105 (29%), Positives = 47/105 (44%), Gaps = 3/105 (2%)

            A+E     P     ++D+ V  G  A+F C ++     +V W  +   I ES   ++   

            ++GN   L I +V   D   Y+C   N  GE T +A L VE   E

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 21/81 (25%), Positives = 35/81 (43%)

             + V  G  + +  +V G P P++ W   G  +   +     Q   +  L I+E    D G

              Y   A NS+G  +  A++ V

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

             SV A  G+ V +     G P PTV W +D K L  D   + +   +    L + +V    

              G+Y + ++N VGE           SS  ++     PA+C+ L

 Score = 38.9 bits (89), Expect = 0.047
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

             G +  L+   +G P P I+WL +G P+   ++ R +       L I++A  E  G YT +

              +NA+ +++    V             L P  PSKP  PI
Sbjct: 21333 LDNAVCRIAVPITVIT-----------LGP--PSKPKGPI 21359

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 3/114 (2%)

            G E+  T   + PAP   P    PP ++   ++  V  GESV L   ++G    T TW +

               QI+ S   ++      ++L I  A  E  G +T    N+ G+      L V

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

            PV  ++P  P    + +     +++M G  + +   V+G P P  +W     E+ + +  

              +  GT+  L I++   +D G Y   A NS G

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

             L +K G T + E  VRG P P+V W   ++   +T   R  +D     + FSL       

              D GKY   ATN +G+
Sbjct: 11964 SDGGKYVVTATNTAGS 11979

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 91/425 (21%), Positives = 154/425 (36%), Gaps = 61/425 (14%)

             IP EG+ D+   K      +  ++   T++    V G P P++ W      +R + G ++

             +       +L        D+G Y  T  N+ G+   +  ++V         + V E++  

              + V  +  +I+G   ++   V+     R +W         +  T E       + +   

                  +   AEN  G         + +   +R +     V  S+   P+      DLKV 

               S+ + ++   G   P       G+ I     DF  E+   Q    SL +Q    + T 

                 T+   A N  GE  T + +TV    D   P    K        A    +  +   I

              G P P+V W +    L  DT    V  +    TL++   Q   AG+Y I LKN  G   

Query: 805   CQVSL 809
Sbjct: 13761 GTISI 13765

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 33/131 (25%), Positives = 47/131 (35%), Gaps = 11/131 (8%)

             PAF L      +  G   K +    G P P VTWH++  P+    R   +        L 

             I     ED G Y  + TN +G    T+ + V        G   + +   D  +       

Query: 153   PSIWGECPPKF 163
                WG  PPK+
Sbjct: 15957 ---WG--PPKY 15962

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

             RD  VV  G   R +  + G P P + W + D+ I ES   +I  + D    LI+ D   

Query: 1824  DDDAKYTCKAVNSLG 1838
              D  +Y  +A N  G
Sbjct: 17386 IDGGQYILRASNVAG 17400

 Score = 38.5 bits (88), Expect = 0.062
 Identities = 22/83 (26%), Positives = 37/83 (44%)

             +  K G        I+GRP P+VTW    + L+ + RVS++       L +    + D G

              Y   + N +G  + S  + + G

 Score = 38.1 bits (87), Expect = 0.081
 Identities = 58/270 (21%), Positives = 103/270 (38%), Gaps = 43/270 (15%)

            PV    W+ +N +PI+  +   E GV        +P+        A NA+G         

                + S  SE ++   P  KPT  +      D+ V++G ++++ V     P P V W  

            +G E++ S+    +       L + +    D G YT    N  G       V  +  P  

               P    K   +T S       SC +  +P       P +H++ + +   + T +  V+

              E+  +  +K + P     + +   N+VG

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 7/92 (7%)

            PT  + L    D +KV  G  V +   V+G P P++ W  N   I++  D          

            +   +  L I +   ED GTYT  A N  G V

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 20/73 (27%), Positives = 33/73 (45%)

             V++K G+  R    ++GRP P + W K    L+ +A++ +   +    L      + D G

Query: 230   VYTCLVVNGSGKA 242
              YT    N  G A
Sbjct: 15226 AYTLTATNPGGFA 15238

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

             +AP   L P+    + +  G T   E  +RG P P V W ++G+ +  +  R  +   I+

              T +LV+      D G+Y  + +N  G + + + + V

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 13/99 (13%)

             PS+ T PI ++        + D+K  D      G  + +   ++G P P + W  +G EI

             +E              L +++    DTG Y     N AG

 Score = 37.7 bits (86), Expect = 0.11
 Identities = 20/83 (24%), Positives = 38/83 (45%)

             +  G+ L ++  V   P   + W  +G  ++    + ++      S+ +  A  + RG+Y

                AKN +G A+   +V V D P

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

            ++++ G   R    + G P P  VW K++  + + R   +  D  G  S LII D    D

              +Y   A NS G     A + V

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

             +T  +GQ++ I   + G P P + W ++GK L ++    +++Q+     L +K+      

Query: 790   GQYEILLKNRVG 801
             G+Y I  KN  G
Sbjct: 11672 GKYIISAKNSSG 11683

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

             G +  L  +V G P+P ++W  +G   +P +  +   +  +  L +     +D G YT  

             AEN+ G  S +  + V +K

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 9/125 (7%)

             VDP R+   P  +          + +  G + K +  + G P P + W +  Q +++  R

               +      T SL +      D G Y  +A N +G R VTV + V        G  V+S 

Query: 139   TLGDR 143
Sbjct: 16344 VTAEK 16348

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 81/409 (19%), Positives = 147/409 (35%), Gaps = 65/409 (15%)

             V+   + +      G P PE+ W        R+EG    +V  + G +Y  L +      

             D+G Y     N+ G  S   T++V       + LAV EV    + ++ +  +I+G   V 

                +      R           YA  + +       +++        +  +AEN  G   

                 V V    + + +E   P  P K T            + D SQ + ++       PE

                 H+G           + +GT+         +C   V    +G    +  +A+N  G+

                + +       D T QP       + +   G+ + I   + G P P + W++DG+ L 

             K T    V +      L +K+      G+Y +   N  G  +  +S+++

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

             D S +    +A+E+   +P F   S+  + L V  G++        G P P V+W K D 

              +R   +       D   SL I +   +D  KYT    N L  A+ T  L+V+ ++

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

             P   + ++ G+  K +  + G P P+VT  R+G P+ +  RF  +       ++ +    

               D G+Y   A N SG  +  + + V        G  V+S

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

             G+S+ I   + G P P V W +DG  + K   + E+       +L ++     H G Y +

               KN  G    ++ + +Q++  + +

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 87/433 (20%), Positives = 147/433 (33%), Gaps = 79/433 (18%)

            +  H G        + +   P      + V V EG+    +C+V+  P   + W LNG+ 

            ++ +K   +  +G +  + I      D G  K  A+N  G  E   ++ +       S  

             +APE    RP+  +      + +     +P   T  K  +  +  +    +KV   ES 

Query: 1256 ELFGKVTGT------QPITCTWMKFRKQIQESEHM-------------------KVENSE 1290
            EL  K          + IT   +K RK+ +  E +                   K   +E

             G K+TI         L+   E    +  +    +G    A   + VV KPDP       

                       WY +            IE  D     W E   C      ++D+  +   

               V+AIN+ G +        Q  +L T  ++ ++     KD +   + +  EP V  + 

Query: 1452 VTINTEQKVSDFY 1464
                 E    D Y
Sbjct: 2162 YKDGMEVHEGDKY 2174

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 57/266 (21%), Positives = 95/266 (35%), Gaps = 45/266 (16%)

            P+ V E + K+   Q+ DFRSVL            + P P+   P+F     GK +   +

                  +T   K V   K             + + K  E  + + +     T +    A 

                LKS  K+E  +++      +  H     T+ EK++   E + T P FK        

                    +++Q   V +G     + +V   P     W  NG K  ++ +      E ++

            C + I     ED       A N AG+

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

             G  + +   VSG PPP V W  N NE    ++   E      S+ I+       G Y+  

             A N AGE +   ++ V
Sbjct: 10292 AKNEAGERKKTIIVDV 10307

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

             T RD+  V  G   R   +++G P+P++ W K+ +  +RE R   +D  +D     L I 

             +    D  KY   A NS G A  +A

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 7/107 (6%)

             V  E+  VK    K + DL+      V  G   R +  + G P PEV W KD  +   +R

               ++  D   + S   ++     D  KY   A N+ G     A + V

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/92 (23%), Positives = 40/92 (43%)

             + +  G ++ +   V G P P   W    +E+  S      +  +   L I++V  +D+G

              Y+  A NS+G    +  + V +     QP F

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

             + +  G + R    I+G P PEV W K D  IR++    +        SL++ +V   D 

Query: 1827  AKYTCKAVNSLG 1838
              KYT    NS G
Sbjct: 16704 GKYTLTLENSSG 16715

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

             P     +   EVV+   G++ +    I G P P + W+KDD+ ++ +    ++   D   

             S++I D    +   Y  K  N++G A+ T

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

             V  + G   +    I+G+P P + W K +  LQ +A V V     +  + I   ++ + G

              Y   + N  G A  SA + +Q LD

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 3/108 (2%)

            RF A   E R  +     PK  T    +VV  G+           P+ +  W K N PL 

                 + +E+   ++LE     + D G Y  ++ N  GKA     L +

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

            V+EG       KI G P P +TW K   P +P  +  V   +  N + V     L I   

             + D G+YT   VN  G AS    L++ G

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

             G    L   ++G P P++TW    +     AR       ++L I++A  ED G Y+   E

             N  G  + S  V V +K
Sbjct: 10988 NPAGSKTVSVKVLVLDK 11004

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 37/151 (24%), Positives = 56/151 (37%), Gaps = 10/151 (6%)

             A+N  G +S  +  T   +    K EY  P     PT          L +  G  + +  

             + + G P P+  W   G +I+ S+        T   L I+    +D G YT  A N  G 

                   +TV +      P  IS   +  A+L

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

             V  GS + + + +SG P P+V    +G  ++ +  F+ E      ++ ++E    D G Y

                A NS+G  +    ++ +  P   T P  IS

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 5/109 (4%)

             +AF   + +E P ++P    T    +++    GS    D  I G P P+V W  ++  ++

             E+    I   +D   +L + D    D  +Y     N+ G  T +  ++V

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

            NC+    G  D    N K S      P      + L+DV V  G+     C++S +    

            + W L GK L+ +  ++   EG + ++++     ED G  +  AK+

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 2/90 (2%)

             SG PKP+V+WF +   V  ++    +     +  L  +KA+  DSG Y     N+ G   

                 + V       V P SF  V KD  VI

 Score = 36.2 bits (82), Expect = 0.31
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

             ++  + G++  +   + G P PT+ WLR  K + +++   E+   +    L++K      

              GQY +   N  G  S  V++

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

            P   T L   V +EG +   +  IT   +  V W   N  +    +    +      L I

              VN +D  G Y C  +N SGK + SA+L++

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 37/186 (19%), Positives = 66/186 (35%), Gaps = 32/186 (17%)

            T S ++  + E    ++  +A N  G  + ++ L V                + D    P

             ++ R S+ G+           + VK G+       +TG P P++ W K    ++     

                +  VS       L I    ++D G YT    N  G    +  + +    S  R+  

Query: 261  VRETKA 266
            V + KA
Sbjct: 9201 VTDIKA 9206

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 1/75 (1%)

             G +V     I G P PT  W  DG  + K   H+ V  +     L +K       G+Y+I

Query: 795   LLKNRVGECSCQVSL 809
              + N  G  +  V L
Sbjct: 11279 TVSNAAGSKTVAVHL 11293

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

             EAP  +L P     L IK G T       + G P P+ +W + G+ I       +     

              +   + +A  + D G+YT  ATN  G +   V++TV

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 25/100 (25%), Positives = 39/100 (39%), Gaps = 16/100 (16%)

             G +  ++  V G P P +TW    Q ++  +       A    L+I + +  D G Y   

             A N +G+V     + VH+              P  PT PI
Sbjct: 14835 ARNIVGEVGDVITIQVHD-------------IPGPPTGPI 14861

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

             I+ G + +    ++G P P+V W +    I      ++D     T SLV+  V+  D GK

             YT    N SG +   V + V

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 3/91 (3%)

             P+  LP     +K     K +   +G P+  V W ++GQ +    R  +    +   SL 

             I    +ED G Y    +N +G+  +TV +T+

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

             +G P P V W KD++++     + I+ + D +  L I  V  +D  KY     N +GE

 Score = 35.8 bits (81), Expect = 0.40
 Identities = 20/106 (18%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

             +T    ++  +G  P  +    D+ + EGK L + C  + +P   + W+  G+ + + + 

                 +     L ++ I     +D GLY     N+ G    +  + +

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 47/231 (20%), Positives = 82/231 (35%), Gaps = 56/231 (24%)

            F + L ++ V+E   + L C+VS  P A +IW    + +  T    +  EG    + I+ 

            A  ED G Y C                                 R P S         +D
Sbjct: 6219 AHLEDAGNYNC---------------------------------RLPSS--------RTD 6237

              VK            +  + I  P++ ++  GE  E    ++  +     W +  K ++

              +   V        L +  A  +  G Y ++V    G+ +A  +LTV++K

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 16/82 (19%), Positives = 37/82 (45%)

             ++ ++ G+    + + +G+P+P+V+W K    +    R  +        LE     + D 

             G Y  +V N +G      ++++

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 25/96 (26%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

             KP   + L G+  L V  G  + +   V G P PEV W    +  ++  S     + R  

                  + +    D G Y   A N+AG     A + V

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 31/122 (25%), Positives = 47/122 (38%), Gaps = 9/122 (7%)

             +  +A+NA G +S  +  T      + K E  LP     P      +    + V  G   

              +   V G P P + WL    EI+ES     +    +  L +++    D G Y   A N 

Query: 701   AG 702
Sbjct: 17399 AG 17400

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 104/516 (20%), Positives = 179/516 (34%), Gaps = 49/516 (9%)

             + +K G   K    + G P P ++W ++G  I    R  +      T  L +      D 

             G+Y     N +G R V V   V        G   ++    ++ S     P  +    I  

                 K  T      + EG++   SCK+T         LKGN  +            +P  

              V++   +   V      LEI  V ++ + +  C     S   S  +   I+  +  +  

             +VR  K    D+R + T +      E ++ +  AA  S     S   R   P +     P

              PP + K+ +S K +   A   P+    +          + +       + S  G E   

                   A +  R      +G+ D  S +++ +I  E + +  F       ++  VK   +

                     G P P V W    T +R +   ++  +   S  L +  A   DSG Y+ T  

             N     S +  ++V          +   V K+ AV+

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

             + V++G + R +  I G+P P   W K    +   A ++ SE +    L I   ++ D G

              Y  ++ N  GK ++  ++ + G

 Score = 35.4 bits (80), Expect = 0.52
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

             P  +  +R   V  G   RF   ++  P  EV W+ +   ++ES   +I Y +  G  +L

              I D   DD   Y     N  GEA+  A L V

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

            F   + D++V E   A+F+C++   P     W K  Q I     F++  D   + S++I 

Query: 1820 DVCGDDDAKYTCKA 1833
                +D+AKY  +A
Sbjct: 5595 SAAFEDEAKYMFEA 5608

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

             R+VV  G + R    ++G+P P VTW      L   A +  +  +   V  I    +   

Query: 229   GVYTCLVVNGSGK 241
             GVY+ L  N +G+
Sbjct: 10286 GVYSLLAKNEAGE 10298

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

             ++ G   +    VRG P P+VTW + G    +  G   L+D        LVI     +D 

             GKY+    N +G + V V + V

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

             L V  G+    D  + G P P V W KD   ++ +   ++    +  C+L +  V   D 

               YT  A NS G  + T +L V

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

             VA     AP + L+GL DL  +  + S   + + + G P P V W    + +        

             E      +L + +    D G YT    N AG +  T ++  V +P   T P

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 24/99 (24%), Positives = 38/99 (38%), Gaps = 10/99 (10%)

             D + AP +   P+I          K G  +V        +  I G+P P+ +W K    +

             +PS    ++      +L I    + D G YT    N  G

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

             +V    G ++ +   I+G P P V   RDG  L K T  F      +  T+ LK+     

             AG+YEI   N  G     +++++

 Score = 35.0 bits (79), Expect = 0.68
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

             V+++   ++ V+K  A   G    L+  + G P P I W  + + +Q     C      +

             A + I+DA   + G Y     NA+G  S +  V + +K

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 46/173 (26%), Positives = 63/173 (36%), Gaps = 19/173 (10%)

            V   P+    W   G PV   +  +   E+ G  Y             Y   A N QG  

              S  T +++ +   E    F  V  L    V  G    L  +V G P P+ITW      

            + Q  R T E     + + I D+   D GTY   A N  G+ +    V V +K

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 16/67 (23%), Positives = 28/67 (41%)

             G    +   + G P P + W+    E+  +     +      SL +++    D+G Y  +

Query: 697   AWNSAGE 703
             A N AGE
Sbjct: 16313 AKNVAGE 16319

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 25/106 (23%), Positives = 42/106 (39%), Gaps = 4/106 (3%)

             +SK ++   P+  + +   P+    P+ ++   V   +T +   +V G P P + W L G

                  +    E+        L +  A   D G Y   ASN  G  S

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

             ++  AT +    ++G PEP+V W +    +T   +      +  +F+ LVI  V   D G

             +Y     N SG++   V + V

 Score = 34.7 bits (78), Expect = 0.89
 Identities = 23/93 (24%), Positives = 35/93 (37%), Gaps = 1/93 (1%)

             +KP          V      + D   +G P   V W KD Q+++E+    +   +    S

             L I +   +D   Y     NS G  T    +IV

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

            ++D  V E     F+C++      +  WF+++++I +S  + I   +D   +L I D   

            DD A Y     N  GE     A LIVE

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 33/146 (22%), Positives = 56/146 (38%), Gaps = 11/146 (7%)

            +A PK ++  Q   V   + +         PK E  WF E  P+  +  +I+   +  S 

               +L+A+  D G Y     N  G+      L+       V  L V E      S+  + 

             + +G   ++   V    + R TW+L

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 10/116 (8%)

            G+  L   S  +K  +S DPS +   PLT   AF+ P  +L   K+G        +    

               GYP P  TW    + + +G R  +   +     LVI      D+G YT +  N

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/85 (24%), Positives = 33/85 (38%), Gaps = 2/85 (2%)

             G + VK G   R    + G+P P+V W K      L  S RV +  +       +    +

              D G Y     N +G     A +++

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

             S+  + + V  G +AR     +G P PE+ W +++    +    ++  ++  N + +  D

              C  +DA KY  K  NS G

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 6/109 (5%)

             P  V    + E P + L  R    + +++G   +    ++G P P   W + GQ I+   

             R ++      T  LVI      D G Y     N  G + V +++ V GS

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

             +    G  + I   ++G P PTV W  + + L ++     +       ++V+K  Q  H 

Query: 790   GQYEILLKNRVGE 802
             G Y +L KN  GE
Sbjct: 10286 GVYSLLAKNEAGE 10298

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 30/120 (25%), Positives = 47/120 (39%), Gaps = 26/120 (21%)

             +RG PVP   W  +G  I   ++     +   + L I++ L  D G Y     NA G  +

              +  +TV +              P  PT PI         ++D +   MT  +S  PP +
Sbjct: 11289 VAVHLTVLD-------------VPGPPTGPI--------NILDVTPEHMT--ISWQPPKD 11325

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

             G A R +  + G P P + W KD + +  +   +I    D + +L+  D    D   YT 

Query: 1832  KAVNSLGEA 1840
              A N  G A
Sbjct: 15230 TATNPGGFA 15238

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 20/116 (17%)

             +P+ V   P  E    +LPP         + + I+   T +    ++G P P+V W R+ 

                   G  L    I  T S   L++  V+  D GKY     N SG++   V + V

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

             + +  G  + + V + G P PEV W     EI+++         T  SL +  V   D+G

Query: 692   TYTCEAWNSAG 702
              YT    NS+G
Sbjct: 16705 KYTLTLENSSG 16715

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 4/108 (3%)

             +++ P  V  + +T E     +P   + ++ G     E   +G P+P ++W ++G P+  

                F+         +L I    +E  GKYT    N     ++ V +TV

 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 17/109 (15%)

             + E++AE    ++P     I DLE+ +          G++ R    + G P P + W K 

              Q I  +    ID  E  +  LI+  V   D  KYT +A N  G+ + T

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

            F   + D  V EG  A F C++  +    VVWFK+D  +  SR   I   E     L + 

            +V  DD ++   +    + E + TA+L V

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

            F   ++D+   E  +A F  ++  + +  V WFK+DQ +  +R   +  DE    S+   

            D+  DD ++   +A+    EA  T

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 20/72 (27%), Positives = 32/72 (44%)

            TG P+P  TW  G+  L+   RV +   +    L I    + D G+YT  + N     S 

Query: 245  SAELSIQGLDSA 256
              ++++    SA
Sbjct: 7174 EIDVNVIARPSA 7185

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 27/116 (23%), Positives = 45/116 (38%), Gaps = 9/116 (7%)

            S IS+  ++ DP           P   L   ++ + EG         R  P P V+WH++

            G+ + +  R  +          V  +V   D G YT    N  G+   ++ + V G

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 24/99 (24%), Positives = 37/99 (37%), Gaps = 5/99 (5%)

             G    L+  VRG P P + W  +       RS        A  ++  +  A   D G Y 

               A N  G     A V V +K    ++  ++ V+  + T

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

             + L ++ G T +    V+G P P++TW +    +    R  LD  I+ T F   +    V

             ++ D GKY     N  G ++ T+ + V

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 36/123 (29%), Positives = 48/123 (39%), Gaps = 8/123 (6%)

             VK V     S  S S DP         E P F +     + L +K GA+       RG P

              P V W +    + +  R  +D     T SL I   +  D GKYT    N   A  +T+ 

Query: 121   LTV 123
             + V
Sbjct: 19967 VKV 19969

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 25/88 (28%), Positives = 35/88 (39%), Gaps = 7/88 (7%)

             S + K   V  G  F +    RG PVP + W    +P    R+       +    L I++

             A   D G YT   +N L   S +  V V

 Score = 33.5 bits (75), Expect = 2.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

             L V  G+  TMTV   G P P V+W     +++     + +   ++ SL I+     D+G

Query: 692   TYTCEAWN 699
              YT    N
Sbjct: 19949 KYTLTIQN 19956

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 50/246 (20%), Positives = 84/246 (34%), Gaps = 53/246 (21%)

            G  KL+     +  +LSV+  ++           I   R+L   E     FE  +  +  

              V W+   + I    ++ ++   +  + L +  + ++D GKYT  A    G    + +L

            TV G          +SK L D+                            V E Q   F 
Sbjct: 2570 TVAGG--------AISKPLTDQ---------------------------TVAESQEAVFE 2594

            C++   P  +  WL+    L  +  +        + L I     DD+G YT  V      

Query: 242  ASMSAE 247
            A +  E
Sbjct: 2654 AKLKVE 2659

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 32/135 (23%), Positives = 51/135 (37%), Gaps = 17/135 (12%)

            S T  +++E    + ++ +  L+ +++ K  VK              PYF+  + D   V

            E       C++    D  V WFKD + I  S  + I  D      L I      D  +Y 

Query: 1831 CKAVNSLGEATCTAE 1845
            C       +A  T E
Sbjct: 5428 CDCGTDKTKANVTVE 5442

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 30/150 (20%), Positives = 49/150 (32%), Gaps = 11/150 (7%)

            K EV W L    V  Q    ++  +   H L +   + RD G Y   A + + +      

                    +  AP   +  +D  V  G+   +       P     W    +P+       

             A      I +A   D G Y  + +N  G+

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

            + V  G+ + +   V+  P   I W+ N   + K T  + +++E      +   +SI KA

            + ED+G Y   A N  G    +  V V D P+

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

             R+  +  G   R    I+G P P+V W K+D+        +ID    G+  L I +   +

             D   Y+    N  G  T + +++V

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 19/115 (16%)

             +D  V++ G+   +   + G P+P I+W  +G  I+  R+  E    + H    ++D + 

              D G Y    +N  G  S +    V +K             P  P  P+ + GL+

 Score = 33.1 bits (74), Expect = 2.6
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

             ++ GA+ +     +G P P   W +    ++       D     +FS L +   +  D G

             KYT    N SG++ +T  + V

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

            + D +V EG   + + K+      E VW KD Q ++ S    I  D+  +  L+I D+  

            +D   Y+   + +LG +T

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 22/88 (25%), Positives = 33/88 (37%), Gaps = 8/88 (9%)

            G ++ +   +   P     W  +GK  K  K  +        L    +   + I +    

              G Y   AKN AGQ   +C+V V D P

 Score = 32.7 bits (73), Expect = 3.4
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 3/68 (4%)

             GS    D  + G P+P+++W K D+ +       + Y   G  +  +   C   D  KYT

Query: 1831  CKAVNSLG 1838
                 N+ G
Sbjct: 22815 LTVKNASG 22822

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

            ++LE++EG  A F C I  E +P   V W +DD+++     + +  D      L++ D  

              D   Y    V  +G A   A L V

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

             P+      AP  + L     L +  G    +T + SG P P+V W  +  ++ E +  H 

               + T  +L ++++  +  D+G Y     NS G

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

             KD  +++ G+ F L+  V G P P + W  +G+ ++   +  E  +A+    L  +D+  

Query: 576   EDHGTYTCLAENALG 590
              D G YT  A N  G
Sbjct: 15222 RDSGAYTLTATNPGG 15236

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 26/126 (20%), Positives = 51/126 (40%), Gaps = 25/126 (19%)

             G +  +   + G P+P++T   +G P++          AE   +++++++  D G Y   

             A N+ G       + V ++             P  PT P+ +  +++  V          

Query: 636   DGSQVT 641
Sbjct: 20293 GGSQVT 20298

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

             P   + L+    +K   G+ V +   +SG P P + W  +  E+Q +     E      S

             + I++    ++G Y  +  N+ G     A + VQ

 Score = 32.3 bits (72), Expect = 4.4
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 1/87 (1%)

             +P + + +  G   +    + G P P  +W   G  +    R  ++   +    L I   

                D G+YT E  N +G    T+++ +

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

            F++ ++D+   E  + A F+C+    P  +V W+KD   + E   +++  D   +  L I

              +   D   Y+C  V      T TA+LIVE

 Score = 32.0 bits (71), Expect = 5.8
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 21/119 (17%)

            W K G  V+        I + S M +I  ++  K   G+ +  + A  L +   VS   +