Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 116008190

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|116008190 myosin light chain kinase isoform 3B [Homo
sapiens]
         (1794 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|116008190 myosin light chain kinase isoform 3B [Homo sapiens]     3618   0.0  
gi|116008188 myosin light chain kinase isoform 2 [Homo sapiens]      3594   0.0  
gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]     3437   0.0  
gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]      3413   0.0  
gi|16950625 myosin light chain kinase isoform 8 [Homo sapiens]        313   1e-84
gi|16950623 myosin light chain kinase isoform 7 [Homo sapiens]        306   9e-83
gi|110349719 titin isoform N2-A [Homo sapiens]                        295   3e-79
gi|110349717 titin isoform novex-2 [Homo sapiens]                     295   3e-79
gi|110349713 titin isoform novex-1 [Homo sapiens]                     295   3e-79
gi|110349715 titin isoform N2-B [Homo sapiens]                        295   3e-79
gi|146219832 myosin light chain kinase 3 [Homo sapiens]               236   2e-61
gi|167466233 myosin light chain kinase family, member 4 [Homo sa...   221   6e-57
gi|14993776 skeletal myosin light chain kinase [Homo sapiens]         220   1e-56
gi|89363047 death-associated protein kinase 1 [Homo sapiens]          200   9e-51
gi|93102361 palladin [Homo sapiens]                                   193   1e-48
gi|4557511 death-associated protein kinase 3 [Homo sapiens]           191   5e-48
gi|14670383 death-associated kinase 2 [Homo sapiens]                  189   3e-47
gi|148839466 kalirin, RhoGEF kinase isoform 1 [Homo sapiens]          185   4e-46
gi|68362740 kalirin, RhoGEF kinase isoform 3 [Homo sapiens]           185   4e-46
gi|157785645 SPEG complex locus [Homo sapiens]                        166   1e-40
gi|4502557 calcium/calmodulin-dependent protein kinase IV [Homo ...   158   5e-38
gi|4502553 calcium/calmodulin-dependent protein kinase I [Homo s...   158   5e-38
gi|118572606 hemicentin 1 [Homo sapiens]                              155   3e-37
gi|9966875 calcium/calmodulin-dependent protein kinase ID isofor...   154   6e-37
gi|23943850 calcium/calmodulin-dependent protein kinase ID isofo...   154   6e-37
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   151   6e-36
gi|4758194 serine/threonine kinase 17B [Homo sapiens]                 147   1e-34
gi|109255245 serine/threonine kinase 17a [Homo sapiens]               147   1e-34
gi|27901803 protein serine kinase H1 [Homo sapiens]                   144   1e-33
gi|153792294 myopalladin [Homo sapiens]                               141   5e-33

>gi|116008190 myosin light chain kinase isoform 3B [Homo sapiens]
          Length = 1794

 Score = 3618 bits (9382), Expect = 0.0
 Identities = 1794/1794 (100%), Positives = 1794/1794 (100%)

Query: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60
            MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
Sbjct: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60

Query: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
            EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
Sbjct: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120

Query: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180
            LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
Sbjct: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180

Query: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240
            SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
Sbjct: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240

Query: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300
            KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
Sbjct: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300

Query: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG 360
            QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
Sbjct: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG 360

Query: 361  LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420
            LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP
Sbjct: 361  LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420

Query: 421  QSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLL 480
            QSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLL
Sbjct: 421  QSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLL 480

Query: 481  NGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKS 540
            NGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKS
Sbjct: 481  NGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKS 540

Query: 541  EYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF 600
            EYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF
Sbjct: 541  EYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF 600

Query: 601  HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRS 660
            HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRS
Sbjct: 601  HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRS 660

Query: 661  VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
            VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA
Sbjct: 661  VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720

Query: 721  GQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSL 780
            GQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSL
Sbjct: 721  GQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSL 780

Query: 781  RPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKT 840
            RPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKT
Sbjct: 781  RPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKT 840

Query: 841  LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPE 900
            LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPE
Sbjct: 841  LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPE 900

Query: 901  KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA 960
            KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA
Sbjct: 901  KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA 960

Query: 961  KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK 1020
            KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK
Sbjct: 961  KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK 1020

Query: 1021 RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE 1080
            RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE
Sbjct: 1021 RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE 1080

Query: 1081 GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS 1140
            GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS
Sbjct: 1081 GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS 1140

Query: 1141 LPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITC 1200
            LPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITC
Sbjct: 1141 LPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITC 1200

Query: 1201 TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVD 1260
            TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVD
Sbjct: 1201 TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVD 1260

Query: 1261 KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSF 1320
            KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSF
Sbjct: 1261 KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSF 1320

Query: 1321 NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDY 1380
            NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDY
Sbjct: 1321 NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDY 1380

Query: 1381 RTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQE 1440
            RTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQE
Sbjct: 1381 RTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQE 1440

Query: 1441 ISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQI 1500
            ISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQI
Sbjct: 1441 ISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQI 1500

Query: 1501 SEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVA 1560
            SEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVA
Sbjct: 1501 SEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVA 1560

Query: 1561 PEVINYEPIGYATDMWSIGVICYILNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM 1620
            PEVINYEPIGYATDMWSIGVICYILNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
Sbjct: 1561 PEVINYEPIGYATDMWSIGVICYILNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM 1620

Query: 1621 ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV 1680
            ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
Sbjct: 1621 ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV 1680

Query: 1681 AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD 1740
            AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
Sbjct: 1681 AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD 1740

Query: 1741 EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1794
            EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
Sbjct: 1741 EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1794


>gi|116008188 myosin light chain kinase isoform 2 [Homo sapiens]
          Length = 1845

 Score = 3594 bits (9320), Expect = 0.0
 Identities = 1794/1845 (97%), Positives = 1794/1845 (97%), Gaps = 51/1845 (2%)

Query: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60
            MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
Sbjct: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60

Query: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
            EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
Sbjct: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120

Query: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180
            LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
Sbjct: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180

Query: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240
            SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
Sbjct: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240

Query: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300
            KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
Sbjct: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300

Query: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG 360
            QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
Sbjct: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG 360

Query: 361  LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420
            LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP
Sbjct: 361  LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420

Query: 421  QSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLL 480
            QSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLL
Sbjct: 421  QSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLL 480

Query: 481  NGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKS 540
            NGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKS
Sbjct: 481  NGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKS 540

Query: 541  EYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF 600
            EYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF
Sbjct: 541  EYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF 600

Query: 601  HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRS 660
            HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRS
Sbjct: 601  HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRS 660

Query: 661  VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
            VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA
Sbjct: 661  VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720

Query: 721  GQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSL 780
            GQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSL
Sbjct: 721  GQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSL 780

Query: 781  RPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKT 840
            RPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKT
Sbjct: 781  RPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKT 840

Query: 841  LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPE 900
            LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPE
Sbjct: 841  LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPE 900

Query: 901  KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA 960
            KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA
Sbjct: 901  KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA 960

Query: 961  KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK 1020
            KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK
Sbjct: 961  KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK 1020

Query: 1021 RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE 1080
            RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE
Sbjct: 1021 RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE 1080

Query: 1081 GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS 1140
            GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS
Sbjct: 1081 GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS 1140

Query: 1141 LPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITC 1200
            LPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITC
Sbjct: 1141 LPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITC 1200

Query: 1201 TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVD 1260
            TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVD
Sbjct: 1201 TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVD 1260

Query: 1261 KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSF 1320
            KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSF
Sbjct: 1261 KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSF 1320

Query: 1321 NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDY 1380
            NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDY
Sbjct: 1321 NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDY 1380

Query: 1381 RTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQE 1440
            RTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQE
Sbjct: 1381 RTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQE 1440

Query: 1441 ISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQI 1500
            ISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQI
Sbjct: 1441 ISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQI 1500

Query: 1501 SEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVA 1560
            SEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVA
Sbjct: 1501 SEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVA 1560

Query: 1561 PEVINYEPIGYATDMWSIGVICYIL----------------------------------- 1585
            PEVINYEPIGYATDMWSIGVICYIL                                   
Sbjct: 1561 PEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEIS 1620

Query: 1586 ----------------NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTG 1629
                            NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTG
Sbjct: 1621 DDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTG 1680

Query: 1630 NAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP 1689
            NAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP
Sbjct: 1681 NAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP 1740

Query: 1690 YFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLII 1749
            YFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLII
Sbjct: 1741 YFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLII 1800

Query: 1750 SDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1794
            SDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
Sbjct: 1801 SDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1845


>gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]
          Length = 1863

 Score = 3437 bits (8911), Expect = 0.0
 Identities = 1739/1863 (93%), Positives = 1749/1863 (93%), Gaps = 69/1863 (3%)

Query: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60
            MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
Sbjct: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60

Query: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
            EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
Sbjct: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120

Query: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180
            LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
Sbjct: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180

Query: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240
            SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
Sbjct: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240

Query: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300
            KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
Sbjct: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300

Query: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRA-- 358
            QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRA  
Sbjct: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG 360

Query: 359  --------------------------PGLG---VLSPSGEERKRPAPPRPATFPTRQPGL 389
                                      PGLG   V+S +   R      R + FP  +   
Sbjct: 361  LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420

Query: 390  GSQDVV-SKAANRRIPMEGQRDSAFPKF-ESKPQ-----SQEVKENQTVKFRC------- 435
             SQ+V  ++    R  + G        F E  P      S EV E+    + C       
Sbjct: 421  QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR 480

Query: 436  ------------------------EGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT 471
                                    E LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
Sbjct: 481  DSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT 540

Query: 472  PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 531
            PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
Sbjct: 541  PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 600

Query: 532  HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG 591
            HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
Sbjct: 601  HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG 660

Query: 592  NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ 651
            NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
Sbjct: 661  NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ 720

Query: 652  PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV 711
            PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
Sbjct: 721  PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV 780

Query: 712  LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG 771
            LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
Sbjct: 781  LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG 840

Query: 772  GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL 831
            GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
Sbjct: 841  GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL 900

Query: 832  LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK 891
            LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
Sbjct: 901  LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK 960

Query: 892  GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS 951
            GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
Sbjct: 961  GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS 1020

Query: 952  GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG 1011
            GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
Sbjct: 1021 GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG 1080

Query: 1012 HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT 1071
            HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT
Sbjct: 1081 HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT 1140

Query: 1072 TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE 1131
            TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
Sbjct: 1141 TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE 1200

Query: 1132 MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK 1191
            MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
Sbjct: 1201 MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK 1260

Query: 1192 VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ 1251
            VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
Sbjct: 1261 VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ 1320

Query: 1252 AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
            AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
Sbjct: 1321 AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1380

Query: 1312 LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1371
            LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
Sbjct: 1381 LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1440

Query: 1372 DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA 1431
            DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
Sbjct: 1441 DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA 1500

Query: 1432 KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER 1491
            KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
Sbjct: 1501 KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER 1560

Query: 1492 ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV 1551
            ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
Sbjct: 1561 ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV 1620

Query: 1552 LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILNRLDCTQCLQHPWLMKDTKNMEAKKL 1611
            LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILNRLDCTQCLQHPWLMKDTKNMEAKKL
Sbjct: 1621 LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILNRLDCTQCLQHPWLMKDTKNMEAKKL 1680

Query: 1612 SKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEED 1671
            SKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEED
Sbjct: 1681 SKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEED 1740

Query: 1672 VSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRE 1731
            VSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRE
Sbjct: 1741 VSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRE 1800

Query: 1732 SRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEE 1791
            SRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEE
Sbjct: 1801 SRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEE 1860

Query: 1792 EEE 1794
            EEE
Sbjct: 1861 EEE 1863


>gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]
          Length = 1914

 Score = 3413 bits (8849), Expect = 0.0
 Identities = 1739/1914 (90%), Positives = 1749/1914 (91%), Gaps = 120/1914 (6%)

Query: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60
            MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
Sbjct: 1    MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60

Query: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
            EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
Sbjct: 61   EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120

Query: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180
            LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
Sbjct: 121  LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF 180

Query: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240
            SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
Sbjct: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240

Query: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300
            KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
Sbjct: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300

Query: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRA-- 358
            QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRA  
Sbjct: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG 360

Query: 359  --------------------------PGLG---VLSPSGEERKRPAPPRPATFPTRQPGL 389
                                      PGLG   V+S +   R      R + FP  +   
Sbjct: 361  LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420

Query: 390  GSQDVV-SKAANRRIPMEGQRDSAFPKF-ESKPQ-----SQEVKENQTVKFRC------- 435
             SQ+V  ++    R  + G        F E  P      S EV E+    + C       
Sbjct: 421  QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR 480

Query: 436  ------------------------EGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT 471
                                    E LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
Sbjct: 481  DSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT 540

Query: 472  PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 531
            PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
Sbjct: 541  PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 600

Query: 532  HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG 591
            HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
Sbjct: 601  HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG 660

Query: 592  NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ 651
            NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
Sbjct: 661  NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ 720

Query: 652  PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV 711
            PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
Sbjct: 721  PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV 780

Query: 712  LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG 771
            LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
Sbjct: 781  LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG 840

Query: 772  GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL 831
            GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
Sbjct: 841  GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL 900

Query: 832  LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK 891
            LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
Sbjct: 901  LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK 960

Query: 892  GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS 951
            GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
Sbjct: 961  GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS 1020

Query: 952  GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG 1011
            GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
Sbjct: 1021 GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG 1080

Query: 1012 HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT 1071
            HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT
Sbjct: 1081 HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT 1140

Query: 1072 TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE 1131
            TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
Sbjct: 1141 TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE 1200

Query: 1132 MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK 1191
            MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
Sbjct: 1201 MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK 1260

Query: 1192 VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ 1251
            VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
Sbjct: 1261 VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ 1320

Query: 1252 AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
            AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
Sbjct: 1321 AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1380

Query: 1312 LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1371
            LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
Sbjct: 1381 LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1440

Query: 1372 DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA 1431
            DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
Sbjct: 1441 DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA 1500

Query: 1432 KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER 1491
            KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
Sbjct: 1501 KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER 1560

Query: 1492 ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV 1551
            ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
Sbjct: 1561 ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV 1620

Query: 1552 LFGTPEFVAPEVINYEPIGYATDMWSIGVICYIL-------------------------- 1585
            LFGTPEFVAPEVINYEPIGYATDMWSIGVICYIL                          
Sbjct: 1621 LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF 1680

Query: 1586 -------------------------NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM 1620
                                     NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
Sbjct: 1681 DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM 1740

Query: 1621 ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV 1680
            ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
Sbjct: 1741 ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV 1800

Query: 1681 AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD 1740
            AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
Sbjct: 1801 AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD 1860

Query: 1741 EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1794
            EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
Sbjct: 1861 EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1914


>gi|16950625 myosin light chain kinase isoform 8 [Homo sapiens]
          Length = 154

 Score =  313 bits (802), Expect = 1e-84
 Identities = 154/154 (100%), Positives = 154/154 (100%)

Query: 1641 MAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV 1700
            MAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV
Sbjct: 1    MAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV 60

Query: 1701 VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY 1760
            VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY
Sbjct: 61   VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY 120

Query: 1761 TCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1794
            TCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
Sbjct: 121  TCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 154



 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 36/92 (39%), Positives = 51/92 (55%)

Query: 33  PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
           P F    R+L + EG+ A+F+ ++ GYP+P+V W ++ Q I     F +D    G  SL+
Sbjct: 49  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 108

Query: 93  IHAVHEEDRGKYTCEATNGSGARQVTVELTVE 124
           I  V  +D  KYTC+A N  G    T EL VE
Sbjct: 109 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 140



 Score = 68.6 bits (166), Expect = 5e-11
 Identities = 40/119 (33%), Positives = 58/119 (48%), Gaps = 2/119 (1%)

Query: 533 EKKSSRKSEYLLPVAPSKP-TAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG 591
           E +      +L  VA  KP   P F + + DL+V++GS      ++ G P PEV+W  + 
Sbjct: 27  ESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 86

Query: 592 NEIQESEDFHFE-QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDG 649
             I+ES  F  +       SL I +V  +D   YTC+A NS GE    A L V+   +G
Sbjct: 87  QSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEG 145



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 144 FSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQP 203
           F     E +P +     P F+  +  + V EG   RF CKI G P P+V W K +  ++ 
Sbjct: 36  FLEAVAEEKPHV----KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRE 91

Query: 204 SARVSVS-EKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLD 254
           S    +  +++G   L I  V  DD   YTC  VN  G+A+ +AEL ++ ++
Sbjct: 92  SRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 143



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 443 VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYAR----STCEAGVAE 498
           V P FS  ++D  V+EG      C + G P P + W  + Q I+ +R       E G   
Sbjct: 47  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 106

Query: 499 LHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 531
           L I D   +D   YTC A N+LG+ +C+A + V
Sbjct: 107 LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 139



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 1023 ESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTK-FIILSQEG 1081
            E     P F + ++D+ V EG      C++   P   ++W  + ++++ ++ F I   E 
Sbjct: 43   EKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 102

Query: 1082 SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASE 1125
              CS+ I     +D   Y C A N  G+A C+ ++ V+     E
Sbjct: 103  GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGE 146



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 2/124 (1%)

Query: 621 TGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPF 680
           T     E   S  +V    +  V E     +P+F    R +    G +    C I G P 
Sbjct: 18  TSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPD 77

Query: 681 PTVHWLRDGKALCKDTGHFEVLQNED-VFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS 739
           P V W +D +++ +++ HF++  +ED   +L++  V      +Y     N +GE +C   
Sbjct: 78  PEVVWFKDDQSI-RESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAE 136

Query: 740 LMLQ 743
           L+++
Sbjct: 137 LIVE 140



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 1164 KAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENG 1223
            K  + P   +   D +V  G +     K+ G       W K  + I+ES H +++  E+G
Sbjct: 44   KPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG 103

Query: 1224 SKLTILAARQEHCG----CYTLLVENKLGSRQAQVNLTV 1258
            +   I++   + CG     YT    N LG       L V
Sbjct: 104  NCSLIIS---DVCGDDDAKYTCKAVNSLGEATCTAELIV 139


>gi|16950623 myosin light chain kinase isoform 7 [Homo sapiens]
          Length = 153

 Score =  306 bits (785), Expect = 9e-83
 Identities = 153/154 (99%), Positives = 153/154 (99%), Gaps = 1/154 (0%)

Query: 1641 MAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEV 1700
            MAMISGLSGRKSSTGSPTSPLNAEKLESE DVSQAFLEAVAEEKPHVKPYFSKTIRDLEV
Sbjct: 1    MAMISGLSGRKSSTGSPTSPLNAEKLESE-DVSQAFLEAVAEEKPHVKPYFSKTIRDLEV 59

Query: 1701 VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY 1760
            VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY
Sbjct: 60   VEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY 119

Query: 1761 TCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 1794
            TCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE
Sbjct: 120  TCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE 153



 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 36/92 (39%), Positives = 51/92 (55%)

Query: 33  PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
           P F    R+L + EG+ A+F+ ++ GYP+P+V W ++ Q I     F +D    G  SL+
Sbjct: 48  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 107

Query: 93  IHAVHEEDRGKYTCEATNGSGARQVTVELTVE 124
           I  V  +D  KYTC+A N  G    T EL VE
Sbjct: 108 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 139



 Score = 67.8 bits (164), Expect = 9e-11
 Identities = 39/110 (35%), Positives = 56/110 (50%), Gaps = 2/110 (1%)

Query: 542 YLLPVAPSKP-TAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF 600
           +L  VA  KP   P F + + DL+V++GS      ++ G P PEV+W  +   I+ES  F
Sbjct: 35  FLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHF 94

Query: 601 HFE-QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDG 649
             +       SL I +V  +D   YTC+A NS GE    A L V+   +G
Sbjct: 95  QIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEG 144



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 37/119 (31%), Positives = 59/119 (49%), Gaps = 5/119 (4%)

Query: 137 SKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLK 196
           S+ +   F     E +P +     P F+  +  + V EG   RF CKI G P P+V W K
Sbjct: 28  SEDVSQAFLEAVAEEKPHV----KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFK 83

Query: 197 GNVPLQPSARVSVS-EKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLD 254
            +  ++ S    +  +++G   L I  V  DD   YTC  VN  G+A+ +AEL ++ ++
Sbjct: 84  DDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 142



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 443 VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYAR----STCEAGVAE 498
           V P FS  ++D  V+EG      C + G P P + W  + Q I+ +R       E G   
Sbjct: 46  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 105

Query: 499 LHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 531
           L I D   +D   YTC A N+LG+ +C+A + V
Sbjct: 106 LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 138



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 1023 ESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTK-FIILSQEG 1081
            E     P F + ++D+ V EG      C++   P   ++W  + ++++ ++ F I   E 
Sbjct: 42   EKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 101

Query: 1082 SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASE 1125
              CS+ I     +D   Y C A N  G+A C+ ++ V+     E
Sbjct: 102  GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGE 145



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 4/101 (3%)

Query: 644 QEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQ 703
           ++PH   +P+F    R +    G +    C I G P P V W +D +++ +++ HF++  
Sbjct: 42  EKPH--VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSI-RESRHFQIDY 98

Query: 704 NED-VFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
           +ED   +L++  V      +Y     N +GE +C   L+++
Sbjct: 99  DEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 139



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 7/99 (7%)

Query: 1164 KAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENG 1223
            K  + P   +   D +V  G +     K+ G       W K  + I+ES H +++  E+G
Sbjct: 43   KPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG 102

Query: 1224 SKLTILAARQEHCG----CYTLLVENKLGSRQAQVNLTV 1258
            +   I++   + CG     YT    N LG       L V
Sbjct: 103  NCSLIIS---DVCGDDDAKYTCKAVNSLGEATCTAELIV 138


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score =  295 bits (755), Expect = 3e-79
 Identities = 217/812 (26%), Positives = 353/812 (43%), Gaps = 130/812 (16%)

Query: 1028  APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTT--KFIILSQEGSLCS 1085
             AP FK++L++++V       L C+V+  P   + W   GK +     K+ I   +G    
Sbjct: 30927 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQ 30986

Query: 1086  VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVL 1145
             + I     +D  +Y+  A N  G    +  + V+                          
Sbjct: 30987 LIIASVTDDDATVYQVRATNQGGSVSGTASLEVE-------------------------- 31020

Query: 1146  GTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF 1205
                             P K  +P  +        +R GE V +    +G      TW K 
Sbjct: 31021 ---------------VPAKIHLPKTLEGMGAVHALR-GEVVSIKIPFSGKPDPVITWQKG 31064

Query: 1206  RKQIQESEHMKVENSENGSKLTIL-AARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP 1264
             +  I  + H +V  + + + L       ++  G Y +  +N+ G  Q  V L V D PDP
Sbjct: 31065 QDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDP 31124

Query: 1265  PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQD 1324
             P G    SD+   S+ L+W   + DGGS + +Y +E   +  + W  +   R T + V +
Sbjct: 31125 PRGVK-VSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETRYTVIN 31183

Query: 1325  LLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVT 1384
             L     Y+FRV A N +G S+PS+ SE T   E      +  E  D+     EV     +
Sbjct: 31184 LFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETR---EVSMTKAS 31240

Query: 1385  INTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIM 1444
              ++ +++ + Y I E LG G+FG V R VE  ++K +  KF K     ++  +++EISI+
Sbjct: 31241 HSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKV-KGTDQVLVKKEISIL 31299

Query: 1445  NCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGV 1504
             N   H  ++   ++FE    +VM+ E +SG ++FERI    FEL ERE + Y+ Q+ E +
Sbjct: 31300 NIARHRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEAL 31359

Query: 1505  EYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVI 1564
             +++H   I H D++PENI+   +  + IK+I+FG AR+L+   + ++LF  PE+ APEV 
Sbjct: 31360 QFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVH 31419

Query: 1565  NYEPIGYATDMWSIGVICYIL--------------------------------------- 1585
              ++ +  ATDMWS+G + Y+L                                       
Sbjct: 31420 QHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKEISIEAM 31479

Query: 1586  ------------NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVR 1633
                         +R+  ++ LQHPWL +  + +  K +   + ++Y      +K  N V 
Sbjct: 31480 DFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYY-HTLIKKDLNMVV 31538

Query: 1634  AIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSK 1693
             +  R+S    I      +S  G   + +    +E    VS   + AV EE  HVK     
Sbjct: 31539 SAARISCGGAI------RSQKGVSVAKVKVASIEI-GPVSGQIMHAVGEEGGHVK----- 31586

Query: 1694  TIRDLEVVEGSAARFDCKIEGY-PDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDV 1752
                           + CKIE Y    +V W+   + +  S  ++I Y EDG   L + D+
Sbjct: 31587 --------------YVCKIENYDQSTQVTWYFGVRQLENSEKYEITY-EDGVAILYVKDI 31631

Query: 1753  CGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
                DD  Y CK VN  GE +  AEL V+ + E
Sbjct: 31632 TKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE 31663



 Score =  179 bits (455), Expect = 2e-44
 Identities = 269/1226 (21%), Positives = 462/1226 (37%), Gaps = 191/1226 (15%)

Query: 31   EAPA-FILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF 89
            +APA F+    +  I++G     EG   G P   VTW +NG  +T   R    C I  T 
Sbjct: 7865 KAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQR----CNITTTE 7920

Query: 90   SLVIHAVHE---EDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSA 146
               I  +     ED G+Y C   N SG    + ++ +                       
Sbjct: 7921 KSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILE--------------------- 7959

Query: 147  PAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSAR 206
                         PP F  +L  V V  G      C++ G P+  V+W KG+  L+P+  
Sbjct: 7960 -------------PPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTT 8006

Query: 207  VSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKA 266
              +  +N +  L  + V+ +D G Y C   N  G+ S S  L++Q       SF R+ + 
Sbjct: 8007 YKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQE-QKLPPSFSRQLR- 8064

Query: 267  TNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCK 326
               DV++ V   +  +  +   E  + S             W  + +P     +   S  
Sbjct: 8065 ---DVQETVGLPVVFDCAISGSEPISVS-------------WYKDGKPLKDSPNVQTSFL 8108

Query: 327  DSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGE----ERKRP-------A 375
            D+  T      + KT  S+  Q +     P    +G  S S      E K P       A
Sbjct: 8109 DNTATLN----IFKTDRSLAGQYSCTATNP----IGSASSSARLILTEGKNPPFFDIRLA 8160

Query: 376  PP-----RPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQT 430
            P        A F     G     V     +R I   G+   ++ +  +     +V +  +
Sbjct: 8161 PVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDS 8220

Query: 431  VKFRCEGLAVMEVA----------------PSFSSVLKDCAV-IEGQDFVLQCSVRGTPV 473
             ++ C   AV EV                 PSF+  L +     EG  F L+  V G+  
Sbjct: 8221 GQYTC--YAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQP 8278

Query: 474  PRITWLLNG---QPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVT 530
              + W  N    QP      T +     L ++ A   D G YTC   N  G   C++ + 
Sbjct: 8279 ITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIV 8338

Query: 531  VHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHN 590
            + E              P KP  P+F Q L+ + V +G  V ++  V G+ P  + WL  
Sbjct: 8339 IKE--------------PKKP--PVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKA 8382

Query: 591  GNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPH--- 647
            G EI+ S+   F        L +++V   D+G Y C+A N AG   T++ +T+++     
Sbjct: 8383 GREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVA 8442

Query: 648  --------DGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHF 699
                    DG + +F+S+P+S+      +      + GDP P V W +         G  
Sbjct: 8443 PATKKAAVDG-RLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRV 8501

Query: 700  EVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRG--REPA 757
             + Q  D   L ++      +G Y  +  N  GE    V+L +     +    G  R   
Sbjct: 8502 FIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAML 8561

Query: 758  SCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEA 817
                +   G G +    D    L+   P   + +       D RG+L+     +Q  EE 
Sbjct: 8562 KKTPILKKGAGEE-EEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEE 8620

Query: 818  IRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPK---TVSEEER 874
              + E+E+++ R    +K   + +S    +    E +    +++ Q   K    V E + 
Sbjct: 8621 THRLEIEEIE-RSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDI 8679

Query: 875  KVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAEN----GSSS 930
            K++ P+      +   KGT K          +P+     S+ G +  L  +N       +
Sbjct: 8680 KINYPE----IKLSWYKGTEKL---------EPSDKFEISIDGDRHTLRVKNCQLKDQGN 8726

Query: 931  AETLNAKAVESSKPLSNAQPSGP--LKPVGNAKPAETLK-----PMGNAKP-----AETL 978
               +    + S+K L+  +P+    L+ V   K  +T        + N K         L
Sbjct: 8727 YRLVCGPHIASAK-LTVIEPAWERHLQDV-TLKEGQTCTMTCQFSVPNVKSEWFRNGRIL 8784

Query: 979  KPMGNAKP--DENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQ 1036
            KP G  K   +  +   +  +++ + +    CK      T  E R E++     F +++Q
Sbjct: 8785 KPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDL-ETSAELRIEAEPI--QFTKRIQ 8841

Query: 1037 DVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDR 1096
            ++ V+E +    +C+VS D  A + W      L  ++      +G    ++I    P+D 
Sbjct: 8842 NIVVSEHQSATFECEVSFD-DAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDE 8900

Query: 1097 GLYKCVAK-NDAGQAECSCQVTVDDAPASENTKAPEM-KSRRPKSSLPPVLGTESDATVK 1154
            G+Y  +A+    G+A  + ++ +         K P++  SR P  ++P          ++
Sbjct: 8901 GVYSVIARLEPRGEARSTAELYLTTKEIKLELKPPDIPDSRVPIPTMP----------IR 8950

Query: 1155 KKPAPKTPPKAAMP-PQIIQFPEDQK 1179
              P  + PP  A P P ++  PE++K
Sbjct: 8951 AVPPEEIPPVVAPPIPLLLPTPEEKK 8976



 Score =  175 bits (444), Expect = 3e-43
 Identities = 200/781 (25%), Positives = 316/781 (40%), Gaps = 138/781 (17%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G     AS+ +   S S   +R+ +    ++P F + P ++ +  G +A FE  V G   
Sbjct: 6243 GQYSCSASNPLGTASSS---ARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQP 6299

Query: 62   PQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
             ++TW ++ + I  GG + + C +  T  L I  V + D G+YTC+ATN  G    + +L
Sbjct: 6300 MRITWSKDNKEIRPGGNYTITC-VGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQL 6358

Query: 122  TVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKL-GRVVVKEGQMGRF 180
            +V+                                   PPKF  KL    V K+G+  + 
Sbjct: 6359 SVKE----------------------------------PPKFVKKLEASKVAKQGESIQL 6384

Query: 181  SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVN--G 238
             CKI+G P+ +V+W + +  L  S + ++S  N + +L I+  + +D G Y C   N  G
Sbjct: 6385 ECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG 6444

Query: 239  SGKASMSAELSIQGLDSANRSFVRETKATNSDV-------------------RKEVTNVI 279
                S +  +    + +   S V   K   SDV                   RK+V N  
Sbjct: 6445 DASCSTALTVKAPPVFTQKPSPVGALKG--SDVILQCEISGTPPFEVVWVKDRKQVRN-- 6500

Query: 280  SKESKLDS--LEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPV 337
            SK+ K+ S   + +    N  +   G     A N       E   ++C  S +       
Sbjct: 6501 SKKFKITSKHFDTSLHILNLEASDVGEYHCKATN-------EVGSDTCSCSVKFKEPPRF 6553

Query: 338  LQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSK 397
            ++K S + TL    V+      G   +S    + +                    +V+ +
Sbjct: 6554 VKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRG-------------------EVIRE 6594

Query: 398  AANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCE--GLAVMEVAPSFSSVLKDCA 455
            + N RI        +F    +  Q    + + + K+ C+    A M    +  +VL+   
Sbjct: 6595 SENTRI--------SFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPAR 6646

Query: 456  VIE---------GQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGVAELHIQD 503
            +IE         G  F L+C V GTP     W  +G+ +        T    VA L I  
Sbjct: 6647 IIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPC 6706

Query: 504  ALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDL 563
            A   D G Y+   +N++G+ +C+  V+VH       S+ ++P        P F++ L D+
Sbjct: 6707 AEMSDKGLYSFEVKNSVGKSNCT--VSVHV------SDRIVP--------PSFIRKLKDV 6750

Query: 564  KVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGT 623
              + G+ V +  +VSG+ P  V W  +GNEI               +L +  + P DTG 
Sbjct: 6751 NAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGI 6810

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
            YTC A N AG     AVLTVQEP     P F   P SV    G S+  +  I G P   V
Sbjct: 6811 YTCVAANVAGSDECSAVLTVQEP-----PSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKV 6865

Query: 684  HWLRDGKALCKDTGHFEVLQNEDVFT-LVLKKVQPWHAGQYEILLKNRVGECSCQVSLML 742
             W +  + L    G    +  ED  T L L +VQP  +G Y  L+ N  G  SC   L +
Sbjct: 6866 KWFKGSRELVP--GESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFV 6923

Query: 743  Q 743
            +
Sbjct: 6924 K 6924



 Score =  166 bits (420), Expect = 2e-40
 Identities = 161/707 (22%), Positives = 277/707 (39%), Gaps = 57/707 (8%)

Query: 63    QVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELT 122
             +VTW+++G+ +   G F       GT+ L I+ + E D+G+Y CE +   G  +  ++  
Sbjct: 32748 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 32807

Query: 123   VEG-----------SFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVV 171
              +            S  K+  Q     T+  +    A E   S      P   T L    
Sbjct: 32808 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISS-----KPVIVTGLQDTT 32862

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             V    + +F+ K TG P+P   W K    +    +  +SE  G   LEIH  +  D G+Y
Sbjct: 32863 VSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLY 32922

Query: 232   TCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAA 291
             TC V N +G  S S +L+I+ +       V   K   S++  +   V+ +E      + A
Sbjct: 32923 TCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQK--TSEITPQKKAVVQEEIS----QKA 32976

Query: 292   AKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQK--TSSSITLQA 349
              +S+     +       A   +      S  E  K S  T+ +  ++ +  T +S   + 
Sbjct: 32977 LRSEEIKMSEAKSQEKLALKEEASKVLIS--EEVKKSAATSLEKSIVHEEITKTSQASEE 33034

Query: 350   ARVQPEPRAPGLGVLSPSGEERKRPAPPRPAT---FPTRQPGLGSQD-----VVSKAANR 401
              R   E +A    +    G+     A    AT   +      L + +     V       
Sbjct: 33035 VRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTL 33094

Query: 402   RIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQD 461
              I     RD       SK +   VK    +    E    +  AP+F S  +   + EGQ+
Sbjct: 33095 TIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKE----LSDAPAFISQPRSQNINEGQN 33150

Query: 462   FVLQCSVRGTPVPRITWLLNGQPIQYARSTC---EAGVAELHIQDALPEDHGTYTCLAEN 518
              +  C + G P P I W  N  PI  + +        V  L I++A   D G YT  A+N
Sbjct: 33151 VLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKN 33210

Query: 519   ALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVS 578
               GQ S +A            S  +LP+   +P+  + L+   D   + GS  + +VQ+S
Sbjct: 33211 FRGQCSATA------------SLMVLPLV-EEPSREVVLRTSGDTS-LQGSFSSQSVQMS 33256

Query: 579   GNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQ 638
              +         + +      +  F     Q    +QE F E + +      N   ++ + 
Sbjct: 33257 ASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT-QLESS 33315

Query: 639   AVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL-CKDTG 697
                 ++    G  P   + P  ++   G+ + ++CA  G+P P V W   G+ +  ++ G
Sbjct: 33316 TSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQG 33375

Query: 698   HFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQN 744
              F +   +D+ TL++  VQ    G Y + L N  G  S  V++ +++
Sbjct: 33376 RFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS 33422



 Score =  153 bits (387), Expect = 1e-36
 Identities = 166/748 (22%), Positives = 293/748 (39%), Gaps = 111/748 (14%)

Query: 27   MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
            + + E P+F++ P        +T +F+  ++G P  ++ W ++   + SG +  +  G+ 
Sbjct: 5324 LTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFI--GLE 5381

Query: 87   GTFSLV-IHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFS 145
            G+ S + +++V     G+YTC  TN  G+   T  L V                      
Sbjct: 5382 GSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTE-------------------- 5421

Query: 146  APAVETRPSIWGECPPKFATKL-GRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS 204
                          PPKF  KL    +VK G   R  CKI G P+ +V W +    L  S
Sbjct: 5422 --------------PPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPAS 5467

Query: 205  ARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRET 264
             +  ++  + + V++++ ++ +D G + C   N +G                       T
Sbjct: 5468 DKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGS----------------------T 5505

Query: 265  KATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAA-----NSQPQPPRE 319
              +   + KE     S    +++L+ A  S  C   +  G+PP+         Q +  ++
Sbjct: 5506 SCSTKVIVKEPPVFSSFPPIVETLKNAEVSLEC---ELSGTPPFEVVWYKDKRQLRSSKK 5562

Query: 320  SKLES-----------CKDSPRTAPQTPVLQKTSSSITLQAARVQPEPR-APGLGVLSP- 366
             K+ S              S           +  S   +   +++  PR    L  L+  
Sbjct: 5563 YKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVV 5622

Query: 367  SGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIP-MEGQRDSAFPKFESKPQSQ-- 423
            +GE  +  A    A     Q     ++V+ ++ N RI  +E      F K E     +  
Sbjct: 5623 AGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKAEPANAGKYI 5682

Query: 424  -EVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNG 482
             ++K +  ++     L V+E A           V  G+   L+C V GTP   + W  +G
Sbjct: 5683 CQIKNDGGMRENMATLMVLEPAVIVEKA-GPMTVTVGETCTLECKVAGTPELSVEWYKDG 5741

Query: 483  QPI---QYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRK 539
            + +   Q  + +    ++ L I     +D GTYT   +N +G+ SC+A V V ++     
Sbjct: 5742 KLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRA---- 5797

Query: 540  SEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED 599
                          P F + L +   + G+   +  +V+G+ P  V W H   +I     
Sbjct: 5798 ------------VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAK 5845

Query: 600  FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPR 659
            +         +L +  +   D G YTC A N AG    +AVLTVQEP     P F+ +P 
Sbjct: 5846 YQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEP-----PSFVKEPE 5900

Query: 660  SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             +    G++V  +  I G P   V+W R  + L K      +   + V  L L  +    
Sbjct: 5901 PLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKG-DRCNIYFEDTVAELELFNIDISQ 5959

Query: 720  AGQYEILLKNRVGECSCQVSLMLQNSSA 747
            +G+Y  ++ N  G+ SC   L ++  +A
Sbjct: 5960 SGEYTCVVSNNAGQASCTTRLFVKEPAA 5987



 Score =  152 bits (385), Expect = 2e-36
 Identities = 165/737 (22%), Positives = 270/737 (36%), Gaps = 107/737 (14%)

Query: 27   MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
            M +  AP        L +  G  AKF   ++  P  +  W + G+ I    +    C IR
Sbjct: 3450 MEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDK----CSIR 3505

Query: 87   GT---FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR 143
             +    SL I      D G+YTC+A+N  G+   T  LTV  ++                
Sbjct: 3506 SSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAY---------------- 3549

Query: 144  FSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQP 203
                            PP F ++   +    G+  +F C +TG P  +  W K    L P
Sbjct: 3550 ----------------PPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSP 3593

Query: 204  SARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRE 263
            S    +S+     +LE+  +   D GVY+C   N  G     AEL I  +D  +  F++E
Sbjct: 3594 SPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELII--IDKPH--FIKE 3649

Query: 264  TKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLE 323
             +   S + K+V      E ++D               R  +  W+ + Q  PP +   +
Sbjct: 3650 LEPVQSAINKKV----HLECQVDE-------------DRKVTVTWSKDGQKLPPGKD-YK 3691

Query: 324  SCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVL---SPSGEERKRPA----P 376
             C +      + P+ +   S   +  A  +    +    V     PS  ++  P+    P
Sbjct: 3692 ICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLP 3751

Query: 377  PRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCE 436
               A    +  G     V     N+ +         F   E+     +VK   +  + CE
Sbjct: 3752 GESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCE 3811

Query: 437  GL-----------AVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI 485
             +            V++  PSF   L+   ++ G + +LQC V GT    I+W  + + I
Sbjct: 3812 AVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQI 3871

Query: 486  QYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEY 542
            + +   R   +  +  L I      D G Y C+  N +G+  C A   + E         
Sbjct: 3872 RSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLKE--------- 3922

Query: 543  LLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHF 602
                       P F++ + DL  + G  VT+   V G+ P  V W+     I+E      
Sbjct: 3923 ----------PPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKM 3972

Query: 603  EQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVT 662
                    L I +V     G YTC A N AG   +   L V+EP        I +   + 
Sbjct: 3973 SFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAK-----IIERAELIQ 4027

Query: 663  ASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQ 722
             + G    +   +AG P     W +DG+ L   +  + +    +V  L     +   +GQ
Sbjct: 4028 VTAGDPATLEYTVAGTPELKPKWYKDGRPLVA-SKKYRISFKNNVAQLKFYSAELHDSGQ 4086

Query: 723  YEILLKNRVGECSCQVS 739
            Y   + N VG  SC+ +
Sbjct: 4087 YTFEISNEVGSSSCETT 4103



 Score =  152 bits (385), Expect = 2e-36
 Identities = 171/747 (22%), Positives = 288/747 (38%), Gaps = 123/747 (16%)

Query: 29   LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
            L E P+FI    N      ++A F+  V G P   +TW ++ Q +       +   +   
Sbjct: 5044 LKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISF-VDSV 5102

Query: 89   FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPA 148
             +L I +V     G+YTC+A N SG  +    L V+                        
Sbjct: 5103 ATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQE----------------------- 5139

Query: 149  VETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVS 208
                       P +   K   V V E       C + G P+ +V WLK    + PS   S
Sbjct: 5140 -----------PAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFS 5188

Query: 209  VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLD-SANRSFVRETKAT 267
            +S +N +    I  V + D G YT  V N  G  S S +  ++ LD +   SF +  K T
Sbjct: 5189 MSFENNVASFRIQSVMKQDSGQYTFKVENDFG--SSSCDAYLRVLDQNIPPSFTK--KLT 5244

Query: 268  NSDVRKEVTNVISKESKLD-SLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCK 326
              D  K + + I  E K+  SL  +A+              W  + +           C 
Sbjct: 5245 KMD--KVLGSSIHMECKVSGSLPISAQ--------------WFKDGKEISTSAKYRLVCH 5288

Query: 327  DSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQ 386
            +   +     +  + +++ T + + V  +    G+  +           PP     P RQ
Sbjct: 5289 ERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKE---------PPSFLVKPGRQ 5339

Query: 387  PGLGSQDVVSKAANRRIP----------------------MEGQRDSAFPKFESKPQSQE 424
              +    V  KA  +  P                      +EG   ++F    S   S+ 
Sbjct: 5340 QAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGS--TSFLNLYSVDASKT 5397

Query: 425  VK-----ENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIE-GQDFVLQCSVRGTPVPRITW 478
             +      N      C  + ++   P F   L+   +++ G    L+C + G+P  R+ W
Sbjct: 5398 GQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVW 5457

Query: 479  LLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKK 535
              N   +  +   R T    VA + + +   ED G + C A+N  G  SCS  V V E  
Sbjct: 5458 FRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEP- 5516

Query: 536  SSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQ 595
                     PV  S P  PI       ++ +  ++V++  ++SG PP EV+W  +  +++
Sbjct: 5517 ---------PVFSSFP--PI-------VETLKNAEVSLECELSGTPPFEVVWYKDKRQLR 5558

Query: 596  ESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFI 655
             S+ +    +    S+ I  V   D G Y C+A N  G       + ++EP     P F+
Sbjct: 5559 SSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEP-----PRFV 5613

Query: 656  SKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKV 715
            SK  S+T   G+   +  +I G     V WL++ + + +++ +  +   E+V TL   K 
Sbjct: 5614 SKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQFAKA 5673

Query: 716  QPWHAGQYEILLKNRVGECSCQVSLML 742
            +P +AG+Y   +KN  G      +LM+
Sbjct: 5674 EPANAGKYICQIKNDGGMRENMATLMV 5700



 Score =  151 bits (382), Expect = 5e-36
 Identities = 188/860 (21%), Positives = 318/860 (36%), Gaps = 144/860 (16%)

Query: 445  PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGVAELHI 501
            P F         ++G D  L+C ++GTP   ++W  + + ++  +      E  +  +HI
Sbjct: 7399 PIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHI 7458

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
             +    D G Y C A N +G  +C   + +               AP     P F++ LS
Sbjct: 7459 LNVDAADIGEYQCKATNDVGSDTCVGSIALK--------------AP-----PRFVKKLS 7499

Query: 562  DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEI-QESEDFHFEQRGTQHSLCIQEVFPED 620
            D+  + G +V +   + G  P  V+W  +  EI +ES++          +L    V P +
Sbjct: 7500 DISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPAN 7559

Query: 621  TGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPF 680
             G YTC+  N AG     A L+V EP        + KP S+  + G +  + C +AG P 
Sbjct: 7560 AGKYTCQIKNDAGMQECFATLSVLEP-----ATIVEKPESIKVTTGDTCTLECTVAGTPE 7614

Query: 681  PTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSL 740
             +  W +DGK L  D   +++     V  L +  V P  +G Y   ++N VG+ SC  SL
Sbjct: 7615 LSTKWFKDGKELTSD-NKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASL 7673

Query: 741  MLQNSSARALPRG--REPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGE 798
             +   S R +P    R+      L G  V  +      YGS     P     W  E  G 
Sbjct: 7674 QV---SDRTVPPSFTRKLKETNGLSGSSVVME---CKVYGS-----PPISVSWFHE--GN 7720

Query: 799  DVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRA 858
            ++    K +     +T  A+    +E+ D  D     ++T     D+             
Sbjct: 7721 EISSGRKYQTTLTDNT-CALTVNMLEESDSGDY--TCIATNMAGSDECS----------- 7766

Query: 859  NLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVL-- 916
                   P TV E    V  P  +D   VL     + T + +  PP   +     S L  
Sbjct: 7767 ------APLTVREPPSFVQKPDPMD---VLTGTNVTFTSIVKGTPPFSVSWFKGSSELVP 7817

Query: 917  GGKKKLPAENGSSSAETLNAKAVES-------SKPLSNAQPSGPLKPVGNAKPAETL--- 966
            G +  +  E+  +  E  +    +S       S     A  +  L     AK  + L   
Sbjct: 7818 GDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDY 7877

Query: 967  -----KPM-------GNAKPAETLKPMG-NAKPDE--NLKSASKEELKKDVKNDV----- 1006
                 KP+       G    + T K  G N  P +  N+ +  K  + +   + V     
Sbjct: 7878 SIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQ 7937

Query: 1007 -NCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLN 1065
             NC   +A   D+          P F ++L+ V V+ G    LQCQ++  P   + W   
Sbjct: 7938 YNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKG 7997

Query: 1066 GKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASE 1125
               L+ T    +    ++ ++   +    D G Y C A+N  G+   S  +TV +     
Sbjct: 7998 DTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQE----- 8052

Query: 1126 NTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGES 1185
                                                     +PP   +   D +   G  
Sbjct: 8053 ---------------------------------------QKLPPSFSRQLRDVQETVGLP 8073

Query: 1186 VELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVEN 1245
            V     ++G++PI+ +W K  K +++S +++    +N + L I    +   G Y+    N
Sbjct: 8074 VVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATN 8133

Query: 1246 KLGSRQAQVNLTVVDKPDPP 1265
             +GS  +   L + +  +PP
Sbjct: 8134 PIGSASSSARLILTEGKNPP 8153



 Score =  147 bits (371), Expect = 9e-35
 Identities = 189/781 (24%), Positives = 307/781 (39%), Gaps = 107/781 (13%)

Query: 40   RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF-SLVIHAVHE 98
            +N+ + E  TA FE  V  +  P + W +NG  I    +F +   ++G    L+I     
Sbjct: 2889 KNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIV--VQGKLHQLIIMNTST 2945

Query: 99   EDRGKYTCEATNGSGARQVTV----------------------ELTV--EGSFAKQLGQP 134
            ED  +YT    N   +  +TV                      E+TV  EG   K L   
Sbjct: 2946 EDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNG 3005

Query: 135  VVSKT---------------------LGDR----FSAPAVETRPSIWGECPP-KFATKLG 168
            V  K+                      GD     F A    +  +++ E    +F   + 
Sbjct: 3006 VEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIK 3065

Query: 169  RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDV 228
             + V E +   F C+++  P   V W+K +  LQ + R+ + ++  +  L I      D 
Sbjct: 3066 DIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDA 3124

Query: 229  GVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSL 288
            G YT +    +G    +A+L ++G D   RS           ++KEV  VI K+  +   
Sbjct: 3125 GKYTVV----AGGNVSTAKLFVEGRDVRIRS-----------IKKEV-QVIEKQRAVVEF 3168

Query: 289  EAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPR----TAPQTPVLQKTSSS 344
            E      +    + G    +    + +   E ++     S          T V  +  SS
Sbjct: 3169 EVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSS 3228

Query: 345  ITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLG---SQDVVSKAANR 401
            +TL     +P P+   L  L P   +  +PA          QP +     + ++S     
Sbjct: 3229 VTLYVNAPEP-PQV--LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKC 3285

Query: 402  RIPMEGQRDS-----AFPKFESKPQSQEVKENQTVKFRCEGLAVM--EVA---------- 444
            +   +GQ  +     AFP+ ++   + E K +  V      L+V   EV           
Sbjct: 3286 KFLHDGQEYTLLLIEAFPE-DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3344

Query: 445  PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ---PIQYARSTCEAGVAELHI 501
            P+  + L+D    EGQ    QC V GT + +++W    +   P ++ R T      +L I
Sbjct: 3345 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
             +A PED GTYT +A NA+GQVS +A +++   +S         +      AP+  + + 
Sbjct: 3404 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIE 3463

Query: 562  DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
             L+V  G     T ++   P     W   G EI ES+           SL I      D 
Sbjct: 3464 PLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDC 3523

Query: 622  GTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFP 681
            G YTC+A N  G V   A LTV E +    P F+S+P+S+T  +G++    C + G P  
Sbjct: 3524 GEYTCKASNEYGSVSCTATLTVTEAY---PPTFLSRPKSLTTFVGKAAKFICTVTGTPVI 3580

Query: 682  TVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLM 741
               W +DG AL   + ++ +   E+   L L  +     G Y     N+ G   CQ  L+
Sbjct: 3581 ETIWQKDGAAL-SPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELI 3639

Query: 742  L 742
            +
Sbjct: 3640 I 3640



 Score =  144 bits (364), Expect = 6e-34
 Identities = 165/767 (21%), Positives = 287/767 (37%), Gaps = 115/767 (14%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFI--LPPRNLCIKEGATAKFEGRVRGY 59
            G     AS+   K S S        + + E P FI  L P  + +K+    ++E ++ G 
Sbjct: 7280 GQYTCYASNIAGKDSCSAQ------LGVQEPPRFIKKLEPSRI-VKQDEFTRYECKIGGS 7332

Query: 60   PEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTV 119
            PE +V W+++   I    +F +   +     L +H +  ED G YTCEA N +G+   + 
Sbjct: 7333 PEIKVLWYKDETEIQESSKFRMSF-VDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSST 7391

Query: 120  ELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGR 179
             L V+                                   PP F  K   +   +G    
Sbjct: 7392 SLKVKE----------------------------------PPIFRKKPHPIETLKGADVH 7417

Query: 180  FSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGS 239
              C++ G P   V+W K    L+   +  +  +N +  + I  V+  D+G Y C   N  
Sbjct: 7418 LECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDV 7477

Query: 240  GKASMSAELSIQGLDSANRSFVRETKATNSDVRKEV-----------TNVISKESKLDSL 288
            G  +    ++++    A   FV++    ++ V KEV            +V+  + K + +
Sbjct: 7478 GSDTCVGSIALK----APPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIV 7533

Query: 289  EAA-----AKSKNCSSPQRGGSPPWAANSQP-QPPRESKLESCKDSPRTAPQTPVLQKTS 342
              +     + S+N ++ Q     P  A     Q   ++ ++ C  +        +++K  
Sbjct: 7534 RESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPE 7593

Query: 343  SSITLQAARVQPEPRAPGLGVLS----PSGEERKRPAPPRPATFPTRQPGLGSQDVVSKA 398
            S           E    G   LS      G+E       + + F             +K 
Sbjct: 7594 SIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFF-------------NKV 7640

Query: 399  ANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIE 458
            +  +I      DS    FE   Q+   K++ T   +   ++   V PSF+  LK+   + 
Sbjct: 7641 SGLKIINVAPSDSGVYSFE--VQNPVGKDSCTASLQ---VSDRTVPPSFTRKLKETNGLS 7695

Query: 459  GQDFVLQCSVRGTPVPRITWLLNGQPIQYAR---STCEAGVAELHIQDALPEDHGTYTCL 515
            G   V++C V G+P   ++W   G  I   R   +T       L +      D G YTC+
Sbjct: 7696 GSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCI 7755

Query: 516  AENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTV 575
            A N  G   CSA +TV E                    P F+Q    + V+ G+ VT T 
Sbjct: 7756 ATNMAGSDECSAPLTVRE-------------------PPSFVQKPDPMDVLTGTNVTFTS 7796

Query: 576  QVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEV 635
             V G PP  V W    +E+   +  +     +   L + +V    +G YTC   N AG+ 
Sbjct: 7797 IVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKA 7856

Query: 636  RTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKD 695
                 L ++ P       F+ +    +   G+ +++     G P  +V W ++G  +   
Sbjct: 7857 SCTTHLYIKAPAK-----FVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINV-TP 7910

Query: 696  TGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLML 742
            +    +   E    L +       AGQY   ++N  G+ SC   +++
Sbjct: 7911 SQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILI 7957



 Score =  144 bits (362), Expect = 1e-33
 Identities = 170/745 (22%), Positives = 277/745 (37%), Gaps = 109/745 (14%)

Query: 27   MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
            + + E    I  P  + +  G     E  V G PE    W ++G+ +++  +  +   I 
Sbjct: 6639 LTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITF-IN 6697

Query: 87   GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSA 146
               SL I      D+G Y+ E  N  G    TV + V                  DR   
Sbjct: 6698 KVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVS-----------------DRI-- 6738

Query: 147  PAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSAR 206
                         PP F  KL  V    G      C+++G     V W +    +    +
Sbjct: 6739 ------------VPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPK 6786

Query: 207  VSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQ--------------- 251
               S    +  L +  +   D G+YTC+  N +G    SA L++Q               
Sbjct: 6787 CQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVL 6846

Query: 252  -GLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAA 310
             G+     S +R T        K    ++  ES   SLE           Q         
Sbjct: 6847 PGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQ--------- 6897

Query: 311  NSQPQPPRESKLESC---KDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPS 367
                  P ES   SC    D+   +  T +  K  ++   + A    E  +P +   + +
Sbjct: 6898 ------PLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEATYT 6951

Query: 368  GEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQR---DSAFPKFESKPQSQE 424
            G            T P     +  + ++S++    I M  +    +      E   Q   
Sbjct: 6952 G------------TPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSC 6999

Query: 425  VKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQP 484
            + EN+  +  CE L  +   P F   L+    + G+   LQC V GTP  RI+W      
Sbjct: 7000 LIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTK 7059

Query: 485  IQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSE 541
            ++ A   +   +  VA L I      D G Y+C A+N++G V+ SA + +  +K      
Sbjct: 7060 LRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARK------ 7113

Query: 542  YLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH 601
              LP        P F + L D+    G  V    +++G+ P +V W  +G  +++  +  
Sbjct: 7114 --LP--------PFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANL- 7162

Query: 602  FEQRGTQHSLCIQEVFPED---TGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKP 658
              Q    H++   ++   D    G Y C A N  G   + A L + E H+   P+F  KP
Sbjct: 7163 --QTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSE-HE-VPPFFDLKP 7218

Query: 659  RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPW 718
             SV  +LG+S    C + G     + W +D + + +  G++++   E+  TL + KV   
Sbjct: 7219 VSVDLALGESGTFKCHVTGTAPIKITWAKDNREI-RPGGNYKMTLVENTATLTVLKVGKG 7277

Query: 719  HAGQYEILLKNRVGECSCQVSLMLQ 743
             AGQY     N  G+ SC   L +Q
Sbjct: 7278 DAGQYTCYASNIAGKDSCSAQLGVQ 7302



 Score =  142 bits (357), Expect = 4e-33
 Identities = 161/731 (22%), Positives = 269/731 (36%), Gaps = 95/731 (12%)

Query: 29   LTEAPAFILPPRNLC-IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRG 87
            + + PA I+    L  +  G  A  E  V G PE +  W+++G+P+ +  ++ +      
Sbjct: 4012 IVKEPAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFK-NN 4070

Query: 88   TFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAP 147
               L  ++    D G+YT E +N  G+       TV            + + +   F+ P
Sbjct: 4071 VAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTV------------LDRDIAPFFTKP 4118

Query: 148  AVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARV 207
                   + G C                   R  CKI G    +V+W K    +  S R 
Sbjct: 4119 LRNVDSVVNGTC-------------------RLDCKIAGSLPMRVSWFKDGKEIAASDRY 4159

Query: 208  SVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKAT 267
             ++   G   LEI  V+ +D G +TC   N  G    S  L +Q       SFV  TK  
Sbjct: 4160 RIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQ----EPPSFV--TKPG 4213

Query: 268  NSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKD 327
            + DV    + V  K +   S     +    +     G   +      +   E  L    D
Sbjct: 4214 SKDVLPG-SAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSD 4272

Query: 328  SPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPA----------PP 377
            S      T  +   +  +   A     EP A  +  L PS   +K  A          PP
Sbjct: 4273 S---GTYTCKVSNVAGGVECSANLFVKEP-ATFVEKLEPSQLLKKGDATQLACKVTGTPP 4328

Query: 378  RPATF-----PTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVK 432
               T+       ++        V   A  R+   G  DS     E+        +N+   
Sbjct: 4329 IKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEA--------QNEAGS 4380

Query: 433  FRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYAR--- 489
              C  + +++ +P F+   K   V++  D +L   V GTP   ITW  +   ++  R   
Sbjct: 4381 DHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYK 4440

Query: 490  STCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPS 549
            +  +  +  L I   +  D G Y C   N +G   CSA VT+ E                
Sbjct: 4441 TFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREP--------------- 4485

Query: 550  KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQH 609
                P F++ +     + G        + G+ P  V WL + +EI E ++          
Sbjct: 4486 ----PSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVA 4541

Query: 610  SLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSV 669
            SL +  +  +  G Y C+A N AG  R  A+L+V+EP   T+     +  S+  + G   
Sbjct: 4542 SLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITE-----EAVSIDVTQGDPA 4596

Query: 670  LISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKN 729
             +    +G    T  W +DG+ L   +  +++   + V  L +   +   +G+Y   ++N
Sbjct: 4597 TLQVKFSGTKEITAKWFKDGQELTLGS-KYKISVTDTVSILKIISTEKKDSGEYTFEVQN 4655

Query: 730  RVGECSCQVSL 740
             VG  SC+  +
Sbjct: 4656 DVGRSSCKARI 4666



 Score =  142 bits (357), Expect = 4e-33
 Identities = 169/741 (22%), Positives = 270/741 (36%), Gaps = 113/741 (15%)

Query: 31   EAPAFILPPRN-LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF 89
            E P FI  P   L ++ G +  FE ++ G P+ +V+W+ +G  IT+  +  +   I G  
Sbjct: 4859 EPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISF-IDGLA 4917

Query: 90   SLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAV 149
            +  I     E+ G Y CEA N +G    ++EL V+                         
Sbjct: 4918 TFQISGARVENSGTYVCEARNDAGTASCSIELKVKE------------------------ 4953

Query: 150  ETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSV 209
                      PP F  +L  V V +       C++TG P  +VTWLK N  ++ S + ++
Sbjct: 4954 ----------PPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTL 5003

Query: 210  SEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNS 269
            +++  +  L I   +  D G Y C+V N  G  S S  ++++       SF+++ + T  
Sbjct: 5004 TDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALK----EPPSFIKKIENT-- 5057

Query: 270  DVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPP----WAANSQPQPPRESKLESC 325
                  T V+   +   S  A             GSPP    W  + Q     ++   S 
Sbjct: 5058 ------TTVLKSSATFQSTVA-------------GSPPISITWLKDDQILDEDDNVYISF 5098

Query: 326  KDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG-LGVLSPSGEERKRPA----PPRPA 380
             DS  T     V    S   T QA       R    L V  P+    K  +       P 
Sbjct: 5099 VDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVTEKDPM 5158

Query: 381  TFPTRQPGLGS------QDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVK-----ENQ 429
            T      G         +D      +R   M  + + A  + +S  +    +     EN 
Sbjct: 5159 TLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVEND 5218

Query: 430  TVKFRCEG-LAVME--VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ 486
                 C+  L V++  + PSF+  L     + G    ++C V G+      W  +G+ I 
Sbjct: 5219 FGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEIS 5278

Query: 487  YA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYL 543
             +   R  C      L + +   ED   YTC   N  G  +CS  +TV E          
Sbjct: 5279 TSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEP--------- 5329

Query: 544  LPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFE 603
                      P FL      + +  S V     + G PP ++ W  +  E+         
Sbjct: 5330 ----------PSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIG 5379

Query: 604  QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISK-PRSVT 662
              G+   L +  V    TG YTC   N  G      +L V EP     P F+ K   S  
Sbjct: 5380 LEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP-----PKFVKKLEASKI 5434

Query: 663  ASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQ 722
               G S  + C IAG P   V W R+   L   +  + +   + V  + +  +    +G 
Sbjct: 5435 VKAGDSSRLECKIAGSPEIRVVWFRNEHEL-PASDKYRMTFIDSVAVIQMNNLSTEDSGD 5493

Query: 723  YEILLKNRVGECSCQVSLMLQ 743
            +    +N  G  SC   ++++
Sbjct: 5494 FICEAQNPAGSTSCSTKVIVK 5514



 Score =  140 bits (353), Expect = 1e-32
 Identities = 170/749 (22%), Positives = 289/749 (38%), Gaps = 113/749 (15%)

Query: 24   VDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDC 83
            VD       P+F    +N     GA+   E +V G     V W      I SG ++    
Sbjct: 5791 VDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKY---- 5846

Query: 84   GIRGTFS-----LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK 138
              + TFS     L ++++   D G YTC A N +G+ +    LTV+              
Sbjct: 5847 --QTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQE------------- 5891

Query: 139  TLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGN 198
                                 PP F  +   + V  G+   F+  I G P  +V W +G 
Sbjct: 5892 ---------------------PPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGA 5930

Query: 199  VPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDS--- 255
              L    R ++  ++ +  LE+  ++    G YTC+V N +G+AS +  L ++   +   
Sbjct: 5931 RELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLK 5990

Query: 256  --------ANRSFVRETKATNS-----DVRKEVTNVISKES-KLDSLEAAAKSKNCSSPQ 301
                      +S + E+  T +       +K+  N+ + E   + + E     +  +S +
Sbjct: 5991 RLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTK 6050

Query: 302  RGGSPPWAANSQPQPPRE--SKLESCKDSPRTAPQ-TPVLQKTSSSITLQAARVQPEPRA 358
            R     ++   + +  R+    L S  + P    +  P+      S++LQ          
Sbjct: 6051 RDAG-QYSCEIENEAGRDVCGALVSTLEPPYFVTELEPLEAAVGDSVSLQC----QVAGT 6105

Query: 359  PGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFES 418
            P + V    G+ + RP P     F        + +V +   N+        DS   ++  
Sbjct: 6106 PEITVSWYKGDTKLRPTPEYRTYF--------TNNVATLVFNK----VNINDSG--EYTC 6151

Query: 419  KPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITW 478
            K ++     +    FR   +   ++ PSF+  LKD     G    L C + G+   ++ W
Sbjct: 6152 KAENSIGTASSKTVFR---IQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCW 6208

Query: 479  LLNG---QPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKK 535
              +G   +  +  +++    VA L I        G Y+C A N LG  S SA +T  E K
Sbjct: 6209 YRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPK 6268

Query: 536  SSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQ 595
             S       P    KP +         + V+ G        V+G  P  + W  +  EI+
Sbjct: 6269 KS-------PFFDIKPVS---------IDVIAGESADFECHVTGAQPMRITWSKDNKEIR 6312

Query: 596  ESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFI 655
               ++     G    L I +V   D+G YTC+A N  G+    A L+V+EP     P F+
Sbjct: 6313 PGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEP-----PKFV 6367

Query: 656  SK-PRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKK 714
             K   S  A  G+S+ + C I+G P   V W R+   L  ++  + +     V  L + +
Sbjct: 6368 KKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSEL-HESWKYNMSFINSVALLTINE 6426

Query: 715  VQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
                 +G Y     N VG+ SC  +L ++
Sbjct: 6427 ASAEDSGDYICEAHNGVGDASCSTALTVK 6455



 Score =  132 bits (332), Expect = 3e-30
 Identities = 163/739 (22%), Positives = 269/739 (36%), Gaps = 99/739 (13%)

Query: 26   SMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGI 85
            S+   E P F+    +     G   +    V G+    V W ++   +           I
Sbjct: 6544 SVKFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFI 6603

Query: 86   RGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFS 145
                +L + +    + GKY C+  N +G R+ +  LTV                      
Sbjct: 6604 DNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLE-------------------- 6643

Query: 146  APAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSA 205
                          P +   K   + V  G      C +TG P+    W K    L   +
Sbjct: 6644 --------------PARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADS 6689

Query: 206  RVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETK 265
            +  ++  N +  L+I      D G+Y+  V N  GK++ +  + +        SF+R+ K
Sbjct: 6690 KHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDR-IVPPSFIRKLK 6748

Query: 266  ATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGG---SPPWAANSQPQPPRESKL 322
                    +V  ++     L+   + +   +    Q G    S P   +S  +      L
Sbjct: 6749 --------DVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNL 6800

Query: 323  ESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPA-- 380
               + S  T   T V    + S    A     EP         PS E+        P   
Sbjct: 6801 SLLEPSD-TGIYTCVAANVAGSDECSAVLTVQEP---------PSFEQTPDSVEVLPGMS 6850

Query: 381  -TFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRC---- 435
             TF +   G     V     +R +      + +   F ++ +  EV+  ++  + C    
Sbjct: 6851 LTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTN 6910

Query: 436  --------EGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQY 487
                      L V E A +F   L D +V  G   VL+ +  GTP   ++W+ +   I  
Sbjct: 6911 DAGSASCTTHLFVKEPA-TFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQ 6969

Query: 488  ARSTCEAGVAE----LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYL 543
            +   C   + E    L I ++  ED+  Y+CL EN  GQ  C A V+V E          
Sbjct: 6970 SER-CSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEP--------- 7019

Query: 544  LPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFE 603
                      P F++ L  ++ + G   T+  +V G P   + W     +++ +  +  +
Sbjct: 7020 ----------PYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQ 7069

Query: 604  QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTA 663
             +    SL I +V   D G Y+C+A NS G V + AVL ++       P+F  K + V  
Sbjct: 7070 FKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARK--LPPFFARKLKDVHE 7127

Query: 664  SLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQY 723
            +LG  V   C I G     V W +DG  L KD  + +     +V TL + +    H GQY
Sbjct: 7128 TLGFPVAFECRINGSEPLQVSWYKDG-VLLKDDANLQTSFVHNVATLQILQTDQSHIGQY 7186

Query: 724  EILLKNRVGECSCQVSLML 742
                 N +G  S    L+L
Sbjct: 7187 NCSASNPLGTASSSAKLIL 7205



 Score =  132 bits (332), Expect = 3e-30
 Identities = 94/321 (29%), Positives = 141/321 (43%), Gaps = 25/321 (7%)

Query: 425  VKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNG-- 482
            +  N+  K  C     ++    F   L D ++ +G+  +L+ +  GTP   +TW  NG  
Sbjct: 7848 IVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGIN 7907

Query: 483  -QPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSE 541
              P Q    T     A L I  +  ED G Y C  ENA G+ SCSA + + E        
Sbjct: 7908 VTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP------- 7960

Query: 542  YLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH 601
                        P F++ L  +KV  G   ++  Q++G P   V W     +++ +  + 
Sbjct: 7961 ------------PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYK 8008

Query: 602  FEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSV 661
               R    +L   +V   D+G Y C+A NS GEV     LTVQE      P F  + R V
Sbjct: 8009 MHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQE--QKLPPSFSRQLRDV 8066

Query: 662  TASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAG 721
              ++G  V+  CAI+G    +V W +DGK L KD+ + +    ++  TL + K     AG
Sbjct: 8067 QETVGLPVVFDCAISGSEPISVSWYKDGKPL-KDSPNVQTSFLDNTATLNIFKTDRSLAG 8125

Query: 722  QYEILLKNRVGECSCQVSLML 742
            QY     N +G  S    L+L
Sbjct: 8126 QYSCTATNPIGSASSSARLIL 8146



 Score =  124 bits (312), Expect = 6e-28
 Identities = 156/754 (20%), Positives = 274/754 (36%), Gaps = 130/754 (17%)

Query: 26   SMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGI 85
            S+ + E P F   P  +   +GA    E  ++G P   V+W+++ + + SG ++ +   +
Sbjct: 7392 SLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKI---M 7448

Query: 86   RGTFSLVIHAVHEE--DRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR 143
               F   IH ++ +  D G+Y C+ATN  G+       T  GS A +             
Sbjct: 7449 SENFLTSIHILNVDAADIGEYQCKATNDVGSD------TCVGSIALK------------- 7489

Query: 144  FSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPL-Q 202
                            PP+F  KL  +    G+  +    I G     V W K    + +
Sbjct: 7490 ---------------APPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVR 7534

Query: 203  PSARVSVSEKNGMQVLEIHGVN-----------QDDVGVYTCLV---------------- 235
             S  + +S    +  L+   V            ++D G+  C                  
Sbjct: 7535 ESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPES 7594

Query: 236  VNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSK 295
            +  +   + + E ++ G    +  + ++ K   SD + +++   +K S L  +  A    
Sbjct: 7595 IKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKIS-FFNKVSGLKIINVAPSD- 7652

Query: 296  NCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPE 355
                     S  ++   Q    ++S   S + S RT P +   +K   +  L  + V  E
Sbjct: 7653 ---------SGVYSFEVQNPVGKDSCTASLQVSDRTVPPS-FTRKLKETNGLSGSSVVME 7702

Query: 356  PRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPK 415
             +  G              +PP   ++          + +S     +  +     +    
Sbjct: 7703 CKVYG--------------SPPISVSW------FHEGNEISSGRKYQTTLTDNTCALTVN 7742

Query: 416  FESKPQSQE---VKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTP 472
               +  S +   +  N      C     +   PSF        V+ G +      V+GTP
Sbjct: 7743 MLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTP 7802

Query: 473  VPRITWLLNGQ---PIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWV 529
               ++W        P      + E  VAEL + D      G YTC+  N  G+ SC+   
Sbjct: 7803 PFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTT-- 7860

Query: 530  TVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLH 589
                        +L   AP+K     F++ L+D  +  G  + +    +G PP  V W  
Sbjct: 7861 ------------HLYIKAPAK-----FVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKK 7903

Query: 590  NGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDG 649
            NG  +  S+  +         L I     ED G Y C   N++G+    A + + EP   
Sbjct: 7904 NGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEP--- 7960

Query: 650  TQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFT 709
              P+F+ +   V  S+G S  + C +AG P   V W + G    + T  +++    +V T
Sbjct: 7961 --PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYK-GDTKLRPTTTYKMHFRNNVAT 8017

Query: 710  LVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
            LV  +V    +G+Y    +N VGE S    L +Q
Sbjct: 8018 LVFNQVDINDSGEYICKAENSVGEVSASTFLTVQ 8051



 Score =  122 bits (306), Expect = 3e-27
 Identities = 158/734 (21%), Positives = 285/734 (38%), Gaps = 96/734 (13%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G  + ++  I G PFP   W ++G+ + K      +  +E    LV+K+     +G Y++
Sbjct: 30151 GGVIRLTIPIKGKPFPICKWTKEGQDISK---RAMIATSETHTELVIKEADRGDSGTYDL 30207

Query: 726   LLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGV------GADGGGSDRYGS 779
             +L+N+ G+ +  + + +  S     P G  P   +D+    V       AD GG+D  G 
Sbjct: 30208 VLENKCGKKAVYIKVRVIGSPNS--PEG--PLEYDDIQVRSVRVSWRPPADDGGADILGY 30263

Query: 780   LRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKK--VS 837
             +          W   +    VRG        +++ E   R     Q      L  +  V+
Sbjct: 30264 ILERREVPKAAWYTID--SRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVT 30321

Query: 838   TKT-LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGT--S 894
              KT L+  +    P E +D   +       +   +   +V +   ++ +     K    +
Sbjct: 30322 PKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRV-TGYYIERKETSTDKWVRHN 30380

Query: 895   KTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNA-KAVESSKPLSNAQPSGP 953
             KT +   +       PD       + ++ A+N    +ET  A + V    P       G 
Sbjct: 30381 KTQITTTMYTVTGLVPDAEY----QFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGE 30436

Query: 954   LKPVGNAKPAETL---KP-MGNAKPAETLKPMGNAKPDENLKSASKEELKKD-------- 1001
             L+ +  +K + TL   KP     K             D   K ++KE +K          
Sbjct: 30437 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 30496

Query: 1002  ----------VKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQ 1051
                        +N+    R    T  + K   + G AP  +++++DV    G+   L CQ
Sbjct: 30497 EATEYEFRVFAENETGLSRPRR-TAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQ 30555

Query: 1052  VSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAE 1111
             +   P   I W   GK L  ++   +S +G   ++++     ED G+Y C+A N+ G+ E
Sbjct: 30556 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 30615

Query: 1112  CSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQI 1171
              S ++ +   P                                    P  P K       
Sbjct: 30616 TSSKLLLQATPQFH---------------------------------PGYPLK------- 30635

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTIL-A 1230
                 E      G ++ L     G      TW   +K +Q SE++ +EN+E+ + L +   
Sbjct: 30636 ----EKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNV 30691

Query: 1231  ARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDG 1290
              R+ H G Y + + N  G+  A +++ + DKPD P G      +  +S  +SW   + DG
Sbjct: 30692 QRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDG 30751

Query: 1291  GSAVQSYSIEIWDS-ANKTWKELATCRS-TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1348
             GS + +Y +E  ++     W+ +++  S T+  + +L  +  Y FRV A N +G S+P +
Sbjct: 30752 GSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLE 30811

Query: 1349  ESELTTVGEKPEEP 1362
              S +  +    E+P
Sbjct: 30812 VSSVVIIKSPFEKP 30825



 Score =  118 bits (295), Expect = 6e-26
 Identities = 175/807 (21%), Positives = 305/807 (37%), Gaps = 149/807 (18%)

Query: 552  TAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSL 611
            T P  + GL ++ V++G  VT+   +SG P P V W     +I+ S DF    +     L
Sbjct: 941  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 1000

Query: 612  CIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQE-------------------------- 645
             I+E F ED+G +TC A N AG V T   L VQ                           
Sbjct: 1001 MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1060

Query: 646  ---------------PHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGK 690
                           P +   P+FI+KP       G SV+  C + G+P P V+W + G 
Sbjct: 1061 DVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1120

Query: 691  ALCKDTGH-FEVLQNEDV--FTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSA 747
             L   TG+ ++V  N+      LV+       AG+Y I+++N+ GE S   SL L+ +  
Sbjct: 1121 PL--TTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL-LEEADY 1177

Query: 748  RALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWP-ARGQGWLEEEDGEDVRGVLKR 806
              L + ++    +      V        + G   PG+  +  +   E+E     + + K 
Sbjct: 1178 ELLMKSQQEMLYQTQVTAFV-----QEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKD 1232

Query: 807  RVETRQHTEEAIRQQEVEQLDFRDLLGKKVS---TKTLSEDDLKEIPAEQMDFRANLQRQ 863
             V  R + E+    QE     F + L K++     KT  E+ L+E   E+M    +    
Sbjct: 1233 TVVVRTYVED----QEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEA 1288

Query: 864  VKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVP--------EKVPPPKPATPDF--- 912
            V+    S  + ++ + + ++   V      S  P+P        +++   +    DF   
Sbjct: 1289 VE----SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQD 1344

Query: 913  -RSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSG-----PLKPVGNAKPAETL 966
             R+ L     LP + G  +A   N K         NA  SG     P  P+G      TL
Sbjct: 1345 GRASLRIPVVLPEDEGIYTAFASNIK--------GNAICSGKLYVEPAAPLGAPTYIPTL 1396

Query: 967  KPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQG 1026
            +P+   +   +L P   ++    +  A     +         +       +    S+ + 
Sbjct: 1397 EPVSRIR---SLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLER 1453

Query: 1027 T-APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT--TKFIILSQEGSL 1083
               P F  K       EG+      +V   P     W  +G+ +    T  +++ ++G+ 
Sbjct: 1454 LYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ 1513

Query: 1084 CSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPP 1143
             S+ I  A P D G +  VA+N AG++  S  +TV+                        
Sbjct: 1514 -SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---------------------- 1550

Query: 1144 VLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWM 1203
                                +  + P  ++  ++  ++ G  +E+  + TG       W+
Sbjct: 1551 --------------------EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWL 1590

Query: 1204 KFRKQIQESEH--MKVENSENGSKLTILAARQEHCGCYTLLVENKLG--SRQAQVNLTV- 1258
            K    I   ++  +++E ++  + L I +   +    YT    NK G  + + +VN+ V 
Sbjct: 1591 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1650

Query: 1259 VDKPDP------PAGTPCASDIRSSSL 1279
              +P+P      P GT  A +I +  L
Sbjct: 1651 FAEPEPERKLIIPRGTYRAKEIAAPEL 1677



 Score =  114 bits (284), Expect = 1e-24
 Identities = 89/323 (27%), Positives = 136/323 (42%), Gaps = 37/323 (11%)

Query: 435  CEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI---QYARST 491
            C  +  ++  PSF    +   V+ G++      +RGTP  ++ W    + +         
Sbjct: 5883 CRAVLTVQEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIY 5942

Query: 492  CEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKP 551
             E  VAEL + +      G YTC+  N  GQ SC+  + V E           P A    
Sbjct: 5943 FEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKE-----------PAA---- 5987

Query: 552  TAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSL 611
                FL+ LSD  V  G  + +    +G  P  V W  +G  I  SE  +     T    
Sbjct: 5988 ----FLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIV---TTEKT 6040

Query: 612  CIQEVF---PEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQS 668
            CI E+      D G Y+CE  N AG     A+++  EP     P+F+++   + A++G S
Sbjct: 6041 CILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEP-----PYFVTELEPLEAAVGDS 6095

Query: 669  VLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLK 728
            V + C +AG P  TV W + G    + T  +      +V TLV  KV    +G+Y    +
Sbjct: 6096 VSLQCQVAGTPEITVSWYK-GDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAE 6154

Query: 729  NRVGECSCQVSLMLQNSSARALP 751
            N +G  S +    +Q    R LP
Sbjct: 6155 NSIGTASSKTVFRIQE---RQLP 6174



 Score =  113 bits (282), Expect = 2e-24
 Identities = 211/1044 (20%), Positives = 358/1044 (34%), Gaps = 249/1044 (23%)

Query: 533   EKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGN 592
             +K S RK E L     +   AP     +   +V  G      + V   P  EV W HNG 
Sbjct: 32353 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 32412

Query: 593   EIQESE----------------DFHFEQRGTQHSLCI----------------------- 613
             E+QES                 D H +  GT  ++C                        
Sbjct: 32413 ELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYA 32472

Query: 614   ---------QEVFPEDTGTYT-----------CEAWNSAGEVRTQAVLTVQE----PHDG 649
                      + VFPE T T              EA +S  EV++Q   T +      H  
Sbjct: 32473 SQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSA 32532

Query: 650   TQPW--------------------------FISKPRSVTASLGQSVLISCAIAGDPFPTV 683
             +                              ++KPRS+T   G+S   SC   G+P PTV
Sbjct: 32533 SAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTV 32592

Query: 684   HWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
              WLR G+ L     H +V   +   T  +  VQ    G Y ++++N  G+   + +L +Q
Sbjct: 32593 TWLRKGQVLSTSARH-QVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 32651

Query: 744   NS------------------------SARALPRGREPASCEDLCGGGVGADGGGSDRYGS 779
              +                        + ++  R + P                 +++   
Sbjct: 32652 KARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQH 32711

Query: 780   LRPGWPARGQGWLEEEDGEDVR--------GVLKRRVETRQHTEEAIRQQEVEQLDFRDL 831
             L    P +   +L+ E  +++          VL+ +  T     + +++    Q  +   
Sbjct: 32712 LPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSAD 32771

Query: 832   LGKKVSTKTLSEDD----LKEIPAEQMDFRANLQRQVKP-KTVSEEERKVHSPQQVDFR- 885
                ++    L+E D    + EI  E    + NLQ   +  K++ E+  K+   ++ D + 
Sbjct: 32772 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 32831

Query: 886   --SVLAKKGTSKTPVPEKVPP--------------------------PKPA---TPDFRS 914
               S + +K   K P P    P                          P+P    T D ++
Sbjct: 32832 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 32891

Query: 915   VL-GGKKKLPAENGS---------------------------SSAETLNAKAVESSKPLS 946
             +  GGK KL  + G                            SS+  L  KA++ ++   
Sbjct: 32892 ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 32951

Query: 947   -NAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENL---KSASK----EEL 998
              + Q +  + P   A   E +     A  +E +K M  AK  E L   + ASK    EE+
Sbjct: 32952 VSTQKTSEITPQKKAVVQEEISQ--KALRSEEIK-MSEAKSQEKLALKEEASKVLISEEV 33008

Query: 999   KKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPA 1058
             KK     +     H   T   + SE   T    K     + + EG++L+L+  ++     
Sbjct: 33009 KKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG--AT 33066

Query: 1059  TIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
              + W LNG  L  ++       GS  +++I++A   D G+  C++K   G  +C   +T+
Sbjct: 33067 DVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL 33126

Query: 1119  DDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQ 1178
                       + E+                SDA                 P  I  P  Q
Sbjct: 33127 ----------SKEL----------------SDA-----------------PAFISQPRSQ 33143

Query: 1179  KVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
              +  G++V    +++G       W K    I  S ++ +  S N   L I  A     G 
Sbjct: 33144 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 33203

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYS 1298
             YT+  +N  G   A  +L V+   + P+          +SL  S+   S    ++ Q  S
Sbjct: 33204 YTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEAS 33263

Query: 1299  IEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ----ESELTT 1354
                + S++ +   +   +  S + Q +    E    + + +  G S  +Q     S++  
Sbjct: 33264 FSSFSSSSAS--SMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLK 33321

Query: 1355  VGEKPEEPKDEVEVSDDDEKEPEV 1378
              G +   PK E   SD    E +V
Sbjct: 33322 AGIRGIPPKIEALPSDISIDEGKV 33345



 Score =  111 bits (278), Expect = 6e-24
 Identities = 67/201 (33%), Positives = 103/201 (51%), Gaps = 4/201 (1%)

Query: 1167  MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKL 1226
             +PP+I+  PE   ++AG+ + +   V G    TC W K   ++  S H+ V  +++ S L
Sbjct: 18898 LPPKILM-PEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSIL 18956

Query: 1227  TILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGS 1286
              I    ++  G Y+L  EN  G+   ++ + V+D P PP      SDI + + +LSW+  
Sbjct: 18957 IIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIP 19016

Query: 1287  SYDGGSAVQSYSIEIWDSANKTW-KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSE 1345
               DGGS + +Y +E  D +   W   LA+   TS  V  L+P  EY FRVRA N +G SE
Sbjct: 19017 LEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISE 19076

Query: 1346  PSQESELTTVGE--KPEEPKD 1364
             P    ++        P EPK+
Sbjct: 19077 PLTSPKMVAQFPFGVPSEPKN 19097



 Score =  110 bits (275), Expect = 1e-23
 Identities = 73/206 (35%), Positives = 104/206 (50%), Gaps = 21/206 (10%)

Query: 444 APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-----RSTCEAGVAE 498
           AP+F+  L+   V+EG     +  + G PVP ++W  +GQ I  +     + +   G A+
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 499 LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQ 558
           L I      + G Y+  A N  GQ + +A + V       K+E     AP     P F+Q
Sbjct: 65  LTIPAVTKANSGRYSLKATNGSGQATSTAELLV-------KAE----TAP-----PNFVQ 108

Query: 559 GLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFP 618
            L  + V  GSQV + V+V+G P P V +  +G EIQ S DF   Q G  +SL I E +P
Sbjct: 109 RLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYP 168

Query: 619 EDTGTYTCEAWNSAGEVRTQAVLTVQ 644
           ED+GTY+  A NS G   + A L VQ
Sbjct: 169 EDSGTYSVNATNSVGRATSTAELLVQ 194



 Score =  110 bits (275), Expect = 1e-23
 Identities = 90/359 (25%), Positives = 143/359 (39%), Gaps = 45/359 (12%)

Query: 435  CEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---T 491
            C+   ++   P F   L+       +   L+C V       +TW  +GQ +   +     
Sbjct: 3634 CQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKIC 3693

Query: 492  CEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKP 551
             E  +A L I  A  +D GTY C A N  G  SCSA VTV E  S     ++  V PS  
Sbjct: 3694 FEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTVREPPS-----FVKKVDPSYL 3748

Query: 552  TAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSL 611
              P             G    +  ++ G+P  +V W  N  E+ ES         ++  L
Sbjct: 3749 MLP-------------GESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAIL 3795

Query: 612  CIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLI 671
             I +V  ED+G+Y+CEA N  G       + ++EP     P FI          G + L+
Sbjct: 3796 DITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEP-----PSFIKTLEPADIVRGTNALL 3850

Query: 672  SCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRV 731
             C ++G     + W +D K + + +  + +   + +  L +        G+YE ++ N V
Sbjct: 3851 QCEVSGTGPFEISWFKDKKQI-RSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEV 3909

Query: 732  GECSCQVSLML------------------QNSSARALPRGREPASCEDLCGGGVGADGG 772
            G+C C  + +L                  Q  + +A  RG EP S   + G  V  + G
Sbjct: 3910 GKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDG 3968



 Score =  109 bits (272), Expect = 3e-23
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 57/306 (18%)

Query: 30  TEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF 89
           T+AP F  P +++ + EG+TA FE  + G+P P+V+W R+GQ I++        G++ +F
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTL----PGVQISF 58

Query: 90  S-----LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRF 144
           S     L I AV + + G+Y+ +ATNGSG    T EL V+   A                
Sbjct: 59  SDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA---------------- 102

Query: 145 SAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS 204
                          PP F  +L  + V++G   R   ++TG P P V + +    +Q S
Sbjct: 103 ---------------PPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSS 147

Query: 205 ARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQG------------ 252
               +S++  +  L I     +D G Y+    N  G+A+ +AEL +QG            
Sbjct: 148 LDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTI 207

Query: 253 LDSANRSFVRETKATNS-DVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAAN 311
           + +A  S  R+T+     +   +  ++ + E  +D   AA +     +P R   PP   +
Sbjct: 208 VSTAQISESRQTRIEKKIEAHFDARSIATVEMVIDG--AAGQQLPHKTPPR--IPPKPKS 263

Query: 312 SQPQPP 317
             P PP
Sbjct: 264 RSPTPP 269



 Score =  109 bits (272), Expect = 3e-23
 Identities = 65/193 (33%), Positives = 101/193 (52%), Gaps = 3/193 (1%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+AG  +EL   VTG      TW K    +++ + + +EN    S +TI+ +++   G Y
Sbjct: 13702 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 13761

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              +   N  G   A V + V+DKP PPA     +D+ + S  L+W     DGGS + +Y +
Sbjct: 13762 IIEAVNVCGRATAVVEVNVLDKPGPPAAFD-ITDVTNESCLLTWNPPRDDGGSKITNYVV 13820

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGE- 1357
             E   + ++ W +L +T + T+F    L+P+ EY FRV A N+YG  EP Q S +T   + 
Sbjct: 13821 ERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQF 13880

Query: 1358  KPEEPKDEVEVSD 1370
              P  P   +E SD
Sbjct: 13881 DPPGPPTRLEPSD 13893



 Score =  108 bits (270), Expect = 5e-23
 Identities = 83/310 (26%), Positives = 133/310 (42%), Gaps = 29/310 (9%)

Query: 438  LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEA 494
            L+  EV P F        +  G+    +C V GT   +ITW  + + I+     + T   
Sbjct: 7205 LSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVE 7264

Query: 495  GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAP 554
              A L +      D G YTC A N  G+ SCSA + V E                    P
Sbjct: 7265 NTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEP-------------------P 7305

Query: 555  IFLQGLSDLKVMDGSQVTM-TVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCI 613
             F++ L   +++   + T    ++ G+P  +V+W  +  EIQES  F      +   L +
Sbjct: 7306 RFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEM 7365

Query: 614  QEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISC 673
              +  ED+G YTCEA N+AG   +   L V+EP     P F  KP  +    G  V + C
Sbjct: 7366 HNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEP-----PIFRKKPHPIETLKGADVHLEC 7420

Query: 674  AIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGE 733
             + G P   V W +D + L +    ++++    + ++ +  V     G+Y+    N VG 
Sbjct: 7421 ELQGTPPFHVSWYKDKREL-RSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGS 7479

Query: 734  CSCQVSLMLQ 743
             +C  S+ L+
Sbjct: 7480 DTCVGSIALK 7489



 Score =  107 bits (266), Expect = 1e-22
 Identities = 159/700 (22%), Positives = 240/700 (34%), Gaps = 154/700 (22%)

Query: 40   RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEE 99
            +N  I EG    F  ++ GYP P++ W+++G+ I  G R+ +D    G  SL I  V  E
Sbjct: 1298 KNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPE 1357

Query: 100  DRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGD----RFSAPAVETRPSI 155
            D G YT  A+N  G    + +L VE   A  LG P    TL      R  +P   +R  I
Sbjct: 1358 DEGIYTAFASNIKGNAICSGKLYVEP--AAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPI 1415

Query: 156  WGE------------------------------------CPPKFATKLGRVVVKEGQMGR 179
                                                     P F  K       EGQ  R
Sbjct: 1416 RMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTAR 1475

Query: 180  FSCKITGRPQPQVTWL-KGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG 238
            F  K+ GRP P+  W   G   +       V +++G Q L I      D G +T +  N 
Sbjct: 1476 FDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNR 1535

Query: 239  SGKASMSAELSIQGLD-SANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNC 297
            +G++S+S  L+++ ++      FV + K  N          I + S+L+    A  + N 
Sbjct: 1536 AGRSSISVILTVEAVEHQVKPMFVEKLKNVN----------IKEGSRLEMKVRATGNPN- 1584

Query: 298  SSPQRGGSPPWAANSQ---PQPPRESKLESCKDSPRTAPQTPVLQ--------------- 339
                      W  NS    P    + ++E  K        + V Q               
Sbjct: 1585 ------PDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR 1638

Query: 340  -KTSSSITLQAARVQPEPRAPGLGVLSPSGEER-KRPAPP--RPATFPTRQPGLGSQDVV 395
              T   + ++    +PEP      ++ P G  R K  A P   P      Q      D+ 
Sbjct: 1639 DTTRCKVNVEVEFAEPEPERK---LIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLY 1695

Query: 396  SKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCA 455
             K   ++           P F+ K  S  +K      F C    +               
Sbjct: 1696 DKEKQQK-----------PFFKKKLTSLRLKRFGPAHFECRLTPI--------------- 1729

Query: 456  VIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTY 512
                          G P   + WL +G+P++ A   R   E G   L    A   D G  
Sbjct: 1730 --------------GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGII 1775

Query: 513  TCLAENALGQVSCSAWVTVHEKKSSRKSEYL------------------------LPVAP 548
            TC A N  G    SA + V ++KS  +   L                        +    
Sbjct: 1776 TCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQ 1835

Query: 549  SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQ 608
             +   P  +     ++V++G       +V+G P P+V W  NG  I++S+ F     G  
Sbjct: 1836 KEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI- 1894

Query: 609  HSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
            H L I +    DTG     A N  G +  +  L +Q+  D
Sbjct: 1895 HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1934



 Score =  105 bits (261), Expect = 5e-22
 Identities = 82/329 (24%), Positives = 136/329 (41%), Gaps = 32/329 (9%)

Query: 427  ENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ 486
            +N      C    +++  P FSS       ++  +  L+C + GTP   + W  + + ++
Sbjct: 5499 QNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLR 5558

Query: 487  YARSTCEAGV---AELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYL 543
             ++    A       +HI +    D G Y C A+N +G  +C   V + E          
Sbjct: 5559 SSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKE---------- 5608

Query: 544  LPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNE-IQESEDFHF 602
                      P F+  L+ L V+ G    +   + G  P  V WL    E I+ESE+   
Sbjct: 5609 ---------PPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRI 5659

Query: 603  EQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVT 662
                   +L   +  P + G Y C+  N  G     A L V EP        + K   +T
Sbjct: 5660 TFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEP-----AVIVEKAGPMT 5714

Query: 663  ASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQ 722
             ++G++  + C +AG P  +V W +DGK L     H     N+ + +L +  V+   AG 
Sbjct: 5715 VTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNK-ISSLRILSVERQDAGT 5773

Query: 723  YEILLKNRVGECSCQVSLMLQNSSARALP 751
            Y   ++N VG+ SC     + + S RA+P
Sbjct: 5774 YTFQVQNNVGKSSCTA---VVDVSDRAVP 5799



 Score =  102 bits (253), Expect = 4e-21
 Identities = 81/314 (25%), Positives = 133/314 (42%), Gaps = 27/314 (8%)

Query: 434  RCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI----QYAR 489
            RC  L  ++   + +       V +G    LQ    GT      W  +GQ +    +Y  
Sbjct: 4568 RCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKI 4627

Query: 490  STCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPS 549
            S  +  V+ L I     +D G YT   +N +G+ SC A + V         + ++P    
Sbjct: 4628 SVTDT-VSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINV--------LDLIIP---- 4674

Query: 550  KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQH 609
                P F + L  +  + GS + +   V+G+ P  + W  +  EI  SE + F       
Sbjct: 4675 ----PSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTA 4730

Query: 610  SLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSV 669
             L I ++   D+GTYTC A N AG  +    LTV+EP     P+F+ KP+S   +    V
Sbjct: 4731 FLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEP-----PYFVEKPQSQDVNPNTRV 4785

Query: 670  LISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKN 729
             +   + G    T+ W +D K L        V +++   +L L   +   +G Y   L N
Sbjct: 4786 QLKALVGGTAPMTIKWFKDNKELHSGAAR-SVWKDDTSTSLELFAAKATDSGTYICQLSN 4844

Query: 730  RVGECSCQVSLMLQ 743
             VG  + + +L ++
Sbjct: 4845 DVGTATSKATLFVK 4858



 Score =  102 bits (253), Expect = 4e-21
 Identities = 57/185 (30%), Positives = 97/185 (52%), Gaps = 7/185 (3%)

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAA 1231
             +++ E  K RAG SV+L   ++G    T  W K  K++Q +  + VEN+ + + + I  A
Sbjct: 26876 LEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDA 26935

Query: 1232  RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGG 1291
              + + GCY L + N +GS  A + + ++DKP PP G      + +  +TL W   + DGG
Sbjct: 26936 DRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGG 26995

Query: 1292  SAVQSYSIEIWDSANKTW----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             + +  Y +E  +++   W    + L  C  T+  +   +  +EY FRVRA+N YG  EP 
Sbjct: 26996 AKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI---IKGNEYIFRVRAVNKYGIGEPL 27052

Query: 1348  QESEL 1352
             +   +
Sbjct: 27053 ESDSV 27057



 Score =  101 bits (252), Expect = 6e-21
 Identities = 76/249 (30%), Positives = 112/249 (44%), Gaps = 8/249 (3%)

Query: 1167  MPPQI---IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENG 1223
             +PP +   ++  E   V+AG +V     + G    T  W     +I+  EH  VE     
Sbjct: 17506 VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 17565

Query: 1224  SKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSW 1283
             S LTI    +   G Y + V N  GS+   V+LTV+D P PP G     D+    +T+SW
Sbjct: 17566 SVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISW 17625

Query: 1284  YGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQDLLPDHEYKFRVRAINVYG 1342
                  DGGS V +Y +E  D+   TW  +++  S T   +  L    EY FRVRA N  G
Sbjct: 17626 QPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIG 17685

Query: 1343  TSEPSQESELTTVGEK--PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEER 1400
                P  +S  T    K  P  P  +  V+D  E    V +     +    ++ +Y +E R
Sbjct: 17686 VG-PPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYY-MERR 17743

Query: 1401  LGSGKFGQV 1409
               +GK+ +V
Sbjct: 17744 EVTGKWVRV 17752



 Score =  101 bits (252), Expect = 6e-21
 Identities = 58/205 (28%), Positives = 104/205 (50%), Gaps = 6/205 (2%)

Query: 1162  PPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE 1221
             PP+ +M P+   + +   V AGES ++   + G    T  W+K  +++  +  +++++++
Sbjct: 22540 PPRISMDPK---YKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTD 22596

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
               + L++  A +   G Y L  +N  G R   VN+ V+D+P PP G    S + +   TL
Sbjct: 22597 FATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTL 22656

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             +W     DGGS + +Y +E  +++   W  + A  ++ S  V  LL  +EY FR+ A+N 
Sbjct: 22657 AWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNK 22716

Query: 1341  YGTSEPSQESELTTVGE--KPEEPK 1363
             YG  EP +   +        P+ PK
Sbjct: 22717 YGVGEPLESEPVVAKNPFVVPDAPK 22741



 Score =  101 bits (251), Expect = 7e-21
 Identities = 78/253 (30%), Positives = 112/253 (44%), Gaps = 15/253 (5%)

Query: 1174  FPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQ 1233
             F +   VRAG S+ LF    G    T  W K    +  S    +  +++ S LT+    +
Sbjct: 28363 FKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNR 28420

Query: 1234  EHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSA 1293
                G YTL VEN  GS+     + V+D P PP G     D+   S TL W     DGG+ 
Sbjct: 28421 NDAGKYTLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATLMWDAPLLDGGAR 28479

Query: 1294  VQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESEL 1352
             +  Y +E  +++ ++W+ ++  C    F V DL     Y FRV A+N YG  EP +  E 
Sbjct: 28480 IHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 28539

Query: 1353  TTVGEKPEEPK--DEVEVSDDDE----KEPEVD----YRTVTINTEQKVSDFYDIEERLG 1402
                 E+P  P+  D V+ S         +P+ D         +   QK SDF+ +E    
Sbjct: 28540 IVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFW-VEAGHT 28598

Query: 1403  SGKFGQVFRLVEK 1415
                   V RLVEK
Sbjct: 28599 KQLTFTVERLVEK 28611



 Score =  100 bits (250), Expect = 1e-20
 Identities = 82/305 (26%), Positives = 118/305 (38%), Gaps = 29/305 (9%)

Query: 443  VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGVAEL 499
            + PSF+  LK    I+G    L+C V G+    I W  + Q I  +     +     A L
Sbjct: 4673 IPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFL 4732

Query: 500  HIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQG 559
             I      D GTYTC A N  G   CS  +TV E                    P F++ 
Sbjct: 4733 EISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEP-------------------PYFVEK 4773

Query: 560  LSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPE 619
                 V   ++V +   V G  P  + W  +  E+         +  T  SL +      
Sbjct: 4774 PQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKAT 4833

Query: 620  DTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSV-TASLGQSVLISCAIAGD 678
            D+GTY C+  N  G   ++A L V+EP     P FI KP  V     GQS    C I G 
Sbjct: 4834 DSGTYICQLSNDVGTATSKATLFVKEP-----PQFIKKPSPVLVLRNGQSTTFECQITGT 4888

Query: 679  PFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQV 738
            P   V W  DG  +     H  +   + + T  +   +  ++G Y    +N  G  SC +
Sbjct: 4889 PKIRVSWYLDGNEITAIQKH-GISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSI 4947

Query: 739  SLMLQ 743
             L ++
Sbjct: 4948 ELKVK 4952



 Score =  100 bits (250), Expect = 1e-20
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 20/255 (7%)

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAA 1231
             ++F +   ++AGE+  L   V+G  P T  W K  K+++ +  ++++ ++  + L    +
Sbjct: 21465 VKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS 21524

Query: 1232  RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGG 1291
              +   G YTL   N  G  +   N+ V+D+P PP G    +++ S    LSW+    DGG
Sbjct: 21525 TRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGG 21584

Query: 1292  SAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
             + +  Y ++  +++   W  +A+  + T   V  LL  +EY FRV A+N YG  EP +  
Sbjct: 21585 AKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESE 21644

Query: 1351  ELTTVGE--KPEEPKD-EVEVSDDDEK-----EPEVDYRTVTINTEQKVSDFYDIEERLG 1402
              +  V     P+ PK+ EV     D        P+ D  +  IN        Y +E R  
Sbjct: 21645 PVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIIN--------YIVERR-- 21694

Query: 1403  SGKFGQVFRLVEKKT 1417
               K GQ +    KKT
Sbjct: 21695 -DKAGQRWIKCNKKT 21708



 Score =  100 bits (249), Expect = 1e-20
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V AGE +++     G      TW K    ++++  +  E++EN S LTI  A +E  G Y
Sbjct: 22159 VLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHY 22218

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + + N  G     +N+ V+DKP PP G     ++ + S+TLSW    YDGGS++ +Y +
Sbjct: 22219 VVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIV 22278

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTS 1344
             E  D++  TW+ + AT   T+     L    EY+FR+ A N YG S
Sbjct: 22279 EKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKS 22324



 Score =  100 bits (248), Expect = 2e-20
 Identities = 76/305 (24%), Positives = 116/305 (38%), Gaps = 60/305 (19%)

Query: 443  VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI----QYARSTCEAGVAE 498
            V   F S +K+  ++EG      C + G P+P+I W  +G+ I    +Y     + G A 
Sbjct: 1289 VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRAS 1348

Query: 499  LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEY---LLPVAPSKPTAP- 554
            L I   LPED G YT  A N  G   CS  + V          Y   L PV+  +  +P 
Sbjct: 1349 LRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPR 1408

Query: 555  -------------------------------------------------IFLQGLSDLKV 565
                                                             +F+      K 
Sbjct: 1409 SVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKC 1468

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEI--QESEDFHFEQRGTQHSLCIQEVFPEDTGT 623
            ++G      ++V G P PE  W H+G +I    +     ++ GTQ SL I    P D+G 
Sbjct: 1469 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ-SLIIVPATPSDSGE 1527

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
            +T  A N AG      +LTV+      +P F+ K ++V    G  + +     G+P P +
Sbjct: 1528 WTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDI 1587

Query: 684  HWLRD 688
             WL++
Sbjct: 1588 VWLKN 1592



 Score =  100 bits (248), Expect = 2e-20
 Identities = 66/237 (27%), Positives = 109/237 (45%), Gaps = 19/237 (8%)

Query: 1167  MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF-------RKQIQESEHMKVEN 1219
             MPP I    E  +V  G +V +  K+ G    T TW K        ++ +    H+    
Sbjct: 16116 MPPSI-DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLV 16174

Query: 1220  SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSL 1279
              ++   L I  +R+   G YT+   N LG+   ++ L V+ +P PP G      + +  +
Sbjct: 16175 VDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQM 16234

Query: 1280  TLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAI 1338
             TLSW+    DGGS + +Y IE  ++  KTW  +++  +  ++ +  LL  HEY FR+ A 
Sbjct: 16235 TLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQ 16294

Query: 1339  NVYGTSEPSQESELTTVGEKPEEPKD--EVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             N YG  EP        +  +PE  ++   V  + D      V   ++T+N E+   D
Sbjct: 16295 NKYGIGEP--------LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYD 16343



 Score = 99.4 bits (246), Expect = 3e-20
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 4/189 (2%)

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
             P+ +M P+   F +   V AGE+  L   V G    T  W++  K+I+ES   +++N++ 
Sbjct: 23623 PRISMDPK---FRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 23679

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLS 1282
              + L +  A +   G Y L   N  GS+   VN+ V+D+P PP G    + + S   +L+
Sbjct: 23680 KALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLT 23739

Query: 1283  WYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVY 1341
             W     DGGS +  Y +E  +++   W  +A+   + S  V  LL  +EY FR+ A+N Y
Sbjct: 23740 WSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKY 23799

Query: 1342  GTSEPSQES 1350
             G  EP + +
Sbjct: 23800 GVGEPLESA 23808



 Score = 99.0 bits (245), Expect = 4e-20
 Identities = 98/385 (25%), Positives = 150/385 (38%), Gaps = 54/385 (14%)

Query: 302  RGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGL 361
            R  SP +  +    P  E   E+       A     L  TSS     A ++    +AP  
Sbjct: 810  RTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSS-----AQKITKSVKAP-- 862

Query: 362  GVLSPSGEERKRPAPPRPATFP------TRQPGLGSQDVVSKAANRRIPMEGQRDSAFPK 415
              + PS E R R  P     FP      T +   G +  V K     I     R+  F  
Sbjct: 863  -TVKPS-ETRVRAEPTPLPQFPFADTPDTYKSEAGVE--VKKEVGVSITGTTVREERFEV 918

Query: 416  FESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPR 475
               +    E K  +T +     + +    P+  S LK+  VIEG+   L+C + G P P 
Sbjct: 919  LHGR----EAKVTETARVPAP-VEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPT 973

Query: 476  ITWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVH 532
            +TW      I+ +   + T ++G+A L I++A  ED G +TC A N  G VS S ++ V 
Sbjct: 974  VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ 1033

Query: 533  -----EKKSSRKSEYLLP----------------------VAPSKPTAPIFLQGLSDLKV 565
                 EK+++  +E                            P +P AP F+      K+
Sbjct: 1034 VSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKL 1093

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF--HFEQRGTQHSLCIQEVFPEDTGT 623
            ++G  V    QV GNP P V W  +G  +     +   + ++  +  L I   F +D G 
Sbjct: 1094 VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGE 1153

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHD 648
            YT    N  GE    A L  +  ++
Sbjct: 1154 YTIVVRNKHGETSASASLLEEADYE 1178



 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 76/307 (24%), Positives = 121/307 (39%), Gaps = 28/307 (9%)

Query: 441  MEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAG----V 496
            M+ AP     ++   V  G      C ++  P  R  W   G+ I Y    C       +
Sbjct: 3452 MKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREI-YESDKCSIRSSKYI 3510

Query: 497  AELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIF 556
            + L I      D G YTC A N  G VSC+A +TV E                    P F
Sbjct: 3511 SSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTE-----------------AYPPTF 3553

Query: 557  LQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEV 616
            L     L    G        V+G P  E IW  +G  +  S ++       +H L +  +
Sbjct: 3554 LSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNL 3613

Query: 617  FPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIA 676
              +D G Y+C+A N  G    QA L + +     +P FI +   V +++ + V + C + 
Sbjct: 3614 TIQDRGVYSCKASNKFGADICQAELIIID-----KPHFIKELEPVQSAINKKVHLECQVD 3668

Query: 677  GDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSC 736
             D   TV W +DG+ L      +++   + + TL +   +   +G Y     N  G  SC
Sbjct: 3669 EDRKVTVTWSKDGQKL-PPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSC 3727

Query: 737  QVSLMLQ 743
              ++ ++
Sbjct: 3728 SATVTVR 3734



 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 55/168 (32%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VR G +V L     G    + +W+K    ++ESE ++   +EN   L+I  A++EH G Y
Sbjct: 27575 VRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKY 27634

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T++++N +      + +  +  P  P G     +I++ S+ LSW     +GG  +  YSI
Sbjct: 27635 TVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSI 27694

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             E  +++   WK + ++   T+F V +L+ D EY+FRVRA N YG S+P
Sbjct: 27695 EKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQP 27742



 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 56/168 (33%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+AG +V L   V G    T +W K    ++ +E +K+    N   L + +  ++  G Y
Sbjct: 19307 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 19366

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T+  EN  GS+ A + L V+DKP PPA     + + S    LSW     DGGS + +Y +
Sbjct: 19367 TITAENSSGSKSATIKLKVLDKPGPPASVK-INKMYSDRAMLSWEPPLEDGGSEITNYIV 19425

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             +  +++   W ++ AT   TS +V+ L+  HEY+FR+ A N YG  +P
Sbjct: 19426 DKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP 19473



 Score = 96.3 bits (238), Expect = 2e-19
 Identities = 57/211 (27%), Positives = 97/211 (45%), Gaps = 7/211 (3%)

Query: 1159  PKTPPKAAMPPQI-IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKV 1217
             P T      PP + + F +   +R GE+  L G+ +G      +W K    + E +   +
Sbjct: 16808 PITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHI 16867

Query: 1218  ENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSS 1277
             + +     L  + A++   G Y ++VEN  GSR+    + VVD+P PP G     ++   
Sbjct: 16868 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKD 16927

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQDLLPDHEYKFRVR 1336
              + +SW     DGGS + +Y IE  +     W  + +  + T+  V  LL   +Y FR+ 
Sbjct: 16928 YMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIH 16987

Query: 1337  AINVYGTSEPSQESELTT-----VGEKPEEP 1362
             A N+YG S+P     +       V + P++P
Sbjct: 16988 AENLYGISDPLVSDSMKAKDRFRVPDAPDQP 17018



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 158/697 (22%), Positives = 252/697 (36%), Gaps = 128/697 (18%)

Query: 21   PSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFL 80
            P +++  P  EAP      ++  + +G+ A F  RV G P+P+  W++NG  I    R  
Sbjct: 2066 PDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIY 2125

Query: 81   LDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTL 140
                      LVI  V  ED      +A N +G       L V+   AKQL         
Sbjct: 2126 WYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ---AKQL--------- 2173

Query: 141  GDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQ-MGRFSCKITGRPQPQVTWLKGNV 199
                                  F  +L  VV KE   M  F C+ T  P  +V W K  +
Sbjct: 2174 --------------------ITFTQELQDVVAKEKDTMATFECE-TSEPFVKVKWYKDGM 2212

Query: 200  PLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRS 259
             +    +  +     +  L I  ++  D   Y+C++V        +A+L ++G   A   
Sbjct: 2213 EVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN-VKTTAKLIVEG---AVVE 2268

Query: 260  FVRETKATN--SDVRKEVTNVISKES-----KLDSLEAAAKSKNCSSPQRGGSPPWAANS 312
            FV+E +          E+  ++S E+       + +E  +  K   + +RG       + 
Sbjct: 2269 FVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDV 2328

Query: 313  QPQPPRE------SKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAP---GLGV 363
              +   E       K  +CK   +  P   +LQ  S     +   VQ E +       GV
Sbjct: 2329 TKEDQGEYSFVIDGKKTTCKLKMKPRP-IAILQGLSDQKVCEGDIVQLEVKVSLESVEGV 2387

Query: 364  LSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQ 423
                G+E               QP      V+ K ++  +  +  ++ A           
Sbjct: 2388 WMKDGQEV--------------QPSDRVHIVIDKQSHMLLIEDMTKEDA----------- 2422

Query: 424  EVKENQTVKFRCEGLAVMEVAPSFS----SVLKDCAVIEGQDFVLQCSVRGTPVPRITWL 479
                N +      GL+       +S    + LKD  VIEG   VL+C V    V  + W 
Sbjct: 2423 ---GNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWY 2479

Query: 480  LNGQPIQ---YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKS 536
            LN + I+     ++  +     L I      D G Y  +    +G+V  +  ++V + K 
Sbjct: 2480 LNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLI----VGRVETNCNLSVEKIK- 2534

Query: 537  SRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQE 596
                                ++GL DL   +   V   V++S +   +V+W     EI+ 
Sbjct: 2535 -------------------IIRGLRDLTCTETQNVVFEVELS-HSGIDVLWNFKDKEIKP 2574

Query: 597  SEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS 656
            S  +  E  G  + L +  +  +D G YT      AGE  T   LTV           IS
Sbjct: 2575 SSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAGENMTSGKLTV-------AGGAIS 2623

Query: 657  KP-RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL 692
            KP    T +  Q  +  C +A +P     WLRDGK L
Sbjct: 2624 KPLTDQTVAESQEAVFECEVA-NPDSKGEWLRDGKHL 2659



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 69/265 (26%), Positives = 127/265 (47%), Gaps = 11/265 (4%)

Query: 1145  LGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
             +G    + + +    K P      P I     D  V  GE + +          T +W K
Sbjct: 14366 IGVSEPSEISENVVAKDPD---CKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHK 14422

Query: 1205  FRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP 1264
               K+++ S+ + ++N    + L +  + +   G YT+ +ENKLGS  A +N+ V+  P P
Sbjct: 14423 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGP 14482

Query: 1265  PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQ 1323
                   ASDI  SS  L+W    +DGG+ +  Y +E  ++  +T+  + +  +  S+ V+
Sbjct: 14483 CKDIK-ASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVK 14541

Query: 1324  DLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKD---EVEVSDDDEKEPEVDY 1380
             DL+P+ EY FRV+A+N  G  E   E +   + + P++P D   +VEV +   +   + +
Sbjct: 14542 DLIPNGEYFFRVKAVNKVGGGE-YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITW 14600

Query: 1381  RTVTINTEQKVSDFYDIEERLGSGK 1405
             +    +   K+  +  I E++  G+
Sbjct: 14601 KPPLYDGGSKIMGY--IIEKIAKGE 14623



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 64/229 (27%), Positives = 117/229 (51%), Gaps = 20/229 (8%)

Query: 531   VHEK--KSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWL 588
             VHE+  K+S+ SE +   A  K  +       + + + +G ++ +   ++G    +V W+
Sbjct: 33021 VHEEITKTSQASEEVRTHAEIKAFS-------TQMSINEGQRLVLKANIAG--ATDVKWV 33071

Query: 589   HNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
              NG E+  SE++ +   G+  +L I++    D G  TC +    G V+ Q  LT+ +   
Sbjct: 33072 LNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELS 33131

Query: 649   GTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVF 708
                P FIS+PRS   + GQ+VL +C I+G+P P + W ++   +   + +  + ++ +V+
Sbjct: 33132 DA-PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISSNVSISRSRNVY 33189

Query: 709   TLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPA 757
             +L ++      +G+Y I  KN  G+CS   SLM+       LP   EP+
Sbjct: 33190 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV-------LPLVEEPS 33231



 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 65/220 (29%), Positives = 111/220 (50%), Gaps = 17/220 (7%)

Query: 1180  VRAGESVELFG-KVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
             ++AG+++ L    + G      +W K  K I+ S+  ++ ++   S LTI  A ++  G 
Sbjct: 20390 IKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGE 20449

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYS 1298
             YT+   N  G++   V +TV+D P PP G    S++ +   TL+W     DGGS ++SY 
Sbjct: 20450 YTITATNPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKATLTWTPPLEDGGSPIKSYI 20508

Query: 1299  IEIWDSANKTW----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTT 1354
             +E  +++   W    +++ +CR  +     L+  +EY FRV A+N YG  EP Q   +  
Sbjct: 20509 LEKRETSRLLWTVVSEDIQSCRHVA---TKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKM 20565

Query: 1355  VGE-KPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             V    P  P ++ EVS+       V   T T++ ++ V D
Sbjct: 20566 VDRFGPPGPPEKPEVSN-------VTKNTATVSWKRPVDD 20598



 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 79/293 (26%), Positives = 125/293 (42%), Gaps = 29/293 (9%)

Query: 475   RITWLLNGQPIQYARS---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 531
             ++TW    + ++ +     T E GVA L+++D    D GTY C   N  G+ S  A + V
Sbjct: 31599 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 31658

Query: 532   HE-------------KKSSRKSEYL-LPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQV 577
                            KK  R+++ + L   P + T P++     +     G  V   V +
Sbjct: 31659 KGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLY-----NKTAYVGENVRFGVTI 31713

Query: 578   SGNPPPEVIWLHNGNEIQESED---FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE 634
             + +P P V W  +G +I+  ++   + FE     + L I  V  +D   YT  A N  GE
Sbjct: 31714 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 31773

Query: 635   VRTQAVLTVQ---EPHDGT-QPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGK 690
                +A LTV     P D T +P F     +     GQSV     ++G P PT+ W +DG+
Sbjct: 31774 DSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQ 31833

Query: 691   ALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
              L        + +  D + L ++   P   G Y +   N  G  SCQ  L ++
Sbjct: 31834 PLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31886



 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 64/231 (27%), Positives = 105/231 (45%), Gaps = 5/231 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VRAG S+ +F  + G      TW K    I       +EN+E+ + L I    +   G +
Sbjct: 20788 VRAGLSIRIFVPIKGRPAPEVTWTK--DNINLKNRANIENTESFTLLIIPECNRYDTGKF 20845

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + +EN  G +   VN+ V+D P P       +DI   S+TL W     DGGS + +Y +
Sbjct: 20846 VMTIENPAGKKSGFVNVRVLDTPGPVLNLR-PTDITKDSVTLHWDLPLIDGGSRITNYIV 20904

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++  K++    T C   ++ V  L    EY FRV A N YG  EP++ +E     E 
Sbjct: 20905 EKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEA 20964

Query: 1359  PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQV 1409
             P  P D + + D  +    + +     +   K++ +    +R GS ++  +
Sbjct: 20965 P-SPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI 21014



 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 4/186 (2%)

Query: 1162  PPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE 1221
             PP+  M    ++F +   V+AGE +++   + G      +W K   +I+E    ++ +++
Sbjct: 25786 PPRVMMD---VKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTD 25842

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
             N + LT+    +   G Y L ++N  G+R   VN  V+DKP PPAG    + + +   +L
Sbjct: 25843 NHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSL 25902

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             SW     DGG+ +  Y +E  ++++  W       + TS  V  LL  +EY FRV  +N 
Sbjct: 25903 SWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNK 25962

Query: 1341  YGTSEP 1346
             YG  EP
Sbjct: 25963 YGVGEP 25968



 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 131/586 (22%), Positives = 204/586 (34%), Gaps = 111/586 (18%)

Query: 161   PKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEI 220
             P+   ++    V  GQ  RF   +  +P  +V W    V LQ S+++  +  +G+  LEI
Sbjct: 32374 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEI 32433

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSAN----------------------- 257
                + DD G Y  +  N  G+AS  A L + G D                          
Sbjct: 32434 LDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA 32493

Query: 258   --------------RSFVRETKATNSDVRKEVTNVI-SKESKLDSLEAAAKSKNCSSPQR 302
                            S VRE K+  ++ R+ +++   S  +++ S     KS    S  R
Sbjct: 32494 YAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTR 32553

Query: 303   GGSPPWAANSQPQPPR------ESKLESCKDSPRTAPQTPVLQK--------------TS 342
                   AA    +P        ES   SC       P    L+K              T 
Sbjct: 32554 KIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTK 32613

Query: 343   SSITLQAARVQPEPRAPGLGVLSPS-GEE--------RKRPAPPRPATFPTR----QPGL 389
                T + + VQ         V+  S G++        +K     +  T P R    +P +
Sbjct: 32614 YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRV 32673

Query: 390   GSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSS 449
              S + V      + P E     A    E+KP   E  ++  V             P  + 
Sbjct: 32674 KSPEAVKSPKRVKSP-EPSHPKAVSPTETKPTPTEKVQHLPVS----------APPKITQ 32722

Query: 450   VLKDCAVIEGQDFVLQCSVRGTPV--PRITWLLNGQPIQ----YARSTCEAGVAELHIQD 503
              LK  A    +   L C V  + +    +TW  +G+ ++    +       G  EL I +
Sbjct: 32723 FLK--AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINN 32780

Query: 504   ALPEDHGTYTCLAENALG------QVSCSAWVTVHEK--------KSSRKSEYLLPVAPS 549
                 D G Y C      G      Q    A+ ++HEK        KS +K+        +
Sbjct: 32781 LTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKT 32840

Query: 550   KPTAP-------IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHF 602
             +P AP       + + GL D  V   S     V+ +G P P  IW  +G  I +   +  
Sbjct: 32841 EPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKL 32900

Query: 603   EQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
              +      L I +    D+G YTC   NSAG V +   LT++   D
Sbjct: 32901 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKD 32946



 Score = 94.4 bits (233), Expect = 9e-19
 Identities = 76/291 (26%), Positives = 118/291 (40%), Gaps = 25/291 (8%)

Query: 456  VIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTY 512
            V  G    L+ +V GTP  +  W  +G+P+  +   R + +  VA+L    A   D G Y
Sbjct: 4028 VTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQY 4087

Query: 513  TCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVT 572
            T    N +G  SC    TV ++                  AP F + L ++  +      
Sbjct: 4088 TFEISNEVGSSSCETTFTVLDRD----------------IAPFFTKPLRNVDSVVNGTCR 4131

Query: 573  MTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSA 632
            +  +++G+ P  V W  +G EI  S+ +         SL I  V   D G +TC A NS 
Sbjct: 4132 LDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSV 4191

Query: 633  GEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL 692
            G   +   L VQEP     P F++KP S     G +V +     G    T+ W +  K L
Sbjct: 4192 GSKDSSGALIVQEP-----PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKEL 4246

Query: 693  CKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
                G   + +     +L L  V+   +G Y   + N  G   C  +L ++
Sbjct: 4247 VSG-GSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVK 4296



 Score = 94.4 bits (233), Expect = 9e-19
 Identities = 65/215 (30%), Positives = 105/215 (48%), Gaps = 12/215 (5%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             +RAG S+ L   V+G  P   TW K  + I  +    ++ +E+ S L +    +   G Y
Sbjct: 29458 IRAGASLRLMVSVSGRPPPVITWSK--QGIDLASRAIIDTTESYSLLIVDKVNRYDAGKY 29515

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T+  EN+ G + A V + V D P P        ++   S+T++W   + DGG+ V +Y +
Sbjct: 29516 TIEAENQSGKKSATVLVKVYDTPGPCPSVK-VKEVSRDSVTITWEIPTIDGGAPVNNYIV 29574

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++A + +K + T C  T + +  L+    Y FRV   N+YG  EP + S+   V E 
Sbjct: 29575 EKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEV 29634

Query: 1359  PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             P  P  ++EV D       V   TVT+  E+ + D
Sbjct: 29635 PLVPA-KLEVVD-------VTKSTVTLAWEKPLYD 29661



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 58/184 (31%), Positives = 91/184 (49%), Gaps = 4/184 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+A E +++     G    T  W K  + ++E+  + V +S+  + L+I  A +E  G Y
Sbjct: 25406 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 25465

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              L V N  GS    + + V+D+P PP G     ++   S+T+SW    YDGG  + +Y +
Sbjct: 25466 ELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSCDSITISWNPPEYDGGCQISNYIV 25524

Query: 1300  EIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++ + TW  ++     TS  +  L    EY+FRV A N YG S  S+ S    V E 
Sbjct: 25525 EKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESS--AVVAEY 25582

Query: 1359  PEEP 1362
             P  P
Sbjct: 25583 PFSP 25586



 Score = 93.2 bits (230), Expect = 2e-18
 Identities = 77/338 (22%), Positives = 134/338 (39%), Gaps = 25/338 (7%)

Query: 423  QEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNG 482
            Q +  N+     C     ++  PSF   +++   +       Q +V G+P   ITWL + 
Sbjct: 5026 QCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDD 5085

Query: 483  QPIQYARSTCEA---GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRK 539
            Q +    +   +    VA L I+       G YTC A+N  G   C A++ V E      
Sbjct: 5086 QILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQ--- 5142

Query: 540  SEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED 599
                             ++    + V +   +T+   V+G P  +V WL +G +I  S  
Sbjct: 5143 ----------------IVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRY 5186

Query: 600  FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPR 659
            F         S  IQ V  +D+G YT +  N  G     A L V +      P F  K  
Sbjct: 5187 FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLD--QNIPPSFTKKLT 5244

Query: 660  SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             +   LG S+ + C ++G    +  W +DGK +   +  + ++ +E   +L +  ++   
Sbjct: 5245 KMDKVLGSSIHMECKVSGSLPISAQWFKDGKEI-STSAKYRLVCHERSVSLEVNNLELED 5303

Query: 720  AGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPA 757
               Y   + N  G+ +C   L ++   +  +  GR+ A
Sbjct: 5304 TANYTCKVSNVAGDDACSGILTVKEPPSFLVKPGRQQA 5341



 Score = 93.2 bits (230), Expect = 2e-18
 Identities = 60/199 (30%), Positives = 97/199 (48%), Gaps = 12/199 (6%)

Query: 1181  RAGESVELFGKVTGTQPITCTWM---KFRKQIQESEH-----MKVENSENGSKLTILAAR 1232
             +AG  + +   + G      +W    K +K +++  H      ++E +EN S + I   +
Sbjct: 15823 KAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECK 15882

Query: 1233  QEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGS 1292
             + H G Y++  +NK G + A   + V+D P PP      SDI   S  LSW     DGG 
Sbjct: 15883 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK-VSDITRGSCRLSWKMPDDDGGD 15941

Query: 1293  AVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESE 1351
              ++ Y IE      K W ++   C ST+F V DLL + +Y FRVRA N +G   P +  +
Sbjct: 15942 RIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQ 16001

Query: 1352  LTTVGEK--PEEPKDEVEV 1368
              TT  +   P +P  ++++
Sbjct: 16002 RTTARDPIYPPDPPIKLKI 16020



 Score = 92.8 bits (229), Expect = 3e-18
 Identities = 60/220 (27%), Positives = 102/220 (46%), Gaps = 36/220 (16%)

Query: 33   PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
            P F L P ++ +  G +  F+  V G    ++TW ++ + I  GG + +   +  T +L 
Sbjct: 7212 PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTL-VENTATLT 7270

Query: 93   IHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETR 152
            +  V + D G+YTC A+N +G    + +L V+                            
Sbjct: 7271 VLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQE--------------------------- 7303

Query: 153  PSIWGECPPKFATKLGRV-VVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSE 211
                   PP+F  KL    +VK+ +  R+ CKI G P+ +V W K    +Q S++  +S 
Sbjct: 7304 -------PPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSF 7356

Query: 212  KNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQ 251
             + + VLE+H ++ +D G YTC   N +G AS S  L ++
Sbjct: 7357 VDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVK 7396



 Score = 92.4 bits (228), Expect = 3e-18
 Identities = 58/210 (27%), Positives = 105/210 (50%), Gaps = 6/210 (2%)

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESE-HMKVENSE 1221
             P A++ P+   + +   V AGE+  L   + G       W K  K+++E+   M+++++ 
Sbjct: 24705 PNASLDPK---YKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTI 24761

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
               + L +    +   G Y L + N  G++   + + V+D+P PP G    + + +    L
Sbjct: 24762 QKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYL 24821

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINV 1340
             +W     DGG+ +  Y IE  +++  +W +++T  ++ ++ V  LLP +EY FRV A+N 
Sbjct: 24822 AWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNK 24881

Query: 1341  YGTSEPSQESELTTVGE-KPEEPKDEVEVS 1369
             YG  EP +   +T     KP  P    EVS
Sbjct: 24882 YGIGEPLESGPVTACNPYKPPGPPSTPEVS 24911



 Score = 92.4 bits (228), Expect = 3e-18
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 7/197 (3%)

Query: 1147  TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
             T +  TV+      T   + MP + I  P      AG  VEL   + G  P   +W    
Sbjct: 29723 TVTAVTVQDLRVLPTIDLSTMPQKTIHVP------AGRPVELVIPIAGRPPPAASWFFAG 29776

Query: 1207  KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPA 1266
              +++ESE + VE     +KLTI        G YTL ++N  G+    + + ++DKP PP 
Sbjct: 29777 SKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPT 29836

Query: 1267  GTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA-TCRSTSFNVQDL 1325
             G     +I ++S+T+SW     DGG+ +  Y +E  D+    W  ++ +   ++F    L
Sbjct: 29837 GPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRL 29896

Query: 1326  LPDHEYKFRVRAINVYG 1342
                +EY FRV A N +G
Sbjct: 29897 TEGNEYVFRVAATNRFG 29913



 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 76/236 (32%), Positives = 105/236 (44%), Gaps = 16/236 (6%)

Query: 27   MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
            +P+T  P  +   +N+ + EG +   E  + GYP P VTW+R    I S   F +     
Sbjct: 938  IPVTP-PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQ-S 995

Query: 87   GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK---TLGDR 143
            G   L+I     ED G++TC A N +G    +  L V+ S   +     V++   T   R
Sbjct: 996  GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKR 1055

Query: 144  F--SAPAVETRPSIWGE-------CPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTW 194
            F  S   V T  S+  E         P F TK     + EG    F C++ G P+P V W
Sbjct: 1056 FVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYW 1115

Query: 195  LKGNVPLQPSAR--VSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAEL 248
             K  VPL    R  VS +++ G   L I     DD G YT +V N  G+ S SA L
Sbjct: 1116 KKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 80/308 (25%), Positives = 119/308 (38%), Gaps = 37/308 (12%)

Query: 449  SVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-----RSTCEAGVAELHIQD 503
            S+ K+  VIE Q  V++  V    V    W  +G  I +      +   E  +  + I +
Sbjct: 3151 SIKKEVQVIEKQRAVVEFEVNEDDVDA-HWYKDGIEINFQVQERHKYVVERRIHRMFISE 3209

Query: 504  ALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDL 563
                D G YT +A                    +R S  L   AP  P     LQ L  +
Sbjct: 3210 TRQSDAGEYTFVAGR------------------NRSSVTLYVNAPEPPQV---LQELQPV 3248

Query: 564  KVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGT 623
             V  G        +SG P P++ W      +       F   G +++L + E FPED   
Sbjct: 3249 TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAV 3308

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPH----DGTQPWF----ISKPRSVTASLGQSVLISCAI 675
            YTCEA N  G   T A L+V+ P     D   P +    I+  +    S GQ     C +
Sbjct: 3309 YTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRV 3368

Query: 676  AGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECS 735
            +G       + +D K   K +  F + Q ED + L + +  P   G Y  +  N VG+ S
Sbjct: 3369 SGTDLKVSWYSKDKK--IKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVS 3426

Query: 736  CQVSLMLQ 743
               +L L+
Sbjct: 3427 STANLSLE 3434



 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 64/227 (28%), Positives = 106/227 (46%), Gaps = 6/227 (2%)

Query: 1181  RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYT 1240
             +AGE V++     G  P T TW K  K +       +EN+++ S LTI    +   G Y 
Sbjct: 27284 KAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYI 27343

Query: 1241  LLVENKLGS-RQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             L +EN +G  + + V++ V+D P           +   ++TL W     DGGS + +Y I
Sbjct: 27344 LTIENGVGEPKSSTVSVKVLDTP-AACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI 27402

Query: 1300  EIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  D+  +TW  ++  C STSF + DL     + FRV A N  G  EP + +E     E 
Sbjct: 27403 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEV 27462

Query: 1359  PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGK 1405
             P  P  ++ + D  +    + +     +    ++++  + ER G G+
Sbjct: 27463 P-APIRDLSMKDSTKTSVILSWTKPDFDGGSVITEY--VVERKGKGE 27506



 Score = 91.7 bits (226), Expect = 6e-18
 Identities = 50/166 (30%), Positives = 86/166 (51%), Gaps = 1/166 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+ G+ +++   ++G    T TW K    ++++  + V +S + + L+I    ++  G Y
Sbjct: 23241 VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 23300

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + V N +G + A + +  +DKPDPP G     D+ + S+TLSW    Y GG  + +Y +
Sbjct: 23301 GITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIV 23360

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTS 1344
             +  D+    W  + AT   T+  V  L    EY+FR+ A N YG S
Sbjct: 23361 QKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS 23406



 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 59/183 (32%), Positives = 95/183 (51%), Gaps = 10/183 (5%)

Query: 1179  KVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM------KVENSENGSKLTILAAR 1232
             KV+AGE V +   VTG       W K    I++          +V  SE  ++L+I  A 
Sbjct: 15409 KVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAV 15468

Query: 1233  QEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGS 1292
             +E  G YT+   N+LGS    V++ V D+P PP      +DI++ S  L+W     +GGS
Sbjct: 15469 REDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNL-AVTDIKAESCYLTWDAPLDNGGS 15527

Query: 1293  AVQSYSIEIWDSANK--TWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQE 1349
              +  Y I+  D++ K   W+E+  T     + +  L+P+ +Y+FRVRA+N YG S+  + 
Sbjct: 15528 EITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKS 15587

Query: 1350  SEL 1352
              ++
Sbjct: 15588 DKV 15590



 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 63/190 (33%), Positives = 89/190 (46%), Gaps = 7/190 (3%)

Query: 1157  PAPKTPPKAAMPPQII---QFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESE 1213
             P P        PP++I       +Q ++ G+++ L   + G      TW K  +      
Sbjct: 17204 PEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKA 17263

Query: 1214  HMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASD 1273
              + V  +  GSKL I  A  E  G Y+L VEN  GS+   V + V+DKP PP      S+
Sbjct: 17264 RIDV--TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLE-VSE 17320

Query: 1274  IRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYK 1332
             IR  S  L+W     DGGS + +Y +E  D A+  W  L AT +  S   + L   ++Y 
Sbjct: 17321 IRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYL 17380

Query: 1333  FRVRAINVYG 1342
             FRV A N YG
Sbjct: 17381 FRVAAENQYG 17390



 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 65/207 (31%), Positives = 101/207 (48%), Gaps = 10/207 (4%)

Query: 1163  PKAA---MPPQIIQFPEDQKV---RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK 1216
             PKA    +PP+I    + +KV   RA  ++ LF  + G       W   R   +  +   
Sbjct: 21849 PKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWA--RDHGESLDKAS 21906

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS 1276
             +E++ + + L +    +   G Y L VEN  GS+ A VN+ V+D P PP       ++  
Sbjct: 21907 IESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK-VKEVTK 21965

Query: 1277  SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRV 1335
             +S+TL+W     DGGS +++Y +E  +S  K +  +AT C  TS+ V  L     Y FRV
Sbjct: 21966 TSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRV 22025

Query: 1336  RAINVYGTSEPSQESELTTVGEKPEEP 1362
              A N YG   P++ +E     E+P  P
Sbjct: 22026 LAENEYGIGLPAETAESVKASERPLPP 22052



 Score = 90.5 bits (223), Expect = 1e-17
 Identities = 78/322 (24%), Positives = 129/322 (40%), Gaps = 25/322 (7%)

Query: 425  VKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQP 484
            V  N+  K  C    +++  P+F   + D   + GQ   LQ +VRG+    +TW+   + 
Sbjct: 3904 VVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEV 3963

Query: 485  IQ---YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSE 541
            I+     + +   GVA L I D      G YTCLAEN  G  +    + V E        
Sbjct: 3964 IREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE-------- 4015

Query: 542  YLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH 601
                  P+K      ++    ++V  G   T+   V+G P  +  W  +G  +  S+ + 
Sbjct: 4016 ------PAK-----IIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYR 4064

Query: 602  FEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSV 661
               +     L        D+G YT E  N  G    +   TV +      P+F    R+V
Sbjct: 4065 ISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD--RDIAPFFTKPLRNV 4122

Query: 662  TASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAG 721
             + +  +  + C IAG     V W +DGK +   +  + +   E   +L + +V    AG
Sbjct: 4123 DSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAA-SDRYRIAFVEGTASLEIIRVDMNDAG 4181

Query: 722  QYEILLKNRVGECSCQVSLMLQ 743
             +     N VG      +L++Q
Sbjct: 4182 NFTCRATNSVGSKDSSGALIVQ 4203



 Score = 90.5 bits (223), Expect = 1e-17
 Identities = 84/289 (29%), Positives = 126/289 (43%), Gaps = 32/289 (11%)

Query: 1180  VRAGESVELFGKVTGTQPITCTW-MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
             V AG  + +   V+G  P T TW M  R   QE+    +E +   S + I   ++ H G 
Sbjct: 16536 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEAT---IETTAISSSMVIKNCQRSHQGV 16592

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTP-CASDIRSSSLTLSWYGSSYDGGSAVQSY 1297
             Y+LL +N+ G R+  + + V+D P  P GTP  A ++ + S  L+W+    DGGS + +Y
Sbjct: 16593 YSLLAKNEAGERKKTIIVDVLDVPG-PVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNY 16651

Query: 1298  SIEIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG 1356
              IE  +S  + W  +  T    +  VQ L+    Y FR+ A N  G     + SE   + 
Sbjct: 16652 VIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIR 16711

Query: 1357  EK---PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD------FYDIEERL-GSGKF 1406
             E    PE P+D +EV        EV   TVT+       D       Y +E RL G+ KF
Sbjct: 16712 EPITVPERPED-LEVK-------EVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKF 16763

Query: 1407  GQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQC 1455
                     K T      + +     KE +     +S +N +   K   C
Sbjct: 16764 -------HKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFC 16805



 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 55/184 (29%), Positives = 93/184 (50%), Gaps = 4/184 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             +RAG S+ LF  + G       W K   +I+++  + V +S   + L +    +   G Y
Sbjct: 22954 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSF--TSLVLDNVNRYDSGKY 23011

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             TL +EN  G++ A V + V+D P PP      ++I   S++++W     DGGS +++Y +
Sbjct: 23012 TLTLENSSGTKSAFVTVRVLDTPSPPVNLK-VTEITKDSVSITWEPPLLDGGSKIKNYIV 23070

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++  K++  + T C   S+ +  L     Y FRV A N YG   P+Q ++   V E 
Sbjct: 23071 EKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEV 23130

Query: 1359  PEEP 1362
             P+ P
Sbjct: 23131 PQPP 23134



 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 67/250 (26%), Positives = 113/250 (45%), Gaps = 15/250 (6%)

Query: 1159  PKTPPKAAMPPQIIQFPE---DQKVRAGESVELFGKVTGTQPIT------CTWMKFRKQI 1209
             P   P      +++++P+   D++ + G  V   G +  T PI       C W K  + I
Sbjct: 30118 PAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI 30177

Query: 1210  QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTP 1269
               S+   +  SE  ++L I  A +   G Y L++ENK G +   + + V+  P+ P G  
Sbjct: 30178 --SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPL 30235

Query: 1270  CASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPD 1328
                DI+  S+ +SW   + DGG+ +  Y +E  +     W  + +  R TS  V+ L  +
Sbjct: 30236 EYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKEN 30295

Query: 1329  HEYKFRVRAINVYGTSEPSQESELTTVG---EKPEEPKDEVEVSDDDEKEPEVDYRTVTI 1385
              EY FRV A N +G S+P +  E  T       PE P +  EV D  +    + +     
Sbjct: 30296 VEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKD 30355

Query: 1386  NTEQKVSDFY 1395
             +   +V+ +Y
Sbjct: 30356 DGGSRVTGYY 30365



 Score = 89.4 bits (220), Expect = 3e-17
 Identities = 55/193 (28%), Positives = 93/193 (48%), Gaps = 5/193 (2%)

Query: 553 APIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESE--DFHFEQRGTQHS 610
           AP F Q L  + V++GS  T    +SG P PEV W  +G  I  S            +  
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 611 LCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVL 670
           L I  V   ++G Y+ +A N +G+  + A L V+   +   P F+ + +S+T   G  V 
Sbjct: 65  LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKA--ETAPPNFVQRLQSMTVRQGSQVR 122

Query: 671 ISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNR 730
           +   + G P P V + RDG  + + +  F++ Q  D+++L++ +  P  +G Y +   N 
Sbjct: 123 LQVRVTGIPTPVVKFYRDGAEI-QSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181

Query: 731 VGECSCQVSLMLQ 743
           VG  +    L++Q
Sbjct: 182 VGRATSTAELLVQ 194



 Score = 89.4 bits (220), Expect = 3e-17
 Identities = 60/221 (27%), Positives = 100/221 (45%), Gaps = 17/221 (7%)

Query: 431   VKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS 490
             +K R + + ++E  P F+  L +     G++     ++   P P +TW  +GQ I+   +
Sbjct: 31676 IKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDN 31735

Query: 491   ------TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLL 544
                     + G+ +L I     +D   YT +A N  G+ SC A +TV           L 
Sbjct: 31736 DKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV----------TLH 31785

Query: 545   PVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQ 604
             P        P+F + L++ +  +G  V   ++VSG PPP + W  +G  +    +     
Sbjct: 31786 PPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH 31845

Query: 605   RGTQ-HSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQ 644
              G   ++L I++  PEDTG Y   A N+AG    QA L V+
Sbjct: 31846 EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31886



 Score = 88.2 bits (217), Expect = 7e-17
 Identities = 75/304 (24%), Positives = 124/304 (40%), Gaps = 31/304 (10%)

Query: 445  PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELHI--- 501
            P+F S  K      G+     C+V GTPV    W  +G  +  + +   +     HI   
Sbjct: 3551 PTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILEL 3610

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
             +   +D G Y+C A N  G   C A + + +K                   P F++ L 
Sbjct: 3611 SNLTIQDRGVYSCKASNKFGADICQAELIIIDK-------------------PHFIKELE 3651

Query: 562  DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
             ++     +V +  QV  +    V W  +G ++   +D+         +L I     +D+
Sbjct: 3652 PVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDS 3711

Query: 622  GTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISK-PRSVTASLGQSVLISCAIAGDPF 680
            GTY C A N AG     A +TV+EP     P F+ K   S     G+S  + C + G P 
Sbjct: 3712 GTYVCTASNEAGSSSCSATVTVREP-----PSFVKKVDPSYLMLPGESARLHCKLKGSPV 3766

Query: 681  PTVHWLRDGKALCK-DTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS 739
              V W ++ K L + +T     + +E +  +   KV+   +G Y     N VG  SC   
Sbjct: 3767 IQVTWFKNNKELSESNTVRMYFVNSEAILDITDVKVE--DSGSYSCEAVNDVGSDSCSTE 3824

Query: 740  LMLQ 743
            ++++
Sbjct: 3825 IVIK 3828



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 144/684 (21%), Positives = 237/684 (34%), Gaps = 121/684 (17%)

Query: 163  FATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVS-EKNGMQVLEIH 221
            F +++    + EG    F CK++G P P++ W K    ++   R  +   ++G   L I 
Sbjct: 1293 FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIP 1352

Query: 222  GVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISK 281
             V  +D G+YT    N  G A  S +L ++            T    S +R      +S+
Sbjct: 1353 VVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSR 1412

Query: 282  ESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKT 341
                  +  A  S    SP R      +   + +   ES+LE      R      VL+  
Sbjct: 1413 SP--IRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLE------RLYKPVFVLKPV 1464

Query: 342  S-SSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAAN 400
            S   +  Q AR                  + K    P P TF         Q +V+   +
Sbjct: 1465 SFKCLEGQTARF-----------------DLKVVGRPMPETFWFHD----GQQIVNDYTH 1503

Query: 401  RRIPMEGQRDSAFPKFESKPQSQE---VKENQTVKFRCEGLAVME-----VAPSFSSVLK 452
            + +  E    S      +   S E   V +N+  +     +  +E     V P F   LK
Sbjct: 1504 KVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLK 1563

Query: 453  DCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ---PIQYARSTCEA--GVAELHIQDALPE 507
            +  + EG    ++    G P P I WL N     P +Y +   E   G A L I   + +
Sbjct: 1564 NVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQ 1623

Query: 508  DHGTYTCLAENALGQ--VSCSAWVTVHEKKSSRKSEYLLP---------VAP-------- 548
            D   YT  A N  G+    C   V V   +   + + ++P          AP        
Sbjct: 1624 DSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLR 1683

Query: 549  --------------SKPTAPIFLQGLSDLKVMDGSQVTMTVQVS--GNPPPEVIWLHNGN 592
                           K   P F + L+ L++          +++  G+P   V WLH+G 
Sbjct: 1684 YGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGK 1743

Query: 593  EIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQE------- 645
             ++ +            SL     +  D+G  TC A N  G   T A L V++       
Sbjct: 1744 PLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEE 1803

Query: 646  -------------------PHDGT------------QPWFISKPRSVTASLGQSVLISCA 674
                                H+G             +P  +  P  V    G++    C 
Sbjct: 1804 SQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCR 1863

Query: 675  IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
            + G P P V+W  +G+ L + +  F V + + +  L +   + +  G+ ++  +N  G  
Sbjct: 1864 VTGYPQPKVNWYLNGQ-LIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVI 1921

Query: 735  SCQVSLMLQNSS--ARALPRGREP 756
              +V L +Q        L R  EP
Sbjct: 1922 EHKVKLEIQQREDFRSVLRRAPEP 1945



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 69/286 (24%), Positives = 118/286 (41%), Gaps = 46/286 (16%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F ++L+ V V +   + L+C+V+  PP  + W  N + ++++K   L+   S+ ++ I
Sbjct: 4955 PTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHI 5014

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPA----SENTKAPEMKSRRPKSSL--- 1141
             K  P D G Y+C+  N+ G   CS +V + + P+     ENT      S   +S++   
Sbjct: 5015 TKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGS 5074

Query: 1142 PPVLGT-------------------ESDATVKKKPAPKTPP------------------- 1163
            PP+  T                   +S AT++ +                          
Sbjct: 5075 PPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAF 5134

Query: 1164 -KAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
                 P QI++  +   V   + + L   V GT  +   W+K  KQI  S +  +    N
Sbjct: 5135 LLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENN 5194

Query: 1223 GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGT 1268
             +   I +  ++  G YT  VEN  GS      L V+D+  PP+ T
Sbjct: 5195 VASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFT 5240



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 62/207 (29%), Positives = 97/207 (46%), Gaps = 11/207 (5%)

Query: 1163  PKAAMPPQIIQFPEDQK----VRAGESVELFGKVTGTQPITCTWMK--FRKQIQESEHMK 1216
             PK  + P  I      +    VRAG  + LF  V G      TW K      +++ +   
Sbjct: 18597 PKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQ--- 18653

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS 1276
             V+  +  + L I  + ++  G Y+L + N  G +   VN+ V+D P P +     SD+  
Sbjct: 18654 VDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLK-VSDVTK 18712

Query: 1277  SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRV 1335
             +S  +SW     DGGS V  Y +E  ++  KTW  +    + TSF+V +L+P +EY FRV
Sbjct: 18713 TSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRV 18772

Query: 1336  RAINVYGTSEPSQESELTTVGEKPEEP 1362
              A+N YG   P+   +     +   EP
Sbjct: 18773 TAVNEYGPGVPTDVPKPVLASDPLSEP 18799



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 11/211 (5%)

Query: 1159  PKTPPKAAMPPQIIQFPEDQK---------VRAGESVELFGKVTGTQPITCTWMKFRKQI 1209
             P   P    P  I+  PE +          +RAG ++ L+  V G  P   TW K    +
Sbjct: 19675 PSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNL 19734

Query: 1210  QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTP 1269
             ++   + +++++  + L      +   G Y L +EN  G ++  + + V+D P PP    
Sbjct: 19735 RDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNV- 19793

Query: 1270  CASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPD 1328
                +I   S  ++W     DGGS + +Y ++  D+  K+W  + T C  TSF V +L   
Sbjct: 19794 TVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEG 19853

Query: 1329  HEYKFRVRAINVYGTSEPSQESELTTVGEKP 1359
               Y FRV A N YG  +P +  +     + P
Sbjct: 19854 KSYFFRVFAENEYGIGDPGETRDAVKASQTP 19884



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 66/230 (28%), Positives = 106/230 (46%), Gaps = 15/230 (6%)

Query: 1168  PPQIIQFPEDQKV---RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS 1224
             PP+I    + +KV   RA  ++ LF  + G       W K    +  ++  ++E + + +
Sbjct: 25104 PPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL--TDRAQIEVTSSFT 25161

Query: 1225  KLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY 1284
              L I    +   G Y L +EN  GS+ A VN+ V+D P  P       +++  S+TLSW 
Sbjct: 25162 MLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIR-EVKKDSVTLSWE 25220

Query: 1285  GSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGT 1343
                 DGG+ + +Y +E  ++  K +  +   C  T+F +++L     Y FRV A N YG 
Sbjct: 25221 PPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGI 25280

Query: 1344  SEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
               P++ +E   V E P  P     V        +V   T TI  E+  SD
Sbjct: 25281 GLPAETTEPVKVSEPPLPPGRVTLV--------DVTRNTATIKWEKPESD 25322



 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 56/184 (30%), Positives = 89/184 (48%), Gaps = 4/184 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VRAG S  +     G      TW   R++ + ++ +++E   N ++L+I    +   G Y
Sbjct: 24036 VRAGGSARIHIPFKGRPTPEITWS--REEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKY 24093

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              L +EN  GS+ A V + V+D P PP       ++R  S  L W     DGG+ V++Y I
Sbjct: 24094 ILKLENSSGSKSAFVTVKVLDTPGPPQNL-AVKEVRKDSAFLVWEPPIIDGGAKVKNYVI 24152

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             +  +S  K +  +++ C  TSF V++L     Y FRV A N +G   P +  +     E 
Sbjct: 24153 DKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP 24212

Query: 1359  PEEP 1362
             P  P
Sbjct: 24213 PSPP 24216



 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 46/168 (27%), Positives = 85/168 (50%), Gaps = 1/168 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             ++AGE +++   V G      +W+K  + ++++  + VE +   + L I    ++  G Y
Sbjct: 24323 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 24382

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T+   N  G+    +++ V++KP PP G     ++ +  + +SW   +Y GG  + +Y +
Sbjct: 24383 TVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIV 24442

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             E  D+   TW  + AT   T+  +  L    EY+FR+ A N YG S P
Sbjct: 24443 EKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAP 24490



 Score = 86.7 bits (213), Expect = 2e-16
 Identities = 66/269 (24%), Positives = 109/269 (40%), Gaps = 60/269 (22%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F QK   V   +G  ++LQC++S  PP  ++W  + K ++ +K   ++ +    S+ I
Sbjct: 6458 PVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHI 6517

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                  D G Y C A N+ G   CSC V                                
Sbjct: 6518 LNLEASDVGEYHCKATNEVGSDTCSCSV-------------------------------- 6545

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                           K   PP+ ++   D     G++VEL   V G QPI+  W+K R +
Sbjct: 6546 ---------------KFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGE 6590

Query: 1209 -IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV------VDK 1261
             I+ESE+ ++   +N + L + +    + G Y   ++N  G R+    LTV      ++K
Sbjct: 6591 VIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEK 6650

Query: 1262 PDP---PAGTPCASD---IRSSSLTLSWY 1284
            P+P     G P A +     +  L+  W+
Sbjct: 6651 PEPMTVTTGNPFALECVVTGTPELSAKWF 6679



 Score = 85.9 bits (211), Expect = 3e-16
 Identities = 73/292 (25%), Positives = 125/292 (42%), Gaps = 41/292 (14%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+   VA  + S  +L V+          E P  +   + + ++ G  A+F   + G P+
Sbjct: 3216 GEYTFVAGRNRSSVTLYVNAP--------EPPQVLQELQPVTVQSGKPARFCAVISGRPQ 3267

Query: 62   PQVTWHRNGQPITSGGR--FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTV 119
            P+++W++  Q +++G +  FL D      ++L++     ED   YTCEA N  G    + 
Sbjct: 3268 PKISWYKEEQLLSTGFKCKFLHD---GQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSA 3324

Query: 120  ELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGR 179
             L+VE                      P V +        PP   T L   V  EGQ  R
Sbjct: 3325 SLSVE---------------------VPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPAR 3363

Query: 180  FSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGS 239
            F C+++G    +V+W   +  ++PS    +++      LEI     +D G YT +  N  
Sbjct: 3364 FQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAV 3422

Query: 240  GKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAA 291
            G+ S +A LS++    A  S + E      ++  +   VI +  K++ LE A
Sbjct: 3423 GQVSSTANLSLE----APESILHERIEQEIEMEMKAAPVIKR--KIEPLEVA 3468



 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 60/221 (27%), Positives = 94/221 (42%), Gaps = 31/221 (14%)

Query: 33   PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
            P F+L P +    EG TA+F+ +V G P P+  W  +GQ I +     +     GT SL+
Sbjct: 1457 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1516

Query: 93   IHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETR 152
            I      D G++T  A N +G   ++V LTVE                       AVE  
Sbjct: 1517 IVPATPSDSGEWTVVAQNRAGRSSISVILTVE-----------------------AVE-- 1551

Query: 153  PSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS--ARVSVS 210
                 +  P F  KL  V +KEG       + TG P P + WLK +  + P    ++ + 
Sbjct: 1552 ----HQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIE 1607

Query: 211  EKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQ 251
               G   L+I      D   YT   +N +G+ +   +++++
Sbjct: 1608 GTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1648



 Score = 85.1 bits (209), Expect = 6e-16
 Identities = 178/820 (21%), Positives = 302/820 (36%), Gaps = 113/820 (13%)

Query: 367  SGEERKRPAPP--RPATFPTRQPGLGSQDVVSKAANRR-IPMEGQRDSAFPKFESKPQSQ 423
            SG+    PA P   P   PT +P    + +  ++ +R  I M   R S      ++    
Sbjct: 1376 SGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPA 1435

Query: 424  EVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ 483
             +   + ++   E        P F         +EGQ       V G P+P   W  +GQ
Sbjct: 1436 RMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQ 1495

Query: 484  PI--QYARSTC--EAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRK 539
             I   Y       E G   L I  A P D G +T +A+N  G+ S S  +TV   +   K
Sbjct: 1496 QIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVK 1555

Query: 540  SEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED 599
                          P+F++ L ++ + +GS++ M V+ +GNP P+++WL N + I   + 
Sbjct: 1556 --------------PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKY 1601

Query: 600  FHFEQRGT--QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISK 657
                  GT  + +L I     +D+  YT  A N AG   T+  + V+      +P     
Sbjct: 1602 PKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEP----- 1656

Query: 658  PRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVF------TLV 711
             R +    G     +  IA      +H LR G+   ++   ++  + +  F      +L 
Sbjct: 1657 ERKLIIPRG--TYRAKEIAAPELEPLH-LRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLR 1713

Query: 712  LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGR---EPASCEDLCGGGVG 768
            LK+  P H   +E  L   +G+ +  V  +       A  R R   E   C    G    
Sbjct: 1714 LKRFGPAH---FECRL-TPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYS 1769

Query: 769  ADGG-----GSDRYGSLRPGWP--ARGQGWLEEED--GEDVRGVLKRRVETRQHTEEAIR 819
             D G      +++YG+         + +  L EE    E  +G+ +     R   E A+ 
Sbjct: 1770 RDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALT 1829

Query: 820  QQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKT--------VSE 871
                +Q +      K+     L  + ++ +  E   FR  +    +PK         + +
Sbjct: 1830 GVTTDQKE------KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRK 1883

Query: 872  EER------KVHSPQQVDFRS--VLAKKGTSKTP---VPEKVPPPKPATPDFRSVLGGKK 920
             +R       +H    VD +S      K T++ P   +  KV        DFRSVL    
Sbjct: 1884 SKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAP 1943

Query: 921  KLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKP 980
            +   E        L  +  +  +P+   +     K V   K AE +      + +E L+ 
Sbjct: 1944 EPRPEFHVHEPGKLQFEVQKVDRPVDTTE----TKEVVKLKRAERITHEKVPEESEELRS 1999

Query: 981  MGNAKPDE---------NLKSASKEELKKDVKNDVNCKRGH--AGTTDNEKRS---ESQG 1026
                + +E          LKS  K+E  +++      +  H     T+ EK++   E + 
Sbjct: 2000 KFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKI 2059

Query: 1027 TAPAFK----------------QKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNG-KTL 1069
            T P FK                +++Q   V +G     + +V   P     W  NG K  
Sbjct: 2060 TIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIE 2119

Query: 1070 KTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQ 1109
            ++ +      E ++C + I     ED       A N AG+
Sbjct: 2120 RSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGE 2159



 Score = 84.7 bits (208), Expect = 7e-16
 Identities = 150/724 (20%), Positives = 239/724 (33%), Gaps = 89/724 (12%)

Query: 31   EAPAFILPPRNLCIKEGATAKFEGRVR--GYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
            + P F     +L +K    A FE R+   G P   V W  +G+P+ +  R  +     G 
Sbjct: 1701 QKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRM-INEFGY 1759

Query: 89   FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV--EGSFAKQLGQPVVSKTLGDRFSA 146
             SL     +  D G  TC ATN  G    +  L V  E S  ++   P   K L      
Sbjct: 1760 CSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEEL 1819

Query: 147  PAVETRPSIWG-------ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNV 199
              +    ++ G       +  P        V V EG+  RF C++TG PQP+V W     
Sbjct: 1820 ERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQ 1879

Query: 200  PLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRS 259
             ++ S R  V   +G+  L+I      D G       N  G      +L IQ  +   RS
Sbjct: 1880 LIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDF-RS 1937

Query: 260  FVRETKATNSDVRKEVTNVISKE-SKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPR 318
             +R       +        +  E  K+D      ++K     +R          +     
Sbjct: 1938 VLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEEL 1997

Query: 319  ESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPR 378
             SK +   +       T V  K+          ++             + EE+K  A   
Sbjct: 1998 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEG 2057

Query: 379  PATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGL 438
              T PT +P              +I +    ++  PK   + QSQ V +     FR    
Sbjct: 2058 KITIPTFKPD-------------KIELSPSMEA--PKIFERIQSQTVGQGSDAHFRVR-- 2100

Query: 439  AVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTC----EA 494
                                         V G P P   W  NG  I+ +        E 
Sbjct: 2101 -----------------------------VVGKPDPECEWYKNGVKIERSDRIYWYWPED 2131

Query: 495  GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAP 554
             V EL I+D   ED  +    A N  G+ S  A++ V  K+                   
Sbjct: 2132 NVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ-----------------LI 2174

Query: 555  IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQ 614
             F Q L D+   +   +      +  P  +V W  +G E+ E + +        H L I 
Sbjct: 2175 TFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSIL 2234

Query: 615  EVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCA 674
             +   D   Y+C        V+T A L V    +G    F+ + + +      S  + C 
Sbjct: 2235 TIDTSDAEDYSCVLVEDE-NVKTTAKLIV----EGAVVEFVKELQDIEVPESYSGELECI 2289

Query: 675  IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
            ++ +      W  +   L K  G + +        L +K V     G+Y  ++  +   C
Sbjct: 2290 VSPENIEG-KWYHNDVEL-KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTC 2347

Query: 735  SCQV 738
              ++
Sbjct: 2348 KLKM 2351



 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 46/155 (29%), Positives = 76/155 (49%), Gaps = 1/155 (0%)

Query: 1192  VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ 1251
             + G    + +W K    +     + VE+S   + L +   ++   G YT+ ++N  G+++
Sbjct: 20006 IKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKE 20065

Query: 1252  AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
               +++ VV KP  P G     ++ + ++TL W     DGGS + +Y +E  DS N  W  
Sbjct: 20066 GTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVT 20125

Query: 1312  LATC-RSTSFNVQDLLPDHEYKFRVRAINVYGTSE 1345
              A+  + T+F V  L    EY FRV A N YG  E
Sbjct: 20126 CASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE 20160



 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 53/182 (29%), Positives = 87/182 (47%), Gaps = 4/182 (2%)

Query: 1168  PPQIIQ--FPEDQK-VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS 1224
             PP+I    FP     VRAG ++++   ++G      T  +    ++ +     E +    
Sbjct: 26473 PPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENL 26532

Query: 1225  KLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY 1284
              + +  +     G Y +   N  G+ +A +N+ V+D+P PP G    SDI   S+TL W 
Sbjct: 26533 TINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWE 26592

Query: 1285  GSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGT 1343
                YDGGS V +Y +   +++   W E+ AT   T   V  L    EY+FR++A N +G 
Sbjct: 26593 PPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGI 26652

Query: 1344  SE 1345
             S+
Sbjct: 26653 SD 26654



 Score = 83.2 bits (204), Expect = 2e-15
 Identities = 49/183 (26%), Positives = 90/183 (49%), Gaps = 5/183 (2%)

Query: 1169  PQIIQFPEDQK----VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS 1224
             P I++F  +      +++GES+ +   V G      TW K   +I++  +M++ +    +
Sbjct: 27955 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGST 28014

Query: 1225  KLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY 1284
              L +  A ++H G YT+  +N  GS +A++ + V D P    G    ++I    +TL W 
Sbjct: 28015 SLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWD 28074

Query: 1285  GSSYDGGSAVQSYSIEIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGT 1343
                 DG + +  Y IE  +++   W  +   C + S+    L+  +EY+FRV A+N +G 
Sbjct: 28075 APLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGV 28134

Query: 1344  SEP 1346
               P
Sbjct: 28135 GRP 28137



 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 112/474 (23%), Positives = 180/474 (37%), Gaps = 54/474 (11%)

Query: 813  HTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTV--- 869
            H EE+  QQ   +  +++    ++S   ++E   +  PA +      + + VKP+ +   
Sbjct: 722  HLEESYAQQTTLEYGYKE----RISAAKVAEPPQR--PASEPHV---VPKAVKPRVIQAP 772

Query: 870  SEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPP-PKPATPDFRSVLGGKKKLPAENGS 928
            SE   K    + +   S + K     T     V   P+ A+P F      K  +P     
Sbjct: 773  SETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTV---SKISVPKTEHG 829

Query: 929  SSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAET--LKPMGNAKP 986
              A    +      K LS    +   + +  +  A T+KP      AE   L     A  
Sbjct: 830  YEASIAGSAIATLQKELSATSSA---QKITKSVKAPTVKPSETRVRAEPTPLPQFPFADT 886

Query: 987  DENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQG-------------------- 1026
             +  KS +  E+KK+V   +       GTT  E+R E                       
Sbjct: 887  PDTYKSEAGVEVKKEVGVSIT------GTTVREERFEVLHGREAKVTETARVPAPVEIPV 940

Query: 1027 TAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSV 1086
            T P     L++V V EG+ + L+C +S  P  T+ W      ++++    ++ +  +  +
Sbjct: 941  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 1000

Query: 1087 SIEKALPEDRGLYKCVAKNDAGQAECSC--QVTVDDAPASENTKAPEMKSRRPKSSLPPV 1144
             I +A  ED G + C A N+AG    SC   V V +    E T   E  +   K  +   
Sbjct: 1001 MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1060

Query: 1145 LGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
                +D ++ ++ A    P A   P  I  P  QK+  G SV    +V G       W K
Sbjct: 1061 DVVMTDTSLTEEQAGPGEPAA---PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKK 1117

Query: 1205 FRKQIQESEHMKVE-NSENGS-KLTILAARQEHCGCYTLLVENKLGSRQAQVNL 1256
                +      KV  N + G  KL I     +  G YT++V NK G   A  +L
Sbjct: 1118 SGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171



 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 61/234 (26%), Positives = 96/234 (41%), Gaps = 46/234 (19%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F ++L+ V  A  KK+ L+CQV  D   T+ W+ +G+ L   K   +  E  + ++ I
Sbjct: 3644 PHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEI 3703

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
              A  +D G Y C A N+AG + CS  VTV + P                          
Sbjct: 3704 PLAKLKDSGTYVCTASNEAGSSSCSATVTVREPP-------------------------- 3737

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
              + VKK           + P  +  P       GES  L  K+ G+  I  TW K  K+
Sbjct: 3738 --SFVKK-----------VDPSYLMLP-------GESARLHCKLKGSPVIQVTWFKNNKE 3777

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            + ES  +++    + + L I   + E  G Y+    N +GS      + + + P
Sbjct: 3778 LSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPP 3831



 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 101/443 (22%), Positives = 165/443 (37%), Gaps = 57/443 (12%)

Query: 1017  DNEKRSESQ-GTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFI 1075
             D E R++ +   AP  K   QD+ V  GK L +     + P A   W    + L T    
Sbjct: 12987 DKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTID 13046

Query: 1076  ILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSR 1135
               +++ S   +  +K    D+G YK V +N  G+AE    + V D P             
Sbjct: 13047 TTAEQTSFRILEAKKG---DKGRYKIVLQNKHGKAEGFINLKVIDVPG------------ 13091

Query: 1136  RPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGT 1195
                    PV   E   T   +               +    ++ +  G S ++ G V   
Sbjct: 13092 -------PVRNLEVTETFDGE---------------VSLAWEEPLTDGGS-KIIGYVVER 13128

Query: 1196  QPITC-TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC-YTLLVENKLGSRQAQ 1253
             + I   TW+    + +  E       + G +     + +   G    +  +N + +R   
Sbjct: 13129 RDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKY 13188

Query: 1254  VNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA 1313
                   D P PP      +D+    ++L+W    YDGG+ + +Y IE+ D  +  W    
Sbjct: 13189 ------DVPGPPLNVTI-TDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 13241

Query: 1314  TCRST--SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1371
             T R+   S  V D++   EY FRVRA N  G  +PS  +    V +  E P   V ++  
Sbjct: 13242 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSS 13301

Query: 1372  DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQV---FRLVEKKTRKVW----AGK 1424
             D+ +  V  +      +        I ER   GK   +    +LV + T KV       K
Sbjct: 13302 DQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNK 13361

Query: 1425  FFKAYSAKEKENIRQEISIMNCL 1447
             +    SA+ K  +     I+  L
Sbjct: 13362 YLYRVSAENKAGVSDPSEILGPL 13384



 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 53/185 (28%), Positives = 85/185 (45%), Gaps = 4/185 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+AG S  +     G       W K    ++   +  V+ +++ + LTI  A +   G Y
Sbjct: 26198 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAY--VDTTDSRTSLTIENANRNDSGKY 26255

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             TL ++N L +    + + V+D P PP       D+   S  LSW     DGG+ V++Y I
Sbjct: 26256 TLTIQNVLSAASLTLVVKVLDTPGPPTNI-TVQDVTKESAVLSWDVPENDGGAPVKNYHI 26314

Query: 1300  EIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  +++ K W  +   C   S+ V +L     Y FRV   N +G   P++  E   + EK
Sbjct: 26315 EKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEK 26374

Query: 1359  PEEPK 1363
             P  P+
Sbjct: 26375 PSPPE 26379



 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 62/203 (30%), Positives = 92/203 (45%), Gaps = 4/203 (1%)

Query: 533   EKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGN 592
             E + S  SE + P +     AP F + L +L V   S  T+  +V+G+P P V W   G 
Sbjct: 30907 ESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK 30966

Query: 593   EI-QESEDFHFEQ-RGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGT 650
             EI  +   +  ++ +G  H L I  V  +D   Y   A N  G V   A L V+ P    
Sbjct: 30967 EIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIH 31026

Query: 651   QPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTL 710
              P  +    +V A  G+ V I    +G P P + W + G+ L  + GH++V+      +L
Sbjct: 31027 LPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITW-QKGQDLIDNNGHYQVIVTRSFTSL 31085

Query: 711   VLKK-VQPWHAGQYEILLKNRVG 732
             V    V+   AG Y +  KNR G
Sbjct: 31086 VFPNGVERKDAGFYVVCAKNRFG 31108



 Score = 82.0 bits (201), Expect = 5e-15
 Identities = 70/273 (25%), Positives = 106/273 (38%), Gaps = 32/273 (11%)

Query: 23    RVDSMPLTEAPA-FILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGG---R 78
             R D+M L E P  F LP  N     G   +F   +  +PEP VTW+++GQ I  G    +
Sbjct: 31679 RTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKK 31738

Query: 79    FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK 138
             +  +   +G + L I++V  +D  +YT  A N  G      +LTV       L  P    
Sbjct: 31739 YTFESD-KGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV------TLHPPPTDS 31791

Query: 139   TLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGN 198
             TL                    P F   L     +EGQ   F  +++G P P + W K  
Sbjct: 31792 TL-------------------RPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDG 31832

Query: 199   VPLQPSARVS-VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSAN 257
              PL     +  + E      L I     +D G Y     N +G  S  A L ++ L    
Sbjct: 31833 QPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKK 31892

Query: 258   RSFVRETKATNSDVRKEVTNVISKESKLDSLEA 290
             + F +  +     V+K++   +     L   E+
Sbjct: 31893 QEF-KSKEEHERHVQKQIDKTLRMAEILSGTES 31924



 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 59/221 (26%), Positives = 100/221 (45%), Gaps = 7/221 (3%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRK--QIQESEHMKVENSENGSKLTILAARQEHCG 1237
             V+AG+++ L   V G       W K +    +  S  +K++   + SK ++  A++   G
Sbjct: 18213 VKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGG 18272

Query: 1238  CYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSY 1297
              Y +   N  GS  A   + V+DKP P        D+ S   T+ W     DGG  +Q+Y
Sbjct: 18273 KYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIV-DVSSDRCTVCWDPPEDDGGCEIQNY 18331

Query: 1298  SIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESEL--TT 1354
              +E  ++    W    AT  +    V  L+  +EY FRVRA N  GT  P++   +   T
Sbjct: 18332 ILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKT 18391

Query: 1355  VGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFY 1395
               +KP  P D  EV+   ++E  V +     +  + ++ ++
Sbjct: 18392 KYDKPGRP-DPPEVTKVSKEEMTVVWNPPEYDGGKSITGYF 18431



 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 53/193 (27%), Positives = 89/193 (46%), Gaps = 4/193 (2%)

Query: 553   APIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLC 612
             AP   + + D+    G    ++ Q+ G P P++ W   G E+ +S  +     G  H+L 
Sbjct: 30532 APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLT 30591

Query: 613   IQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLIS 672
             +     ED G YTC A N  GEV T + L +Q       P +  K +   A +G ++ + 
Sbjct: 30592 VMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQ-FHPGYPLKEKYYGA-VGSTLRLH 30649

Query: 673   CAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQ-PWHAGQYEILLKNRV 731
                 G P P + W   G+ L +++ +  +   E    LV+K VQ   HAG+Y++ L N  
Sbjct: 30650 VMYIGRPVPAMTWFH-GQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVF 30708

Query: 732   GECSCQVSLMLQN 744
             G     + + +Q+
Sbjct: 30709 GTVDAILDVEIQD 30721



 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 75/315 (23%), Positives = 116/315 (36%), Gaps = 74/315 (23%)

Query: 12    ISKTSLSVDPSRVD---SMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHR 68
             ISKT   +   + D   S  L++APAFI  PR+  I EG    F   + G P P++ W +
Sbjct: 33110 ISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFK 33169

Query: 69    NGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL------- 121
             N  PI+      +    R  +SL I      D GKYT +A N  G    T  L       
Sbjct: 33170 NNLPISISSNVSISRS-RNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVE 33228

Query: 122   --------------TVEGSFAKQLGQPVVSKTLGD---------------RFSAPAVETR 152
                           +++GSF+ Q  Q   SK                   +F++ + ++ 
Sbjct: 33229 EPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSM 33288

Query: 153   PSIWGE--------------------------------CPPKFATKLGRVVVKEGQMGRF 180
              S+                                    PPK       + + EG++   
Sbjct: 33289 SSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTV 33348

Query: 181   SCKITGRPQPQVTWLKG--NVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG 238
             +C  TG P P+VTW  G   +  Q   R  +   + +  L I  V + D G+YT  + N 
Sbjct: 33349 ACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNE 33408

Query: 239   SGKASMSAELSIQGL 253
              G  S +  + I+ +
Sbjct: 33409 FGSDSATVNIHIRSI 33423



 Score = 81.3 bits (199), Expect = 8e-15
 Identities = 123/536 (22%), Positives = 192/536 (35%), Gaps = 142/536 (26%)

Query: 5     KLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQV 64
             K +    I+KTS + +  R  +    E  AF      + I EG     +  + G  +  V
Sbjct: 33018 KSIVHEEITKTSQASEEVRTHA----EIKAF---STQMSINEGQRLVLKANIAGATD--V 33068

Query: 65    TWHRNGQPITSGGRFLLDCGIRGTF-SLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
              W  NG  +T+   +    G+ G+  +L I      D G  TC +    G  +   +LT+
Sbjct: 33069 KWVLNGVELTNSEEYRY--GVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL 33126

Query: 124   EGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCK 183
                          SK L D   APA  ++P                  + EGQ   F+C+
Sbjct: 33127 -------------SKELSD---APAFISQPRSQN--------------INEGQNVLFTCE 33156

Query: 184   ITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKAS 243
             I+G P P++ W K N+P+  S+ VS+S    +  LEI   +  D G YT    N  G+ S
Sbjct: 33157 ISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCS 33216

Query: 244   MSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEA--AAKSKNCSSPQ 301
              +A L +  L                 V +    V+ + S   SL+   +++S   S+ +
Sbjct: 33217 ATASLMVLPL-----------------VEEPSREVVLRTSGDTSLQGSFSSQSVQMSASK 33259

Query: 302   RGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGL 361
             +  S    ++S      E K  S      ++ Q   ++ +SSS                +
Sbjct: 33260 QEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSF---------------M 33304

Query: 362   GVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQ 421
             G+ + +  E                    S   + KA  R IP         PK E+ P 
Sbjct: 33305 GISNMTQLE-------------------SSTSKMLKAGIRGIP---------PKIEALPS 33336

Query: 422   SQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLN 481
                + E +          V+ VA                     C+  G P P +TW   
Sbjct: 33337 DISIDEGK----------VLTVA---------------------CAFTGEPTPEVTWSCG 33365

Query: 482   GQPI---QYARSTCE--AGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVH 532
             G+ I   +  R   E    +  L I D   +D G YT    N  G  S SA V +H
Sbjct: 33366 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFG--SDSATVNIH 33419



 Score = 80.9 bits (198), Expect = 1e-14
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 9/209 (4%)

Query: 1162  PPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE 1221
             PPKA +  ++    +   +RAG  + L   V G       W K  K++   E + ++ + 
Sbjct: 29043 PPKAELDARL--HGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTG 29100

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
               +   I    +   G YTL V+N  G++   V + V+D P  P G    S +     TL
Sbjct: 29101 KRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPG-PCGKLTVSRVTQEKCTL 29159

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             +W     DGG+ +  Y +E  +++   W  +   C + S+ V  L+ ++EY FRVRA+N 
Sbjct: 29160 AWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNK 29219

Query: 1341  YG-----TSEPSQESELTTVGEKPEEPKD 1364
             YG      SEP       T+   P  P++
Sbjct: 29220 YGPGVPVESEPIVARNSFTIPSPPGIPEE 29248



 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 170/794 (21%), Positives = 285/794 (35%), Gaps = 143/794 (18%)

Query: 2     GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
             G+V   A++  S  +L     +V  +PL     FI P  ++ + E   AKFE  V   P+
Sbjct: 11818 GEVSFQAANAKSAANL-----KVKELPLI----FITPLSDVKVFEKDEAKFECEVSREPK 11868

Query: 62    PQVTWHRNGQPITSGGRF-LLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGA------ 114
                 W +  Q IT   RF L+  G + +  +   A  +E +  +  E  + SG       
Sbjct: 11869 T-FRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGI 11927

Query: 115   --------RQVTVELTVEGSFAKQLGQPVV----------------------SKTLGDRF 144
                     + VT +      F  +L    +                       KT    F
Sbjct: 11928 RLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITF 11987

Query: 145   SAPAVETRPSIWGEC--------------PPKFATKLGRVVVKEGQMGRFSCKITGRPQP 190
                +++    I  E                P F  KL      E       C+I+    P
Sbjct: 11988 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP 12047

Query: 191   QVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
              V W K    ++PS    +      ++L +    + D+G YTC      G    S +L I
Sbjct: 12048 -VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDI 12102

Query: 251   QGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAA 310
             +     +R         + +V +  T     E   D + A  K K  +  Q         
Sbjct: 12103 E-----DREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQ--------- 12148

Query: 311   NSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEE 370
                 +   E K+ S         QT  +   ++++   +A ++ +PR   +G+L P  + 
Sbjct: 12149 TPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVK-SSAHLRVKPRV--IGLLRPLKDV 12205

Query: 371   RKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQT 430
                      ATF      L  +D+  +   +   +E   D   P+ E K  +  +++   
Sbjct: 12206 TVTAG--ETATFDCE---LSYEDIPVEWYLKGKKLEPS-DKVVPRSEGKVHTLTLRD--- 12256

Query: 431   VKFRCEG--------------LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRI 476
             VK    G              L V E    F+  L+D  V EG   VL+C V      ++
Sbjct: 12257 VKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKV 12315

Query: 477   TWLLNGQPIQYARS---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHE 533
              W  NG  I  ++      +  V +L I D  PED  TYTC A++   + SC+  V    
Sbjct: 12316 KWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDF--KTSCNLNVV--- 12370

Query: 534   KKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNE 593
                              P    FL+ L+DL+V +        ++S     +V W  +G E
Sbjct: 12371 -----------------PPHVEFLRPLTDLQVREKEMARFECELS-RENAKVKWFKDGAE 12412

Query: 594   IQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPW 653
             I++ + +    +G    L I +   +D   Y+CE   +    RT  +LTV E     +  
Sbjct: 12413 IKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTA----RTSGMLTVLE----EEAV 12464

Query: 654   FISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLK 713
             F     ++  S   ++ + C ++  P   V W +  + +  +TG +E+L       LV++
Sbjct: 12465 FTKNLANIEVSETDTIKLVCEVS-KPGAEVIWYKGDEEII-ETGRYEILTEGRKRILVIQ 12522

Query: 714   KVQPWHAGQYEILL 727
                   AG Y   L
Sbjct: 12523 NAHLEDAGNYNCRL 12536



 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 181/813 (22%), Positives = 280/813 (34%), Gaps = 141/813 (17%)

Query: 29    LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
             L  AP   L  R+  +  G   +F   V+  P  +V W+ NG  +    +        G 
Sbjct: 32370 LDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYT-NTSGV 32428

Query: 89    FSLVIHAVHEEDRGKY---------------TCEATNGSGA------------RQVTVEL 121
              +L I   H +D G Y               T + T G               R V  EL
Sbjct: 32429 LTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPEL 32488

Query: 122   TVEGSFA----KQLGQPVVSKTLGDRFSAPAVETRPSIWG-------------------- 157
             T   ++A    K+  +   S ++ +   +   ETR S+                      
Sbjct: 32489 TRTEAYAVSSFKKTSEMEASSSVRE-VKSQMTETRESLSSYEHSASAEMKSAALEEKSLE 32547

Query: 158   ----------ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARV 207
                           +  TK   + V EG+  RFSC   G P P VTWL+    L  SAR 
Sbjct: 32548 EKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARH 32607

Query: 208   SVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKAT 267
              V+        EI  V   D G Y+ +V N  GK      L+IQ      ++ V E KA 
Sbjct: 32608 QVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ------KARVTE-KAV 32660

Query: 268   NSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKD 327
              S  R     V S E ++ S EA    K   SP+    P       P   + +  E  + 
Sbjct: 32661 TSPPR-----VKSPEPRVKSPEAVKSPKRVKSPE----PSHPKAVSPTETKPTPTEKVQH 32711

Query: 328   SPRTAPQ--TPVLQ-KTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAP-----PRP 379
              P +AP   T  L+ + S  I      V+              G++ K            
Sbjct: 32712 LPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSAD 32771

Query: 380   ATFPTRQPGLGSQDV---------VSKAANRRIPMEGQRDSAFPKFESK----PQSQEVK 426
              T+  +   L   D              +   +   GQ   +  +  SK     +S +  
Sbjct: 32772 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 32831

Query: 427   ENQTVKFRCEGLAVMEVA--PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRIT--WLLNG 482
                TV  + E  A   ++  P   + L+D  V    D V + +V+ T  PR T  W  +G
Sbjct: 32832 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTV--SSDSVAKFAVKATGEPRPTAIWTKDG 32889

Query: 483   QPI----QYARSTCEAG-VAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSS 537
             + I    +Y  S  + G   E+H  D    D G YTC  +N+ G VS S  +T+   K +
Sbjct: 32890 KAITQGGKYKLSEDKGGFFLEIHKTDT--SDSGLYTCTVKNSAGSVSSSCKLTIKAIKDT 32947

Query: 538   RKSEY-LLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQE 596
                +      +   P     +Q     K +   ++ M+         ++      +++  
Sbjct: 32948 EAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMS---EAKSQEKLALKEEASKVLI 33004

Query: 597   SEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS 656
             SE+    ++    SL    V  E T T       ++ EVRT A +              S
Sbjct: 33005 SEEV---KKSAATSLEKSIVHEEITKTS-----QASEEVRTHAEIKA-----------FS 33045

Query: 657   KPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQ 716
                S+    GQ +++   IAG     V W+ +G  L     +   +   D  TL +K+  
Sbjct: 33046 TQMSINE--GQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGSDQ-TLTIKQAS 33100

Query: 717   PWHAGQYEILLKNRVGECSCQVSLMLQNSSARA 749
                 G    + K + G   CQ  L L    + A
Sbjct: 33101 HRDEGILTCISKTKEGIVKCQYDLTLSKELSDA 33133



 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 54/230 (23%), Positives = 92/230 (40%), Gaps = 47/230 (20%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P+F +KL+DV+   G  ++L+C+VS   P ++ W  +G  + +      S   ++C++++
Sbjct: 6741 PSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNL 6800

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                P D G+Y CVA N AG  ECS  +TV + P+ E T                     
Sbjct: 6801 SLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQT--------------------- 6839

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                                      P+  +V  G S+     + GT P    W K  ++
Sbjct: 6840 --------------------------PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRE 6873

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
            +   E   +   +  ++L +   +    G Y+ LV N  GS     +L V
Sbjct: 6874 LVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFV 6923



 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 1/163 (0%)

Query: 1181  RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYT 1240
             +AG+++++   V G    T TW K  + +++++ +  E +   + L I    +   G Y 
Sbjct: 21078 KAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYP 21137

Query: 1241  LLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE 1300
             L   N +G     + + V D P PP G     ++ S  +T SW     DGG  + +Y +E
Sbjct: 21138 LTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVE 21197

Query: 1301  IWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYG 1342
             +  + + TW ELA T   T++    L    EY+FRV+A N YG
Sbjct: 21198 MRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYG 21240



 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 39/112 (34%), Positives = 62/112 (55%), Gaps = 1/112 (0%)

Query: 1669 EEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQS 1728
            EED  +     ++E +  V+  F   I++  ++EG    F CK+ GYP P++ W+KD + 
Sbjct: 1272 EEDGEEKMAVDISESEA-VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKR 1330

Query: 1729 IRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            I+    +Q+D+ +DG  SL I  V  +D+  YT  A N  G A C+ +L VE
Sbjct: 1331 IKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVE 1382



 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 148/719 (20%), Positives = 276/719 (38%), Gaps = 111/719 (15%)

Query: 35    FILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS-LVI 93
             F+ P  +L ++E   A+FE  +      +V W ++G  I  G ++  D   +G    LVI
Sbjct: 12376 FLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKY--DIISKGAVRILVI 12432

Query: 94    HAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRP 153
             +    +D  +Y+CE      +  +TV L  E  F K L    VS+T              
Sbjct: 12433 NKCLLDDEAEYSCEVRTARTSGMLTV-LEEEAVFTKNLANIEVSET-------------- 12477

Query: 154   SIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKN 213
                                      +  C+++ +P  +V W KG+  +  + R  +  + 
Sbjct: 12478 ----------------------DTIKLVCEVS-KPGAEVIWYKGDEEIIETGRYEILTEG 12514

Query: 214   GMQVLEIHGVNQDDVGVYTCLVVNG--SGKASMSAELSIQGLDSANRSFVRETKATNSDV 271
               ++L I   + +D G Y C + +    GK  +  EL+ + +       + E +      
Sbjct: 12515 RKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVH-ELAAEFISKPQNLEILEGE------ 12567

Query: 272   RKEVTNVISKES-----KLD--SLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLES 324
             + E    ISKES     K D  +LE+  K    +  ++       A  Q        + +
Sbjct: 12568 KAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGA 12627

Query: 325   CKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPT 384
                  R A    V++K    + L+  RV+ +        ++  G + K       A F +
Sbjct: 12628 A----RAAAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKW-FRNEEAIFDS 12682

Query: 385   RQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVA 444
              +  +  +D+V     R   ++ Q +  +    +  + + VK    +    E L ++E  
Sbjct: 12683 SKYIILQKDLVYTLRIRDAHLDDQAN--YNVSLTNHRGENVKSAANLIVEEEDLRIVEP- 12739

Query: 445   PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELH---I 501
                   LKD   +E +     C V    V  + W  NG+ + +            H   I
Sbjct: 12740 ------LKDIETMEKKSVTFWCKVNRLNVT-LKWTKNGEEVPFDNRVSYRVDKYKHMLTI 12792

Query: 502   QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
             +D    D G Y                VT  + KS   +E L+  AP++     F++ L 
Sbjct: 12793 KDCGFPDEGEYI---------------VTAGQDKSV--AELLIIEAPTE-----FVEHLE 12830

Query: 562   DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
             D  V +      + Q+S      V W  NG EI+E + + FE+ G+ H L I++   +D 
Sbjct: 12831 DQTVTEFDDAVFSCQLS-REKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDE 12889

Query: 622   GTYTCEAWNSAGEVRTQAVLTVQE-PHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPF 680
               Y C       + +++A L V+E P +  +P     P+ +  + G  V+    +  D  
Sbjct: 12890 CEYAC----GVEDRKSRARLFVEEIPVEIIRP-----PQDILEAPGADVVFLAELNKDKV 12940

Query: 681   PTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS 739
               V WLR+   + +   H +++    +  L +  ++P   G+Y  + K++      +++
Sbjct: 12941 -EVQWLRNNMVVVQGDKH-QMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA 12997



 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 67/283 (23%), Positives = 111/283 (39%), Gaps = 60/283 (21%)

Query: 1023 ESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGS 1082
            + Q   P+F ++L+DV    G  ++  C +S   P ++ W  +GK LK +  +  S   +
Sbjct: 8051 QEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDN 8110

Query: 1083 LCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLP 1142
              +++I K      G Y C A N  G A  S ++ +     +E    P    R     L 
Sbjct: 8111 TATLNIFKTDRSLAGQYSCTATNPIGSASSSARLIL-----TEGKNPPFFDIR-----LA 8160

Query: 1143 PVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTW 1202
            PV     DA V                             GES +    VTGTQPI  +W
Sbjct: 8161 PV-----DAVV-----------------------------GESADFECHVTGTQPIKVSW 8186

Query: 1203 MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
             K  ++I+     ++   EN + LT+L   +   G YT    N++G       L + ++ 
Sbjct: 8187 AKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERL 8246

Query: 1263 DPPAGTPCASD----------------IRSSSLTLSWYGSSYD 1289
             PP+ T   S+                  S  +T++WY ++ +
Sbjct: 8247 IPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIE 8289



 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 68/246 (27%), Positives = 109/246 (44%), Gaps = 42/246 (17%)

Query: 1156  KPAPKTPPKAAMPPQIIQFPE-----DQKVRAGESVELFGKVTGTQPITCTWMKFRK--- 1207
             +P+  TPP  A+ P  I  P+       +V+ G+ + L   ++G+   T TW+K      
Sbjct: 14664 EPSRATPPTKAVDP--IDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIV 14721

Query: 1208  -----------------QIQESE--------HMKVENSENG-SKLTILAARQEHCGCYTL 1241
                              ++QE E         + ++NS+ G S+L +  + +   G Y +
Sbjct: 14722 PEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMI 14781

Query: 1242  LVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEI 1301
              VEN  G  +A   ++V+D P PP       DIR +S+   W     DGGS + +Y++E 
Sbjct: 14782 KVENDHGIAKAPCTVSVLDTPGPPINF-VFEDIRKTSVLCKWEPPLDDGGSEIINYTLEK 14840

Query: 1302  WDSA--NKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
              D    +  W  + +T R   ++V  L+   EY FRVRA N +G   P     L  V + 
Sbjct: 14841 KDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPL--VAKD 14898

Query: 1359  PEEPKD 1364
             P  P D
Sbjct: 14899 PFGPPD 14904



 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 56/212 (26%), Positives = 97/212 (45%), Gaps = 7/212 (3%)

Query: 1159  PKTPPKAAMPP--QIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK 1216
             P T   A + P   +  F +  +V     + +    TG    T TW    K ++  + +K
Sbjct: 13383 PLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVK 13442

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS 1276
             ++     ++L I  + +   G YTL +EN++ +   ++++ V+ +P  P       DI  
Sbjct: 13443 MKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELK-FGDITK 13501

Query: 1277  SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTW-KELATCRSTSFNVQDLLPDHEYKFRV 1335
              S+ L+W     DGGS +  Y +E  + + KTW K +       F V DL+   EY F+V
Sbjct: 13502 DSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKV 13561

Query: 1336  RAINVYGTSEPSQESE---LTTVGEKPEEPKD 1364
              A N  G  EP+   E   ++T    P+ P++
Sbjct: 13562 CARNKCGPGEPAYVDEPVNMSTPATVPDPPEN 13593



 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 69/335 (20%), Positives = 137/335 (40%), Gaps = 41/335 (12%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             PA  ++L  V  ++   +L   +   D  + I   L     K + F + +      + ++
Sbjct: 28546 PAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTV 28605

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             E+ + +    ++  AKNDAG +E                         P+ +   V+   
Sbjct: 28606 ERLVEKTEYEFRVKAKNDAGYSE-------------------------PREAFSSVI--- 28637

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                 +K+     T     +  Q+I        +AG    +   ++G      TW     +
Sbjct: 28638 ----IKEPQIEPTADLTGITNQLIT------CKAGSPFTIDVPISGRPAPKVTWKLEEMR 28687

Query: 1209  IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGT 1268
             ++E++ + +  +++ + LT+  + +   G Y L +EN  G +   V + V+ +P P  G 
Sbjct: 28688 LKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGP 28747

Query: 1269  PCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLP 1327
                S + + S  LSW      GG+ + +Y +E  +S    W+ + ++ + T   V  L  
Sbjct: 28748 IEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTK 28807

Query: 1328  DHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
               EY FRV + N +G S+P + + +  + E P  P
Sbjct: 28808 YMEYSFRVSSENRFGVSKPLESAPI--IAEHPFVP 28840



 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 81/346 (23%), Positives = 127/346 (36%), Gaps = 63/346 (18%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P  K       V  G+ L ++  +S  P  TI WT +G  LK T  I ++    L ++SI
Sbjct: 23230 PDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSI 23289

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             ++   +D G Y     N  GQ   S ++   D P  +  K P                  
Sbjct: 23290 KETHKDDGGQYGITVANVVGQKTASIEIVTLDKP--DPPKGPV---------------KF 23332

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
              D + +       PP      QI  +   ++                   T  W      
Sbjct: 23333 DDVSAESITLSWNPPLYTGGCQITNYIVQKR----------------DTTTTVWDVVSAT 23376

Query: 1209  IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV-----DKPD 1263
             +  +  +KV   + G++             + +  EN+ G   A  +  +V      +P 
Sbjct: 23377 VARTT-LKVTKLKTGTEYQ-----------FRIFAENRYGQSFALESDPIVAQYPYKEPG 23424

Query: 1264  PPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCR 1316
             PP GTP A+ I   S+ + W+    +GGS V  Y +E       +W   NKT        
Sbjct: 23425 PP-GTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKT-----IIH 23478

Query: 1317  STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
              T F  Q+L    EY+FRV A N+ G  + S+ SE     +  + P
Sbjct: 23479 DTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPP 23524



 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 66/242 (27%), Positives = 101/242 (41%), Gaps = 22/242 (9%)

Query: 13   SKTSLSVDPSRVDS----MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHR 68
            +  SLSV+   V S    MP+   PA I P ++    EG  A+F+ RV G  + +V+W+ 
Sbjct: 3322 TSASLSVEVPEVVSPDQEMPVYP-PAIITPLQDTVTSEGQPARFQCRVSG-TDLKVSWYS 3379

Query: 69   NGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFA 128
              + I    RF        T+ L I   + ED G YT  A+N  G    T  L++E    
Sbjct: 3380 KDKKIKPS-RFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAP-- 3436

Query: 129  KQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRP 188
                       L +R     +E    +  +  P    K+  + V  G + +F+C+I   P
Sbjct: 3437 --------ESILHER-----IEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAP 3483

Query: 189  QPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAEL 248
              +  W K    +  S + S+     +  LEI      D G YTC   N  G  S +A L
Sbjct: 3484 NVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATL 3543

Query: 249  SI 250
            ++
Sbjct: 3544 TV 3545



 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 85/383 (22%), Positives = 150/383 (39%), Gaps = 47/383 (12%)

Query: 1031  FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEK 1090
             F + L+D  V E    +  CQ+S +  A + W  NG+ +K  K     ++GS+  + I+ 
Sbjct: 12825 FVEHLEDQTVTEFDDAVFSCQLSREK-ANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKD 12883

Query: 1091  ALPEDRGLYKCVAKNDAGQAECSCQ-VTVD---------DAPASENTKAPEMKSRRP--- 1137
                +D   Y C  ++   +A    + + V+         +AP ++     E+   +    
Sbjct: 12884 CRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQ 12943

Query: 1138  --KSSLPPVLGTESDAT-----------------------VKKKPAPKTPPKAAMPPQII 1172
               ++++  V G +                           + K    +   + A  P+I 
Sbjct: 12944 WLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIK 13003

Query: 1173  QFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAAR 1232
                +D  V  G+ + +             W K  + +       ++ +   +   IL A+
Sbjct: 13004 TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT---IDTTAEQTSFRILEAK 13060

Query: 1233  QEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGS 1292
             +   G Y ++++NK G  +  +NL V+D P P       ++     ++L+W     DGGS
Sbjct: 13061 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLE-VTETFDGEVSLAWEEPLTDGGS 13119

Query: 1293  AVQSYSIEIWDSANKTWKELATCRSTS--FNVQDLLPDH-EYKFRVRAINVYGTSEPSQE 1349
              +  Y +E  D   KTW  LAT R+ S  F V  L     EY FRV A N  GT EP + 
Sbjct: 13120 KIIGYVVERRDIKRKTW-VLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVET 13178

Query: 1350  SELTTVGEKPEEPKDEVEVSDDD 1372
                     K + P   + V+  D
Sbjct: 13179 DNPVEARSKYDVPGPPLNVTITD 13201



 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 43/138 (31%), Positives = 66/138 (47%), Gaps = 2/138 (1%)

Query: 1652 SSTGSPTSPLNAEKLESEE-DVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDC 1710
            S TG+       E L   E  V++        E P   P     ++++ V+EG +   +C
Sbjct: 905  SITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLEC 964

Query: 1711 KIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE 1770
             I GYP P V W+++D  I  S  FQI + + G   L+I +   +D  ++TC AVN  G 
Sbjct: 965  HISGYPSPTVTWYREDYQIESSIDFQITF-QSGIARLMIREAFAEDSGRFTCSAVNEAGT 1023

Query: 1771 ATCTAELIVETMEEGEGE 1788
             + +  L V+  EE E E
Sbjct: 1024 VSTSCYLAVQVSEEFEKE 1041



 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 62/234 (26%), Positives = 97/234 (41%), Gaps = 48/234 (20%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P+F + L+   +  G   LLQC+VS   P  I W  + K ++++K   L  + SL  + I
Sbjct: 3831 PSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEI 3890

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                  D G Y+CV  N+ G  +C C  T                               
Sbjct: 3891 FSFNSADVGEYECVVANEVG--KCGCMAT------------------------------- 3917

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                +K+            PP  ++  +D     G++V L   V G++PI+ TWMK ++ 
Sbjct: 3918 --HLLKE------------PPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEV 3963

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            I+E   +K+  S   + L I   +    G YT L EN+ GS Q  V   +V +P
Sbjct: 3964 IREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGS-QTSVGELIVKEP 4016



 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 89/411 (21%), Positives = 156/411 (37%), Gaps = 69/411 (16%)

Query: 983   NAKPDENLKSASKEELKKDVKNDVNCKRGHA-GTTDNEKRSES-----QGTAPAFKQKLQ 1036
             N++P ++LK   +E +  D +  +  +  +A G ++  + SE+         P    +  
Sbjct: 14335 NSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETH 14394

Query: 1037  DVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDR 1096
             D+ V EG+KL +     + P  T+ W  +GK +K +  + +  +     + + K++  D 
Sbjct: 14395 DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 14454

Query: 1097  GLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKK 1156
             G+Y    +N  G A  S  V V   P        ++K+              SD T    
Sbjct: 14455 GIYTITLENKLGSATASINVKVIGLPGP----CKDIKA--------------SDITKSSC 14496

Query: 1157  PAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK 1216
                  PP+                             G  PI   ++  R++     ++ 
Sbjct: 14497 KLTWEPPE---------------------------FDGGTPIL-HYVLERREAGRRTYIP 14528

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ--AQVNLTVVDKPDPPAGTPCASDI 1274
             V + EN    T+          + +   NK+G  +     N  +   P  P   P   ++
Sbjct: 14529 VMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEV 14588

Query: 1275  RS---SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-----TSFNVQDLL 1326
              +    ++T++W    YDGGS +  Y IE      + WK    C        ++  + L 
Sbjct: 14589 HNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKR---CNEHLVPILTYTAKGLE 14645

Query: 1327  PDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPK----DEVEVSDDDE 1373
                EY+FRVRA N  G SEPS+ +  T   +  + PK      +EV   DE
Sbjct: 14646 EGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDE 14696



 Score = 75.1 bits (183), Expect = 6e-13
 Identities = 68/321 (21%), Positives = 116/321 (36%), Gaps = 53/321 (16%)

Query: 998  LKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPP 1057
            L  +   D  C+  +A  + +   S      P F++K   +   +G  + L+C++   PP
Sbjct: 7368 LSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPP 7427

Query: 1058 ATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAEC----- 1112
              + W  + + L++ K   +  E  L S+ I      D G Y+C A ND G   C     
Sbjct: 7428 FHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIA 7487

Query: 1113 ----------------------SCQVTVDDAPA-----------------------SENT 1127
                                    Q T++ A                         SEN 
Sbjct: 7488 LKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENI 7547

Query: 1128 KAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVE 1187
               +     P ++       ++DA +++  A  +      P  I++ PE  KV  G++  
Sbjct: 7548 ATLQFSRVEPANAGKYTCQIKNDAGMQECFATLS---VLEPATIVEKPESIKVTTGDTCT 7604

Query: 1188 LFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKL 1247
            L   V GT  ++  W K  K++      K+      S L I+       G Y+  V+N +
Sbjct: 7605 LECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPV 7664

Query: 1248 GSRQAQVNLTVVDKPDPPAGT 1268
            G      +L V D+  PP+ T
Sbjct: 7665 GKDSCTASLQVSDRTVPPSFT 7685



 Score = 74.7 bits (182), Expect = 7e-13
 Identities = 69/308 (22%), Positives = 120/308 (38%), Gaps = 73/308 (23%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F      V   +  ++ L+C++S  PP  ++W  + + L+++K   ++ +    S+ I
Sbjct: 5517 PVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHI 5576

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                  D G Y C A+N+ G   C C                                  
Sbjct: 5577 LNVDTSDIGEYHCKAQNEVGSDTCVC---------------------------------- 5602

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
               TVK K           PP+ +       V AGE  EL   + G QPI   W+K +++
Sbjct: 5603 ---TVKLKE----------PPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEE 5649

Query: 1209 -IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNL------TVVDK 1261
             I+ESE++++   EN + L    A   + G Y   ++N  G R+    L       +V+K
Sbjct: 5650 VIRESENIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEK 5709

Query: 1262 PDP---PAGTPCASDIR---SSSLTLSWYG-------------SSYDGGSAVQSYSIEIW 1302
              P     G  C  + +   +  L++ WY              S Y+  S+++  S+E  
Sbjct: 5710 AGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQ 5769

Query: 1303 DSANKTWK 1310
            D+   T++
Sbjct: 5770 DAGTYTFQ 5777



 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 59/236 (25%), Positives = 93/236 (39%), Gaps = 29/236 (12%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            PA    LQD   +EG+    QC+VS      + W    K +K ++F  ++Q      + I
Sbjct: 3345 PAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             +A PED G Y  VA N  GQ   +  ++++                 P+S L   +  E
Sbjct: 3404 AEAYPEDEGTYTFVASNAVGQVSSTANLSLE----------------APESILHERIEQE 3447

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
             +  +K  P  K               E  +V  G   +   ++     +   W K  ++
Sbjct: 3448 IEMEMKAAPVIKRKI------------EPLEVALGHLAKFTCEIQSAPNVRFQWFKAGRE 3495

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP 1264
            I ES+   + +S+  S L IL  +   CG YT    N+ GS      LTV +   P
Sbjct: 3496 IYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPP 3551



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 82/367 (22%), Positives = 148/367 (40%), Gaps = 49/367 (13%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V+V  G  L +   +S  P   +  + +G  LK T            ++++++++  D G
Sbjct: 26486 VYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAG 26545

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLG--TESDATVKK 1155
              Y+  A N +G  +    + V D P                   P V+   TE   T+K 
Sbjct: 26546 RYEITAANSSGTTKAFINIVVLDRPGPPTG--------------PVVISDITEESVTLKW 26591

Query: 1156  KPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM 1215
             +P PK    + +   I+       ++   S  ++ +V+ T  +  T MK  K     E+ 
Sbjct: 26592 EP-PKYDGGSQVTNYIL-------LKRETSTAVWTEVSAT--VARTMMKVMKLTTGEEYQ 26641

Query: 1216  KVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIR 1275
                 +EN                    + + + S    V L     P PP+ TP  +++ 
Sbjct: 26642 FRIKAEN-----------------RFGISDHIDSACVTVKLPYTT-PGPPS-TPWVTNVT 26682

Query: 1276  SSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYKF 1333
               S+T+ W+    +GGSAV  Y +E+ D  +  W++      R+T F V  +     Y+F
Sbjct: 26683 RESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEF 26742

Query: 1334  RVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             RV A N  G  +PS  SE     +  E P++ V ++D  +    + ++    +   K++ 
Sbjct: 26743 RVYAENAAGVGKPSHPSEPVLAIDACEPPRN-VRITDISKNSVSLSWQQPAFDGGSKITG 26801

Query: 1394  FYDIEER 1400
              Y +E R
Sbjct: 26802 -YIVERR 26807



 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 87/395 (22%), Positives = 147/395 (37%), Gaps = 84/395 (21%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P+F +KL+ +   +G  + L+C V+   P +I W  + + +  ++    S   +   + I
Sbjct: 4675 PSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEI 4734

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             +    D G Y C A N AG  +CS  +TV +                            
Sbjct: 4735 SQLEGTDSGTYTCSATNKAGHNQCSGHLTVKE---------------------------- 4766

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                               PP  ++ P+ Q V     V+L   V GT P+T  W K  K+
Sbjct: 4767 -------------------PPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKE 4807

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV------VDKP 1262
            +       V   +  + L + AA+    G Y   + N +G+  ++  L V      + KP
Sbjct: 4808 LHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKP 4867

Query: 1263 DP------PAGTPCASDIRSS-SLTLSWYGSSYDGG--SAVQSYSIEIWDSANKTWKELA 1313
             P         T     I  +  + +SWY    DG   +A+Q + I   D        LA
Sbjct: 4868 SPVLVLRNGQSTTFECQITGTPKIRVSWY---LDGNEITAIQKHGISFIDG-------LA 4917

Query: 1314 TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESEL----TTVGE-KPEE--PKDEV 1366
            T     F +     ++   +   A N  GT+  S E ++    T + E KP E     +V
Sbjct: 4918 T-----FQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVKYSDV 4972

Query: 1367 EVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERL 1401
            E+  +    P  +   +  N E + S  Y + +R+
Sbjct: 4973 ELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRV 5007



 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 12/174 (6%)

Query: 1206  RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG------SRQAQVNLTVV 1259
             R+++ ++    +++   G+ L +   ++     + +  EN+ G      S +     T +
Sbjct: 30267 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPL 30326

Query: 1260  DKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTW--KELATCRS 1317
             + P+PP+  P   D+  SS++LSW     DGGS V  Y IE  +++   W         +
Sbjct: 30327 NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITT 30386

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG---EKPEEPKDEVEV 1368
             T + V  L+PD EY+FR+ A N  G SE S  SE        +KP +P  E+E+
Sbjct: 30387 TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQP-GELEI 30439



 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 5/197 (2%)

Query: 1159  PKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVE 1218
             P+ PP   +    +      ++ AG+++ +   VTG    T  W K   ++ + + + ++
Sbjct: 15098 PQEPPAVELD---VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVID 15153

Query: 1219  NSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS 1278
             N    S+L I  A ++  G Y +   N  GS+ A   + V D P P          R   
Sbjct: 15154 NVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMC 15213

Query: 1279  LTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAI 1338
             L L+W     DGGS +  + IE  D+   TW++      +  ++  LL   EYKFRV A 
Sbjct: 15214 L-LNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAK 15272

Query: 1339  NVYGTSEPSQESELTTV 1355
             N +G   P +   +  V
Sbjct: 15273 NKFGCGPPVEIGPILAV 15289



 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 59/235 (25%), Positives = 95/235 (40%), Gaps = 48/235 (20%)

Query: 1029 PAFKQKLQDVHVA-EGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVS 1087
            P F +KL+   VA +G+ + L+C++S  P   + W  N   L  +    +S   S+  ++
Sbjct: 6364 PKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLT 6423

Query: 1088 IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGT 1147
            I +A  ED G Y C A N  G A CS  +TV         KAP + +++P          
Sbjct: 6424 INEASAEDSGDYICEAHNGVGDASCSTALTV---------KAPPVFTQKPS--------- 6465

Query: 1148 ESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
                           P  A+               G  V L  +++GT P    W+K RK
Sbjct: 6466 ---------------PVGAL--------------KGSDVILQCEISGTPPFEVVWVKDRK 6496

Query: 1208 QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            Q++ S+  K+ +    + L IL       G Y     N++GS     ++   + P
Sbjct: 6497 QVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPP 6551



 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 103/475 (21%), Positives = 169/475 (35%), Gaps = 98/475 (20%)

Query: 924  AENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKP--MGNAKPAETL--K 979
            A NG   A    A  V++  P+   +PS    PVG  K ++ +    +    P E +  K
Sbjct: 6439 AHNGVGDASCSTALTVKAP-PVFTQKPS----PVGALKGSDVILQCEISGTPPFEVVWVK 6493

Query: 980  PMGNAKPDENLKSASKE--------ELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAF 1031
                 +  +  K  SK          L+     + +CK  +   +D    S      P F
Sbjct: 6494 DRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRF 6553

Query: 1032 KQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLN-GKTLKTTKFIILSQEGSLCSVSIEK 1090
             +KL D     G  + L+  V    P +++W  + G+ ++ ++   +S   ++ ++ +  
Sbjct: 6554 VKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGS 6613

Query: 1091 ALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESD 1150
                + G Y C  KNDAG  ECS  +TV +                              
Sbjct: 6614 PEASNSGKYICQIKNDAGMRECSAVLTVLE------------------------------ 6643

Query: 1151 ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQ 1210
                             P +II+ PE   V  G    L   VTGT  ++  W K  +++ 
Sbjct: 6644 -----------------PARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELS 6686

Query: 1211 ESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPC 1270
                  +      + L I  A     G Y+  V+N +G     V++ V D+  PP+    
Sbjct: 6687 ADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRK 6746

Query: 1271 ASDIR---------------SSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC 1315
              D+                S+ +++ W+    DG   V     +   S N        C
Sbjct: 6747 LKDVNAILGASVVLECRVSGSAPISVGWF---QDGNEIVSGPKCQSSFSEN-------VC 6796

Query: 1316 RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKP--EEPKDEVEV 1368
               + N+  L P     +   A NV G+ E    S + TV E P  E+  D VEV
Sbjct: 6797 ---TLNLSLLEPSDTGIYTCVAANVAGSDEC---SAVLTVQEPPSFEQTPDSVEV 6845



 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 42/114 (36%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---C 1315
             +D P PPA    A D   SS+TL W    YDGGSAV  Y +EI     + W  ++T    
Sbjct: 27164 IDPPGPPAKIRIA-DSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEV 27222

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
             R+T + V +L P   Y FRV A+N  G  EP + +E     +  E P+ +++V+
Sbjct: 27223 RTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVA 27276



 Score = 71.2 bits (173), Expect = 8e-12
 Identities = 52/180 (28%), Positives = 81/180 (45%), Gaps = 19/180 (10%)

Query: 1197  PITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVN- 1255
             P T  W++  K   +    +V+   N  K             + +L EN  G  +   + 
Sbjct: 13924 PDTDKWVRCNKMPVKDTTYRVKGLTNKKKYR-----------FRVLAENLAGPGKPSKST 13972

Query: 1256  --LTVVDKPDPP--AGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
               + + D  DPP   G P   D+  +S+ L+W    +DGG+ ++SY IE+  +    W  
Sbjct: 13973 EPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVR 14032

Query: 1312  LAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK--PEEPKDEVEV 1368
             +A    +T   +  L+   EY FRVRA+N  G SEPS+ S+     EK  P  P   +EV
Sbjct: 14033 VAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEV 14092



 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 70/286 (24%), Positives = 121/286 (42%), Gaps = 28/286 (9%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+  +VA +   ++S+SV  + V+++     P F+   +N+ IKEG+  + + R  G P 
Sbjct: 1526 GEWTVVAQNRAGRSSISVILT-VEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPN 1584

Query: 62   PQVTWHRNGQPIT--SGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTV 119
            P + W +N   I      +  ++ G +G  +L I +   +D   YT  A N +G      
Sbjct: 1585 PDIVWLKNSDIIVPHKYPKIRIE-GTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRC 1643

Query: 120  ELTVEGSFAKQLGQPVVSKTLG----DRFSAPAVETRPSIWG--------------ECPP 161
            ++ VE  FA+   +  +    G       +AP +E     +G              +  P
Sbjct: 1644 KVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKP 1703

Query: 162  KFATKLGRVVVKEGQMGRFSCKIT--GRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
             F  KL  + +K      F C++T  G P   V WL    PL+ + R+ +  + G   L+
Sbjct: 1704 FFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLD 1763

Query: 220  IHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETK 265
                   D G+ TC   N  G    SA L ++      +S V E++
Sbjct: 1764 YGVAYSRDSGIITCRATNKYGTDHTSATLIVKD----EKSLVEESQ 1805



 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 60/249 (24%), Positives = 94/249 (37%), Gaps = 46/249 (18%)

Query: 1029 PAFKQKLQD-VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVS 1087
            P+F ++L + V   EG    L+ +V+   P T+ W  N   ++ T    ++ + +   + 
Sbjct: 8249 PSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQ 8308

Query: 1088 IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGT 1147
            + KA   D GLY C   NDAG A C+  + +                             
Sbjct: 8309 VRKAGMNDAGLYTCKVSNDAGSALCTSSIVI----------------------------- 8339

Query: 1148 ESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
                        K P K   PP   Q      V  GE V+L   V G++PI   W+K  +
Sbjct: 8340 ------------KEPKK---PPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGR 8384

Query: 1208 QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPD-PPA 1266
            +I+ S+      +   + L +    +   G Y     N  GS   +  +T+ DKP   PA
Sbjct: 8385 EIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPA 8444

Query: 1267 GTPCASDIR 1275
                A D R
Sbjct: 8445 TKKAAVDGR 8453



 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 92/386 (23%), Positives = 152/386 (39%), Gaps = 75/386 (19%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V V  G  + L+      P  +I W  +G  LK ++F+  S+  +  ++SI+ A  E  G
Sbjct: 27573 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGG 27632

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKP 1157
              Y  +  N        C++ V   P +  T  P  K + P                    
Sbjct: 27633 KYTVILDNAV------CRIAV---PITVITLGPPSKPKGP-------------------- 27663

Query: 1158  APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKV---TGTQPITCTWMKFRKQIQESEH 1214
                           I+F E +     +SV L   V    G   ITC  ++ R+  Q +  
Sbjct: 27664 --------------IRFDEIK----ADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWK 27705

Query: 1215  MKVEN-SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGT 1268
             M   + +    K+  L    E+   + +  EN+ G  Q  V+  +V K     P PP G 
Sbjct: 27706 MVCSSVARTTFKVPNLVKDAEYQ--FRVRAENRYGVSQPLVSSIIVAKHQFRIPGPP-GK 27762

Query: 1269  PCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CRSTSFNVQDLL 1326
             P   ++ S  ++L+W    YDGGS V  + +E  +  +  W+++ T       +    L+
Sbjct: 27763 PVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLV 27822

Query: 1327  PDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTIN 1386
                +Y+FRV A N  G S PS  S+  T+   P +P    +  D       V   T+T+ 
Sbjct: 27823 EGLDYQFRVYAENSAGLSSPSDPSKF-TLAVSPVDPPGTPDYID-------VTRETITLK 27874

Query: 1387  TEQKVSD------FYDIEERLGSGKF 1406
                 + D       Y IE+R G+ ++
Sbjct: 27875 WNPPLRDGGSKIVGYSIEKRQGNERW 27900



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 79/335 (23%), Positives = 125/335 (37%), Gaps = 54/335 (16%)

Query: 1035  LQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPE 1094
             L  + V  G K+ L   V+  P   I WT     LK  K I +       +V+I  +   
Sbjct: 13697 LAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRS 13756

Query: 1095  DRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVK 1154
             D G Y   A N  G+A    +V V D P                   PP     +D T +
Sbjct: 13757 DTGTYIIEAVNVCGRATAVVEVNVLDKPG------------------PPAAFDITDVTNE 13798

Query: 1155  KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEH 1214
                    PP+     +I  +  +++    E                 W K    ++++  
Sbjct: 13799 SCLLTWNPPRDDGGSKITNYVVERRATDSE----------------VWHKLSSTVKDTNF 13842

Query: 1215  MKVENSENGSKLTILAARQEHCGCYTLLVENKLG-SRQAQVN-LTVVDKPDPPAGTPC-- 1270
                       K T L   +E+   + +  EN  G     Q + +T   + DPP G P   
Sbjct: 13843 ----------KATKLIPNKEY--IFRVAAENMYGVGEPVQASPITAKYQFDPP-GPPTRL 13889

Query: 1271  -ASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLP 1327
               SDI   ++TL+W     DGGS +  Y +E  D     W        + T++ V+ L  
Sbjct: 13890 EPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTN 13949

Query: 1328  DHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
               +Y+FRV A N+ G  +PS+ +E   + +  + P
Sbjct: 13950 KKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPP 13984



 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESR--HFQIDYDEDGNCS 1746
            P F++ ++ + V+EGS A F+  I G+P PEV WF+D Q I  S     QI +  DG   
Sbjct: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISF-SDGRAK 64

Query: 1747 LIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            L I  V   +  +Y+ KA N  G+AT TAEL+V+
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 51/223 (22%), Positives = 89/223 (39%), Gaps = 38/223 (17%)

Query: 26   SMPLTEAPAFI--LPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDC 83
            ++ + E P+F+  + P  L +  G +A+   +++G P  QVTW +N + ++      +  
Sbjct: 3730 TVTVREPPSFVKKVDPSYLMLP-GESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYF 3788

Query: 84   GIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR 143
             +     L I  V  ED G Y+CEA N  G+   + E+ ++                   
Sbjct: 3789 -VNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKE------------------ 3829

Query: 144  FSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQP 203
                            PP F   L    +  G      C+++G    +++W K    ++ 
Sbjct: 3830 ----------------PPSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRS 3873

Query: 204  SARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSA 246
            S +  +  +  +  LEI   N  DVG Y C+V N  GK    A
Sbjct: 3874 SKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMA 3916



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 61/269 (22%), Positives = 98/269 (36%), Gaps = 61/269 (22%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P+F+Q    V V  G  L     +   PP  + W    + L   +   +S E  +  + +
Sbjct: 6834 PSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELEL 6893

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             +  P + G Y C+  NDAG A C+  + V +                            
Sbjct: 6894 FEVQPLESGDYSCLVTNDAGSASCTTHLFVKEP--------------------------- 6926

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
              AT  K+ A                  D  V  G  + L    TGT PI+ +W+K    
Sbjct: 6927 --ATFVKRLA------------------DFSVETGSPIVLEATYTGTPPISVSWIKDEYL 6966

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP------ 1262
            I +SE   +  +E  + L IL +  E    Y+ L+EN+ G    +  ++V++ P      
Sbjct: 6967 ISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPL 7026

Query: 1263 -------DPPAGTPCASDIRSSSLTLSWY 1284
                     PA   C  D  +  + +SWY
Sbjct: 7027 EHVEAVIGEPATLQCKVD-GTPEIRISWY 7054



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 153/729 (20%), Positives = 270/729 (37%), Gaps = 101/729 (13%)

Query: 438   LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVA 497
             L V E+   F+  LKD  V E +    +C +  T    + W      I+ +         
Sbjct: 11479 LTVKEIELDFAVPLKDVTVPERRQARFECVL--TREANVIWSKGPDIIKSSDKFDIIADG 11536

Query: 498   ELHI---QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAP 554
             + HI    D+  +D G YT   E    + S   +VT    K                   
Sbjct: 11537 KKHILVINDSQFDDEGVYTAEVEGK--KTSARLFVTGIRLK------------------- 11575

Query: 555   IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQ 614
              F+  L D  V +G   T   ++S +    V+W  N  ++  S        G  H L ++
Sbjct: 11576 -FMSPLEDQTVKEGETATFVCELS-HEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMK 11633

Query: 615   EVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCA 674
             EV  +D      +      E+ + A L V E      P+F  K    TA     + + C 
Sbjct: 11634 EVTLDDISQIKAQV----KELSSTAQLKVLE----ADPYFTVKLHDKTAVEKDEITLKCE 11685

Query: 675   IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
             ++ D    V W +DG+ +      + +  +     L +KK      G+Y          C
Sbjct: 11686 VSKDV--PVKWFKDGEEIVPSP-KYSIKADGLRRILKIKKADLKDKGEYV---------C 11733

Query: 735   SCQVSLMLQNSSARA-LPRGREPASCEDLCGGGVG---ADGGGSDRYGSLRPGWPARGQG 790
              C       N +  A L +  +P    ++  G       +    D +G     W  +GQ 
Sbjct: 11734 DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQ----WKLKGQP 11789

Query: 791   WLEEEDGEDVRGVLKRRV--------ETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLS 842
                  D E +    K  +         T + + +A   +    L  ++L    +    LS
Sbjct: 11790 LTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKEL--PLIFITPLS 11847

Query: 843   EDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQV--DFRSVLAKKGTSKTPVPE 900
               D+K    ++  F   + R+  PKT     R +   Q++  D R  L K GT  + V +
Sbjct: 11848 --DVKVFEKDEAKFECEVSRE--PKTF----RWLKGTQEITGDDRFELIKDGTKHSMVIK 11899

Query: 901   KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA 960
                    A   F +      +    +G    E +  K +   K ++  +    +  V  +
Sbjct: 11900 SAAFEDEAKYMFEA------EDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELS 11953

Query: 961   KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK 1020
                  +K   N +   T + + + + +    S + ++L  D  + +  +    G +   K
Sbjct: 11954 HDNIRVKWFKNDQRLHTTRSV-SMQDEGKTHSITFKDLSIDDTSQIRVEA--MGMSSEAK 12010

Query: 1021  RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE 1080
              +  +G  P F  KLQD    E  +++LQC++S    A + W  +GK +K +K  ++  +
Sbjct: 12011 LTVLEGD-PYFTGKLQDYTGVEKDEVILQCEISK-ADAPVKWFKDGKEIKPSKNAVIKAD 12068

Query: 1081  GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS 1140
             G    + ++KAL  D G Y C    D G  + S ++ ++D          E+K  RP  S
Sbjct: 12069 GKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDR---------EIKLVRPLHS 12115

Query: 1141  LPPVLGTES 1149
             +  V+ TE+
Sbjct: 12116 V-EVMETET 12123



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 94/414 (22%), Positives = 156/414 (37%), Gaps = 55/414 (13%)

Query: 1148  ESDATVKKKP-----APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTW 1202
             ESD  V + P      P TP   A+    +     + V  G S  +   +   +  +  W
Sbjct: 23410 ESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW 23469

Query: 1203  MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
              K  K I      K +N E G +             + +  EN +G  +A  N       
Sbjct: 23470 TKVNKTIIHDTQFKAQNLEEGIEYE-----------FRVYAENIVGVGKASKNSECYVAR 23518

Query: 1263  DP--PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCR--ST 1318
             DP  P GTP    ++ + +TL W    YDGGS +  Y +E  D  +  W + +      T
Sbjct: 23519 DPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIET 23578

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEP--------KDEVEVS 1369
              F V  L  D  Y+FRV A N  G  S+PS  +   T  ++ E P        +D + V+
Sbjct: 23579 QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVN 23638

Query: 1370  DDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFR--LVEKKTRKVWAGKF-F 1426
               +    E D     + T + +    +IEE          F+  L+ K   ++  G++  
Sbjct: 23639 AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYIL 23698

Query: 1427  KAYSAKEKENIRQEISIMNCLHHPK-LVQCVDAFEEKANIVMVLEIVSGGELFERIIDED 1485
             +A +    ++    + +++    P+  VQ      EK ++     +  GG      + E 
Sbjct: 23699 RASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEK 23758

Query: 1486  FE-------LTERECIKYMRQIS---EGVEYIHKQGIVHLDLKPENIMCVNKTG 1529
              E       +   E +    +++   EG EY+ +            IM VNK G
Sbjct: 23759 RETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFR------------IMAVNKYG 23800



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 1237  GC---YTLLVENKLGSRQAQVNLTVVDKPDP-----PAGTPCASDIRSSSLTLSWYGSSY 1288
             GC   Y +  EN  G         ++   DP     P   P   D   +++T++W    +
Sbjct: 26050 GCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLF 26109

Query: 1289  DGGSAVQSYSIEIWDSANKTWK-ELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             DGG+ +  Y++E   S +  WK  + + R T + +  L    EY FRV+++N  G S+PS
Sbjct: 26110 DGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPS 26169

Query: 1348  QESELTTVGEKPEEPKDEVE 1367
               S+     E+ EEP  +++
Sbjct: 26170 DSSDPQIAKEREEEPLFDID 26189



 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 84/348 (24%), Positives = 127/348 (36%), Gaps = 66/348 (18%)

Query: 1029  PAFKQKLQDV-HVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKF--IILSQEGSLCS 1085
             P    KL  V  V  G  + L+  V   P   + WT +      T+   + +        
Sbjct: 18201 PVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 18260

Query: 1086  VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPAS-ENTKAPEMKSRRPKSSLPPV 1144
              S+ KA   D G Y   A N AG       V V D P    N K  ++ S R        
Sbjct: 18261 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDR-------- 18312

Query: 1145  LGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
                    TV   P P+      +   I++  E +++                     W  
Sbjct: 18313 ------CTVCWDP-PEDDGGCEIQNYILEKCETKRM--------------------VWST 18345

Query: 1205  FRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK--- 1261
             +   +             G+ +T L    E+   + +  ENK+G+     +  V+ K   
Sbjct: 18346 YSATVLTP----------GTTVTRLIEGNEYI--FRVRAENKIGTGPPTESKPVIAKTKY 18393

Query: 1262  -----PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--AT 1314
                  PDPP  T  + +     +T+ W    YDGG ++  Y +E  +  +  W  +  + 
Sbjct: 18394 DKPGRPDPPEVTKVSKE----EMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSA 18449

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                    VQ+LLPDHEY+FRV+A N  G  EPS  S    V + P EP
Sbjct: 18450 IPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR-PVVAKDPIEP 18496



 Score = 68.6 bits (166), Expect = 5e-11
 Identities = 81/389 (20%), Positives = 141/389 (36%), Gaps = 63/389 (16%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P+ +      +V   ++L +       P AT+ W  +G+TLK T  + +S   ++ S+SI
Sbjct: 25395 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSI 25454

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             ++A  ED G Y+    N AG       + V D P                   PP     
Sbjct: 25455 KEASKEDVGTYELCVSNSAGSITVPITIIVLDRPG------------------PPGPIRI 25496

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
              + +         PP+     QI  +  ++K                +  + TW    + 
Sbjct: 25497 DEVSCDSITISWNPPEYDGGCQISNYIVEKK----------------ETTSTTWHIVSQA 25540

Query: 1209  IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK----PDP 1264
             +  +  +K+     GS+             + +  EN+ G      +  VV +    P  
Sbjct: 25541 VARTS-IKIVRLTTGSEYQ-----------FRVCAENRYGKSSYSESSAVVAEYPFSPPG 25588

Query: 1265  PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCRS 1317
             P GTP       S++ ++W     DGGS V  Y +E       +W  ANK          
Sbjct: 25589 PPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANK-----ILIAD 25643

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPE 1377
             T   V  L     Y++RV A N+ G  + S+  E       P +P  + EV++   K   
Sbjct: 25644 TQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCE-PVPARDPCDPPGQPEVTNITRKSVS 25702

Query: 1378  VDYRTVTINTEQKVSDFYDIEERLGSGKF 1406
             + +     +   K++ +      L  G++
Sbjct: 25703 LKWSKPHYDGGAKITGYIVERRELPDGRW 25731



 Score = 68.6 bits (166), Expect = 5e-11
 Identities = 60/294 (20%), Positives = 118/294 (40%), Gaps = 57/294 (19%)

Query: 1022  SESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEG 1081
             S+    APAF  + +  ++ EG+ +L  C++S +P   I W  N   +  +  + +S+  
Sbjct: 33127 SKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSR 33186

Query: 1082  SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV---DDAPASE------------- 1125
             ++ S+ I  A   D G Y   AKN  GQ   +  + V    + P+ E             
Sbjct: 33187 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQG 33246

Query: 1126  --NTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAA----------------- 1166
               ++++ +M + + ++S      + + +  + K A  +    +                 
Sbjct: 33247 SFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGI 33306

Query: 1167  --------------------MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
                                 +PP+I   P D  +  G+ + +    TG      TW    
Sbjct: 33307 SNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGG 33366

Query: 1207  KQI--QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
             ++I  QE     +EN+++ + L I+  +++  G YTL + N+ GS  A VN+ +
Sbjct: 33367 RKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 50/235 (21%), Positives = 84/235 (35%), Gaps = 45/235 (19%)

Query: 1028 APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVS 1087
            AP  K+K++ + VA G      C++ S P     W   G+ +  +    +     + S+ 
Sbjct: 3455 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLE 3514

Query: 1088 IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGT 1147
            I +    D G Y C A N+ G   C+  +TV +A                          
Sbjct: 3515 ILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEA-------------------------- 3548

Query: 1148 ESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
                                PP  +  P+      G++ +    VTGT  I   W K   
Sbjct: 3549 -------------------YPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGA 3589

Query: 1208 QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
             +  S + ++ ++EN   L +     +  G Y+    NK G+   Q  L ++DKP
Sbjct: 3590 ALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKP 3644



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 48/162 (29%), Positives = 76/162 (46%), Gaps = 12/162 (7%)

Query: 1624 KWQKTGNAVRA-----IGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLE 1678
            KW K G  + A     I   +++A +   S     +G  T  ++ E   S  + +   L+
Sbjct: 4049 KWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLD 4108

Query: 1679 AVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQID 1738
                    + P+F+K +R+++ V     R DCKI G     V WFKD + I  S  ++I 
Sbjct: 4109 R------DIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIA 4162

Query: 1739 YDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            + E G  SL I  V  +D   +TC+A NS+G    +  LIV+
Sbjct: 4163 FVE-GTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQ 4203



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 60/273 (21%), Positives = 101/273 (36%), Gaps = 63/273 (23%)

Query: 1028 APA-FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSV 1086
            APA F ++L D  + +GK L+L+   +  PP ++ W  NG  +  ++   ++       +
Sbjct: 7866 APAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAIL 7925

Query: 1087 SIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLG 1146
             I  +  ED G Y C  +N +G+  CS Q+ + +                          
Sbjct: 7926 EIPSSTVEDAGQYNCYIENASGKDSCSAQILILE-------------------------- 7959

Query: 1147 TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
                                 PP  ++  E  KV  G+S  L  ++ GT  I  +W K  
Sbjct: 7960 ---------------------PPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGD 7998

Query: 1207 KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPA 1266
             +++ +   K+    N + L          G Y    EN +G   A   LTV ++  PP+
Sbjct: 7999 TKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPS 8058

Query: 1267 ------------GTPCASDIR---SSSLTLSWY 1284
                        G P   D     S  +++SWY
Sbjct: 8059 FSRQLRDVQETVGLPVVFDCAISGSEPISVSWY 8091



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

Query: 1668 SEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQ 1727
            S +  S A L   AE  P   P F + ++ + V +GS  R   ++ G P P V +++D  
Sbjct: 86   SGQATSTAELLVKAETAP---PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGA 142

Query: 1728 SIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
             I+ S  FQI  + D   SL+I++   +D   Y+  A NS+G AT TAEL+V+  EE
Sbjct: 143  EIQSSLDFQISQEGD-LYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 63/233 (27%), Positives = 93/233 (39%), Gaps = 41/233 (17%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT---TKFIILSQEGSLCS 1085
            P   Q+LQ V V  GK       +S  P   I W    + L T    KF+   QE +L  
Sbjct: 3239 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3298

Query: 1086 VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVL 1145
            +   +A PED  +Y C AKND G A  S  ++V+          PE+ S  P   +P   
Sbjct: 3299 I---EAFPEDAAVYTCEAKNDYGVATTSASLSVE---------VPEVVS--PDQEMP--- 3341

Query: 1146 GTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF 1205
                                  PP II   +D     G+      +V+GT  +  +W   
Sbjct: 3342 --------------------VYPPAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSK 3380

Query: 1206 RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
             K+I+ S   ++   E+  +L I  A  E  G YT +  N +G   +  NL++
Sbjct: 3381 DKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3433



 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 78/330 (23%), Positives = 117/330 (35%), Gaps = 66/330 (20%)

Query: 1035  LQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPE 1094
             ++ + V  G  +     +   P  T  WT +G  +KT +   +  +     ++I+  L  
Sbjct: 17517 IEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRR 17576

Query: 1095  DRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVK 1154
             D G Y+    N AG    +  +TV D P              P   +  +  T    T+ 
Sbjct: 17577 DTGEYQITVSNAAGSKTVAVHLTVLDVPGP------------PTGPINILDVTPEHMTIS 17624

Query: 1155  KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEH 1214
              +P    P      P I    E Q  R     + +G V+                     
Sbjct: 17625 WQP----PKDDGGSPVINYIVEKQDTRK----DTWGVVS--------------------- 17655

Query: 1215  MKVENSENGSKLTILAARQEHCGC---YTLLVENKLGSRQAQVNLTVVDK----PDPPAG 1267
                    +GS  T L       GC   + +  ENK+G      +   V K    P  P G
Sbjct: 17656 -------SGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPG 17708

Query: 1268  TPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEI------WDSANKTWKELATCRSTSFN 1321
              P  +DI  ++ T+SW     DGGS +  Y +E       W   NKT           F 
Sbjct: 17709 KPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKT-----PIADLKFR 17763

Query: 1322  VQDLLPDHEYKFRVRAINVYGTSEPSQESE 1351
             V  L   + Y+FRV A N+ G S+PS  S+
Sbjct: 17764 VTGLYEGNTYEFRVFAENLAGLSKPSPSSD 17793



 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 76/322 (23%), Positives = 120/322 (37%), Gaps = 60/322 (18%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             V  G  + L   V   P  T+ W  +G  LK  + I ++ + +LC++ +     +D G Y
Sbjct: 19307 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 19366

Query: 1100  KCVAKNDAGQAECSCQVTVDDAPASE-NTKAPEMKSRRPKSSLPPVL---GTESDATVKK 1155
                A+N +G    + ++ V D P    + K  +M S R   S  P L   G+E    +  
Sbjct: 19367 TITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVD 19426

Query: 1156  KPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM 1215
             K     P  A                         +V+ T PIT   ++  K I+  E+ 
Sbjct: 19427 KRETSRPNWA-------------------------QVSATVPITSCSVE--KLIEGHEYQ 19459

Query: 1216  KVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP--DPPA--GTPCA 1271
                                    + +  ENK G          + K   DPP     P  
Sbjct: 19460 -----------------------FRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVI 19496

Query: 1272  SDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDH 1329
             S+I    +T+SW   + DGGS +  Y +E  ++    W ++        +     L    
Sbjct: 19497 SNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGT 19556

Query: 1330  EYKFRVRAINVYGTSEPSQESE 1351
             EY+FRV AIN  G  +PS  S+
Sbjct: 19557 EYEFRVTAINKAGPGKPSDASK 19578



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 56/235 (23%), Positives = 93/235 (39%), Gaps = 48/235 (20%)

Query: 1029 PAFKQKLQDVHVAE-GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVS 1087
            P F +K   V V   G+    +CQ++  P   + W L+G  +   +   +S    L +  
Sbjct: 4861 PQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQ 4920

Query: 1088 IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGT 1147
            I  A  E+ G Y C A+NDAG A CS ++ V + P    T   E+K              
Sbjct: 4921 ISGARVENSGTYVCEARNDAGTASCSIELKVKEPP----TFIRELK-------------- 4962

Query: 1148 ESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
                                P +++++ +         VEL  +VTGT P   TW+K  +
Sbjct: 4963 --------------------PVEVVKYSD---------VELECEVTGTPPFEVTWLKNNR 4993

Query: 1208 QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            +I+ S+   + +  +   L I        G Y  +V N+ GS      + + + P
Sbjct: 4994 EIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPP 5048



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 60/261 (22%), Positives = 98/261 (37%), Gaps = 47/261 (18%)

Query: 1005 DVNCKRGHAGTTDNEK---RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATII 1061
            +  CK  ++  T + K   R + +   P+F ++L+D+    G  + L C+++   P  + 
Sbjct: 6148 EYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVC 6207

Query: 1062 WTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDA 1121
            W  +G  L+  + +  S   ++ ++ I +      G Y C A N  G A  S ++T    
Sbjct: 6208 WYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLT---- 6263

Query: 1122 PASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVR 1181
                        +R PK S                            P     P    V 
Sbjct: 6264 ------------AREPKKS----------------------------PFFDIKPVSIDVI 6283

Query: 1182 AGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTL 1241
            AGES +    VTG QP+  TW K  K+I+   +  +    N   L IL   +   G YT 
Sbjct: 6284 AGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTC 6343

Query: 1242 LVENKLGSRQAQVNLTVVDKP 1262
               N +G       L+V + P
Sbjct: 6344 QATNDVGKDMCSAQLSVKEPP 6364



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 50/237 (21%), Positives = 87/237 (36%), Gaps = 43/237 (18%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F  +L  V    G+    +C V+   P  + W  + + +++     +S   +   +++
Sbjct: 8153 PFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTV 8212

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             K    D G Y C A N+ G+  C+ Q+ + +                    +PP     
Sbjct: 8213 LKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKER------------------LIPPSFTKR 8254

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
               TV++                           G S +L G+V G+QPIT  W K   +
Sbjct: 8255 LSETVEETE-------------------------GNSFKLEGRVAGSQPITVAWYKNNIE 8289

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP 1265
            IQ + + ++    N   L +  A     G YT  V N  GS     ++ + +   PP
Sbjct: 8290 IQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPP 8346



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 82/367 (22%), Positives = 139/367 (37%), Gaps = 64/367 (17%)

Query: 1014  GTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVS--------SDPPATIIWTLN 1065
             G +D    S+ Q      ++ L D+     K L+++   S          P   ++W+  
Sbjct: 26164 GASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKP 26223

Query: 1066  GKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASE 1125
                L+T  ++  +   S  S++IE A   D G Y    +N    A  +  V V D P   
Sbjct: 26224 DTDLRTRAYVDTTD--SRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPG-- 26279

Query: 1126  NTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGES 1185
                             PP   T  D T +          A +   +   PE+        
Sbjct: 26280 ----------------PPTNITVQDVTKES---------AVLSWDV---PEND------- 26304

Query: 1186  VELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLV-- 1243
                     G  P+    ++ R   + S+   V  + N ++L+      +    Y   V  
Sbjct: 26305 --------GGAPVKNYHIEKR---EASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSG 26353

Query: 1244  ENKLG---SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE 1300
             EN+ G     + +  + + +KP PP      S I   S++L+W    +DGGS +  Y +E
Sbjct: 26354 ENEFGVGIPAETKEGVKITEKPSPPEKLGVTS-ISKDSVSLTWLKPEHDGGSRIVHYVVE 26412

Query: 1301  IWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPE 1360
               +   K W + A  +ST   V  L  + EY FRV A N  G S+P +      + E+ E
Sbjct: 26413 ALEKGQKNWVKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLE 26472

Query: 1361  EPKDEVE 1367
              P+ +++
Sbjct: 26473 PPEIDMK 26479



 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 60/253 (23%), Positives = 98/253 (38%), Gaps = 44/253 (17%)

Query: 27   MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
            + + E P F+  P++  +      + +  V G     + W ++ + + SG    +     
Sbjct: 4762 LTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDT 4821

Query: 87   GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSA 146
             T SL + A    D G Y C+ +N  G       L     F K+                
Sbjct: 4822 ST-SLELFAAKATDSGTYICQLSNDVGTATSKATL-----FVKE---------------- 4859

Query: 147  PAVETRPSIWGECPPKFATKLGRVVV-KEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSA 205
                         PP+F  K   V+V + GQ   F C+ITG P+ +V+W      +    
Sbjct: 4860 -------------PPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQ 4906

Query: 206  RVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETK 265
            +  +S  +G+   +I G   ++ G Y C   N +G AS S EL ++       +F+RE K
Sbjct: 4907 KHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKVK----EPPTFIRELK 4962

Query: 266  ATN----SDVRKE 274
                   SDV  E
Sbjct: 4963 PVEVVKYSDVELE 4975



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 38/113 (33%), Positives = 58/113 (51%), Gaps = 15/113 (13%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P+F   +  ++ V G +A F+C + G    +V W KD + IR    +QI Y E+ +  L 
Sbjct: 8153 PFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLEN-SAHLT 8211

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAEL--------------IVETMEEGEG 1787
            +  V   D  +YTC AVN +G+ +CTA+L              + ET+EE EG
Sbjct: 8212 VLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEG 8264



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 79/316 (25%), Positives = 128/316 (40%), Gaps = 54/316 (17%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             + +  GK L +   V+  P  T +WT     L   + +++   G+   + I+ AL +D G
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDR-VVIDNVGTKSELIIKDALRKDHG 15172

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKP 1157
              Y   A N  G    + +V V D P              P   L PV+ T     +    
Sbjct: 15173 RYVITATNSCGSKFAAARVEVFDVPG-------------PVLDLKPVV-TNRKMCLLNWS 15218

Query: 1158  APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKV 1217
              P+    + +   II+  +D K+            T  QPI            E+E  K 
Sbjct: 15219 DPEDDGGSEITGFIIE-RKDAKMH-----------TWRQPI------------ETERSKC 15254

Query: 1218  ENSENGSKLTILAARQEHCGCYTLLVENKLG-SRQAQVN-LTVVDKPDPPAGTP--CASD 1273
             +       +T L   QE+   + ++ +NK G     ++  +  VD   PP        ++
Sbjct: 15255 D-------ITGLLEGQEYK--FRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTE 15305

Query: 1274  IRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEY 1331
                S++TL W     +GGS +Q Y IE        ++ +    C +TSF V++L     Y
Sbjct: 15306 RTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMY 15365

Query: 1332  KFRVRAINVYGTSEPS 1347
             +FRV+A+N  G SEPS
Sbjct: 15366 EFRVKAVNEIGESEPS 15381



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 74/315 (23%), Positives = 115/315 (36%), Gaps = 53/315 (16%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G+   L+  VS  PP T+ W+ +GK L+ T  + +       ++  + +   D G Y   
Sbjct: 21476 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 21535

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
             A N  G A+    V V D P              P      V    S+  V     P   
Sbjct: 21536 ATNPGGFAKHIFNVKVLDRPG-------------PPEGPLAVTEVTSEKCVLSWFPPLDD 21582

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
               A +   I+Q  E  ++                     W     ++Q ++         
Sbjct: 21583 GGAKIDHYIVQKRETSRL--------------------AWTNVASEVQVTK--------- 21613

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV-----DKPDPPAGTPCASDIRSS 1277
               K+T L    E+   + ++  NK G  +   +  V+       PDPP   P  + I   
Sbjct: 21614 -LKVTKLLKGNEYI--FRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKN-PEVTTITKD 21669

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYKFRV 1335
             S+ + W     DGGS + +Y +E  D A + W +    T     + V  L   HEY+FR+
Sbjct: 21670 SMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRI 21729

Query: 1336  RAINVYGTSEPSQES 1350
              A N  G S PS  S
Sbjct: 21730 MAENAAGISAPSPTS 21744



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 40/122 (32%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 1233  QEHCGCY-TLLVENKLG---SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSY 1288
             QE C  Y  +L EN+ G     +   ++   ++P PP G     D+  +S++LSW    +
Sbjct: 22016 QEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPP-GKITLMDVTRNSVSLSWEKPEH 22074

Query: 1289  DGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1348
             DGGS +  Y +E+    +  W   AT + T   +  L+   EY FRV A N  G S+P Q
Sbjct: 22075 DGGSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQ 22134

Query: 1349  ES 1350
              S
Sbjct: 22135 LS 22136



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 41/116 (35%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATCRST 1318
             P PP+  P   D    S++L+W    YDGG+ +  Y +E+ +     W  +   AT R+T
Sbjct: 29342 PGPPSA-PRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNT 29400

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEK 1374
              F V DL    +Y FRV A+NV G SE S+        E+ E P  ++E++DD +K
Sbjct: 29401 EFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP--DLELADDLKK 29454



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 54/234 (23%), Positives = 84/234 (35%), Gaps = 44/234 (18%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F +KL+DVH   G  +  +C+++   P  + W  +G  LK    +  S   ++ ++ I
Sbjct: 7116 PFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQI 7175

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             +      G Y C A N  G A  S ++ + +                            
Sbjct: 7176 LQTDQSHIGQYNCSASNPLGTASSSAKLILSEHE-------------------------- 7209

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                              +PP     P    +  GES      VTGT PI  TW K  ++
Sbjct: 7210 ------------------VPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNRE 7251

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            I+   + K+   EN + LT+L   +   G YT    N  G       L V + P
Sbjct: 7252 IRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPP 7305



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 84/382 (21%), Positives = 154/382 (40%), Gaps = 28/382 (7%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VV+ G   R      GRP P++TW +       + +V + +      L I   +++D G
Sbjct: 24034 IVVRAGGSARIHIPFKGRPTPEITWSREEGEF--TDKVQIEKGVNYTQLSIDNCDRNDAG 24091

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLE 289
              Y   + N SG  S SA ++++ LD+         K    +VRK+   ++ +   +D   
Sbjct: 24092 KYILKLENSSG--SKSAFVTVKVLDTPGPPQNLAVK----EVRKDSAFLVWEPPIIDG-- 24143

Query: 290   AAAKSKNCSSPQRGGSPPWAANSQPQPPRES-KLESCKDSPRTAPQTPVLQKTSSSI--- 345
               AK KN    +R  +    AN   +  + S K+E+  +      +     +    +   
Sbjct: 24144 -GAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVE 24202

Query: 346   TLQAARVQPEPRAPGLGVLSPSG--------EERKRPAPPRPATFPTRQPGLGSQ--DVV 395
             T+ A +    P  PG   L+           E+ +     R   +       G++   +V
Sbjct: 24203 TVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIV 24262

Query: 396   SKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCA 455
             +++      + G       +F  K  +++ K +  V         + + PS        +
Sbjct: 24263 AESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYS 24322

Query: 456   VIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCE--AGVAELHIQDALPEDHGTY 512
             +  G+D  ++  V G P P I+W+ +G+P+ Q  R   E  A    LHI++   +D G Y
Sbjct: 24323 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 24382

Query: 513   TCLAENALGQVSCSAWVTVHEK 534
             T  A N+ G  + +  V V EK
Sbjct: 24383 TVTATNSAGTATENLSVIVLEK 24404



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 62/258 (24%), Positives = 96/258 (37%), Gaps = 37/258 (14%)

Query: 31    EAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGG-RFLLDCGIRGTF 89
             +AP F    RNL ++  + A    +V G+P+P V W+R G+ I + G ++ +     G  
Sbjct: 30926 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYH 30985

Query: 90    SLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAV 149
              L+I +V ++D   Y   ATN  G+   T  L VE      L                  
Sbjct: 30986 QLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHL------------------ 31027

Query: 150   ETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSV 209
                        PK    +G V    G++       +G+P P +TW KG   +  +    V
Sbjct: 31028 -----------PKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQV 31076

Query: 210   SEKNGMQVLEI-HGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATN 268
                     L   +GV + D G Y     N  G    + EL +  +    R          
Sbjct: 31077 IVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRG------VKV 31130

Query: 269   SDVRKEVTNVISKESKLD 286
             SDV ++  N+   E   D
Sbjct: 31131 SDVSRDSVNLTWTEPASD 31148



 Score = 65.1 bits (157), Expect = 6e-10
 Identities = 53/220 (24%), Positives = 83/220 (37%), Gaps = 32/220 (14%)

Query: 29   LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
            + E P F+     + +  G +A  + ++ G PE  V+W++    +     + +       
Sbjct: 7957 ILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFR-NNV 8015

Query: 89   FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPA 148
             +LV + V   D G+Y C+A N  G    +  LTV+                        
Sbjct: 8016 ATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQ---------------------- 8053

Query: 149  VETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVS 208
                     + PP F+ +L  V    G    F C I+G     V+W K   PL+ S  V 
Sbjct: 8054 ---------KLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQ 8104

Query: 209  VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAEL 248
             S  +    L I   ++   G Y+C   N  G AS SA L
Sbjct: 8105 TSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARL 8144



 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 71/342 (20%), Positives = 124/342 (36%), Gaps = 55/342 (16%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P+ K       +  G+ L ++  V   P   I W  +G+ LK T  + + +  +   + I
Sbjct: 24312 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHI 24371

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             ++   +D G Y   A N AG A  +  V V + P                   PPV    
Sbjct: 24372 KEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG------------------PPVGPVR 24413

Query: 1149  SD-ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
              D  +         PP      QI  +  +++                   T TW     
Sbjct: 24414 FDEVSADFVVISWEPPAYTGGCQISNYIVEKR----------------DTTTTTWHMVSA 24457

Query: 1208  QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV-----DKP 1262
              +  +  +K+   + G++             + +  EN+ G      +  V+      +P
Sbjct: 24458 TVARTT-IKITKLKTGTEYQ-----------FRIFAENRYGKSAPLDSKAVIVQYPFKEP 24505

Query: 1263  DPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSF 1320
              PP GTP  + I    + + W+    DGG+ +  Y +E  +  +  W +L     + T F
Sbjct: 24506 GPP-GTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKF 24564

Query: 1321  NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                 L    EY+F+V A N+ G  +PS+ SE     +  + P
Sbjct: 24565 KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPP 24606



 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 67/307 (21%), Positives = 118/307 (38%), Gaps = 39/307 (12%)

Query: 9     SSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHR 68
             S+ + + SL  + S    +  T A   +  PR++ + EG +A+F     G P P VTW R
Sbjct: 32538 SAALEEKSLE-EKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLR 32596

Query: 69    NGQPITSGGRF-LLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGS- 126
              GQ +++  R  +     + TF   I +V   D G Y+    N  G ++    LT++ + 
Sbjct: 32597 KGQVLSTSARHQVTTTKYKSTFE--ISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKAR 32654

Query: 127   -FAKQLGQPVVSKTLGDRFSAP---------------------AVETRPS-------IWG 157
                K +  P   K+   R  +P                       ET+P+       +  
Sbjct: 32655 VTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPV 32714

Query: 158   ECPPKFATKLGRVVVKEGQMGRFSCKITGR--PQPQVTWLKGNVPLQPSARVSVS-EKNG 214
               PPK    L     KE  + + +C +        +VTW K    L+ +         +G
Sbjct: 32715 SAPPKITQFLKAEASKE--IAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADG 32772

Query: 215   MQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKE 274
                L+I+ + + D G Y C +    G +  + +   Q   S +    + ++   SD +  
Sbjct: 32773 TYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTT 32832

Query: 275   VTNVISK 281
              + V  K
Sbjct: 32833 ESTVTRK 32839



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 69/307 (22%), Positives = 116/307 (37%), Gaps = 64/307 (20%)

Query: 985  KPDENLKS------ASKEELKKDVKND--VNCKRGHA-GTTDNEKR--SESQGTAPAFKQ 1033
            + DENL++      A+ + L+ D+ +    +C   +  GT  +  R  +     +P F  
Sbjct: 6216 RDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDI 6275

Query: 1034 KLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALP 1093
            K   + V  G+    +C V+   P  I W+ + K ++      ++  G+   + I K   
Sbjct: 6276 KPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGK 6335

Query: 1094 EDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATV 1153
             D G Y C A ND G+  CS Q++V +                                 
Sbjct: 6336 GDSGQYTCQATNDVGKDMCSAQLSVKE--------------------------------- 6362

Query: 1154 KKKPAPKTPPKAAMPPQIIQFPEDQKV-RAGESVELFGKVTGTQPITCTWMKFRKQIQES 1212
                          PP+ ++  E  KV + GES++L  K++G+  I  +W +   ++ ES
Sbjct: 6363 --------------PPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHES 6408

Query: 1213 EHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP-----DPPAG 1267
                +    + + LTI  A  E  G Y     N +G       LTV   P       P G
Sbjct: 6409 WKYNMSFINSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVG 6468

Query: 1268 TPCASDI 1274
                SD+
Sbjct: 6469 ALKGSDV 6475



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 31/114 (27%), Positives = 63/114 (55%), Gaps = 7/114 (6%)

Query: 1667 ESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1726
            E+ +D+ +A +  +        PYF + +  +E V G  A   CK++G P+  + W+K+ 
Sbjct: 7004 EAGQDICEALVSVLEP------PYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEH 7057

Query: 1727 QSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
              +R +  +++ + ++   SL+I+ V   D  +Y+CKA NS+G    +A L+++
Sbjct: 7058 TKLRSAPAYKMQF-KNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIK 7110



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 6/189 (3%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VR G+++ +  +V G      TW K  K +   + + +       +L I  A +   G Y
Sbjct: 17920 VRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKY 17979

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              +  +N  G  Q    + V+D+P P       +++   + T+SW     +GGS + ++ +
Sbjct: 17980 IISAKNSSGHAQGSAIVNVLDRPGPCQNLK-VTNVTKENCTISWENPLDNGGSEITNFIV 18038

Query: 1300  EIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG--- 1356
             E      K W  +A+  +      +LL ++EY FRV A N  G   P+ E++   +    
Sbjct: 18039 EYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETKTPILAINP 18097

Query: 1357  -EKPEEPKD 1364
              ++P EP++
Sbjct: 18098 IDRPGEPEN 18106



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 66/229 (28%), Positives = 97/229 (42%), Gaps = 25/229 (10%)

Query: 1146  GTESDATVKKKP--APKTPPKAAMPPQIIQFPEDQKVRAGESVELFG---KVTGTQPITC 1200
             G +S+  V + P   P  PP    PP I+    D       SV L     K TG  PIT 
Sbjct: 20161 GLKSEPIVARHPFDVPDAPP----PPNIVDVRHD-------SVSLTWTDPKKTGGSPITG 20209

Query: 1201  TWMKF--RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
               ++F  R  +      K        K+T L    E+   + ++  N  G  +  +    
Sbjct: 20210 YHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYE--FRVMAINLAGVGKPSLPSEP 20267

Query: 1259  VDKPDP--PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--AT 1314
             V   DP  P G P   +I  +S+TL W    YDGG  +  Y +E  D  +K+W +     
Sbjct: 20268 VVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVN 20327

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEP 1362
                 +F V DL+   +Y+FR+RA N  G  S PS+ +E     ++ E P
Sbjct: 20328 VPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 20376



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 67/331 (20%), Positives = 125/331 (37%), Gaps = 69/331 (20%)

Query: 1028 APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVS 1087
            +P F ++ + + V +   ++L  +V+  PP  I W  +   L++ +      +  L S+ 
Sbjct: 4392 SPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQ 4451

Query: 1088 IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGT 1147
            I K +  D G Y+C   N+ G + CS +VT+ +                           
Sbjct: 4452 ILKFVAADAGEYQCRVTNEVGSSICSARVTLRE--------------------------- 4484

Query: 1148 ESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
                                PP  I+  E      G +      + G+ PIT TW+K   
Sbjct: 4485 --------------------PPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSD 4524

Query: 1208 QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP----- 1262
            +I E +++++    N + L +     +H G Y    +N  G ++    L+V +       
Sbjct: 4525 EITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEE 4584

Query: 1263 ----DPPAGTPCASDIRSS---SLTLSWY--GSSYDGGSAVQSYSIEIWDSANKTWKELA 1313
                D   G P    ++ S    +T  W+  G     GS    Y I + D+ +   K ++
Sbjct: 4585 AVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGS---KYKISVTDTVS-ILKIIS 4640

Query: 1314 TCRSTS----FNVQDLLPDHEYKFRVRAINV 1340
            T +  S    F VQ+ +     K R+  +++
Sbjct: 4641 TEKKDSGEYTFEVQNDVGRSSCKARINVLDL 4671



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 14/163 (8%)

Query: 1624 KWQKTGNAVRA-----IGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLE 1678
            KW K G  +       I    +++++  +S  K  +G  T        E + DV ++  +
Sbjct: 4611 KWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYT-------FEVQNDVGRSSCK 4663

Query: 1679 A-VAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQI 1737
            A +      + P F+K ++ ++ ++GS    +C + G     + WFKDDQ I  S  ++ 
Sbjct: 4664 ARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKF 4723

Query: 1738 DYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             +  D    L IS + G D   YTC A N  G   C+  L V+
Sbjct: 4724 SF-HDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVK 4765



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 53/230 (23%), Positives = 85/230 (36%), Gaps = 44/230 (19%)

Query: 1033 QKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKAL 1092
            +K + V V E   + L+C V+  P   + W  +GK +  +++  +S E ++ S  I+  +
Sbjct: 5145 EKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVM 5204

Query: 1093 PEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDAT 1152
             +D G Y    +ND G + C   + V D                   ++PP        T
Sbjct: 5205 KQDSGQYTFKVENDFGSSSCDAYLRVLD------------------QNIPP------SFT 5240

Query: 1153 VKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQES 1212
             K     K                      G S+ +  KV+G+ PI+  W K  K+I  S
Sbjct: 5241 KKLTKMDKV--------------------LGSSIHMECKVSGSLPISAQWFKDGKEISTS 5280

Query: 1213 EHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
               ++   E    L +     E    YT  V N  G       LTV + P
Sbjct: 5281 AKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPP 5330



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 5/118 (4%)

Query: 1233  QEHCGCY-TLLVENKLG---SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSY 1288
             QE C  Y  +  EN+ G     Q    + V + P PP G     D+  +S++LSW    +
Sbjct: 23098 QEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPP-GKITVDDVTRNSVSLSWTKPEH 23156

Query: 1289  DGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             DGGS +  Y +E+    ++ W E A  +S    + +L    EY FRV A+N  G S+P
Sbjct: 23157 DGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDP 23214



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 87/403 (21%), Positives = 150/403 (37%), Gaps = 89/403 (22%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+ +LV   HI+   L+V             PA+    +++ +KEG T     +    P 
Sbjct: 8725 GNYRLVCGPHIASAKLTVIE-----------PAWERHLQDVTLKEGQTCTMTCQF-SVPN 8772

Query: 62   PQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
             +  W RNG+ +   GR   +   +    L I  V  ED+G+YTC+  +     + + EL
Sbjct: 8773 VKSEWFRNGRILKPQGRHKTEVEHK-VHKLTIADVRAEDQGQYTCKYED----LETSAEL 8827

Query: 122  TVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFS 181
             +E                                   P +F  ++  +VV E Q   F 
Sbjct: 8828 RIEAE---------------------------------PIQFTKRIQNIVVSEHQSATFE 8854

Query: 182  CKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLV-VNGSG 240
            C+++      VTW KG   L  S + +         + IH V  DD GVY+ +  +   G
Sbjct: 8855 CEVS-FDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRG 8913

Query: 241  KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP 300
            +A  +AEL +                T  +++ E+      +S++       ++      
Sbjct: 8914 EARSTAELYL----------------TTKEIKLELKPPDIPDSRVPIPTMPIRA------ 8951

Query: 301  QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG 360
                 PP        PP    L + ++     P    ++ T  ++   A +V  +P+   
Sbjct: 8952 ----VPPEEIPPVVAPPIPLLLPTPEEK---KPPPKRIEVTKKAVKKDAKKVVAKPKE-- 9002

Query: 361  LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRI 403
               ++P  E  K+P PP     P + P +   DV SKA   +I
Sbjct: 9003 ---MTPREEIVKKPPPP-TTLIPAKAPEI--IDVSSKAEEVKI 9039



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 57/224 (25%), Positives = 89/224 (39%), Gaps = 19/224 (8%)

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFG-KVTG-----TQPITCTW 1202
             S+ TV + P  K P     P   +   +  +V+  E +   G +V G      +  +  W
Sbjct: 22329 SEPTVAQYPF-KVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILW 22387

Query: 1203  MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
             +K  K        K    E G +     + +   G         +G         V   P
Sbjct: 22388 VKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVG---------IGKPSKVSECYVARDP 22438

Query: 1263  DPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCR--STSF 1320
               P G P A  +  +S+TL W   +YDGGS +  Y +E  +     W + +      T F
Sbjct: 22439 CDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHF 22498

Query: 1321  NVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEPK 1363
              V  L+ DH Y+FRV A N  G  SEPS+ +   T  ++ + P+
Sbjct: 22499 EVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPR 22542



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 78/337 (23%), Positives = 129/337 (38%), Gaps = 55/337 (16%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G  + L+  +S  P  TI W  + K L+T   + +     L S+ I+ A   + G Y+  
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELK 26946

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
              +N  G A  + +V + D P              P   +     T    T+  +P P   
Sbjct: 26947 LRNAMGSASATIRVQILDKPGP------------PGGPIEFKTVTAEKITLLWRP-PADD 26993

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
               A +   I++  E  +V                     W         SEH++    E 
Sbjct: 26994 GGAKITHYIVEKRETSRV--------------------VWSMV------SEHLE----EC 27023

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGTPCASDIRSS 1277
                 T +    E+   + +   NK G  +   + +VV K     P PP G P  + I  +
Sbjct: 27024 IITTTKIIKGNEYI--FRVRAVNKYGIGEPLESDSVVAKNAFVTPGPP-GIPEVTKITKN 27080

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYKFRV 1335
             S+T+ W     DGGS +  Y +E  D  +  W ++   T R T   V  L  + +Y++RV
Sbjct: 27081 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRV 27140

Query: 1336  RAINVYGTSEPSQESELTTVGE--KPEEPKDEVEVSD 1370
              A+N  G    S+ SE     +   P  P  ++ ++D
Sbjct: 27141 CAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIAD 27177



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 33/95 (34%), Positives = 48/95 (50%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P   + I+   V +GS A F  ++ G PDPE  W+K+   I  S      + ED  C L+
Sbjct: 2078 PKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELV 2137

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
            I DV  +D A    KA+N  GE +  A L+V+  +
Sbjct: 2138 IRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ 2172



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE-------LAT 1314
             P  P   P   D   SS++L W   + DGGS ++ Y +E+ +     WK        + T
Sbjct: 15704 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITT 15763

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
             C     N+++L    +Y+FRV+A+N  G SEPS  +      +  EEP+  +++   D
Sbjct: 15764 CECVVPNLKEL---RKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQD 15818



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL----AT 1314
             + KP PP   P A D   +S+ L+W    +DGGS +  Y +E     ++ W+       +
Sbjct: 17110 IAKPSPPVN-PEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPES 17168

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPK 1363
             C  T + V  L     YKFRV A+N  G S+P+   E   V ++ E P+
Sbjct: 17169 CPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPE 17217



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 110/471 (23%), Positives = 168/471 (35%), Gaps = 95/471 (20%)

Query: 937   KAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPM--GNAKPDENLKSAS 994
             K V +S PLS   P   L+     K + TL           L P+  G AK D  + S  
Sbjct: 18788 KPVLASDPLSEPDPPRKLEVTEMTKNSATLA---------WLPPLRDGGAKIDGYITSYR 18838

Query: 995   KEELKKDVKNDVNCKRGHA----GTTDNEKRS---------------ESQGTAPAFKQKL 1035
             +EE   D   + +  +  +    G  + +K                 E++G   A +Q L
Sbjct: 18839 EEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLL 18898

Query: 1036  -------QDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
                    + + +  GKKL ++  V   P  T  W      + T+  + + +  S   + I
Sbjct: 18899 PPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILII 18958

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPP--VLG 1146
             +    +D G Y   A+N +G      +V V DAP                   PP  +  
Sbjct: 18959 KDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQ---------------PPFDISD 19003

Query: 1147  TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
              ++DA       P     + +   I+   E   V  G+ V     VT T        +  
Sbjct: 19004 IDADACSLSWHIPLEDGGSNITNYIV---EKCDVSRGDWVTALASVTKTS------CRVG 19054

Query: 1207  KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPA 1266
             K I   E++    +EN              G    L   K+    AQ    V  +P    
Sbjct: 19055 KLIPGQEYIFRVRAEN------------RFGISEPLTSPKM---VAQFPFGVPSEPKNAR 19099

Query: 1267  GTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCRSTS 1319
              T    D     + ++W     DGGS +  Y IE       +W  AN T       RST 
Sbjct: 19100 VTKVNKDC----IFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDT-----LVRSTE 19150

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSD 1370
             +    L+   EY FR+ A+N  G+S PS+ +E  T    P +P  + EV D
Sbjct: 19151 YPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVT-ARMPVDPPGKPEVID 19200



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 11/210 (5%)

Query: 45    KEGATAKFEGRVRGYPEP-QVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             +EG   K+  ++  Y +  QVTW+   + + +  ++ +     G   L +  + + D G 
Sbjct: 31580 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYE-DGVAILYVKDITKLDDGT 31638

Query: 104   YTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKF 163
             Y C+  N  G      EL V+G   +++      +T+  +      +T   +  E PP+F
Sbjct: 31639 YRCKVVNDYGEDSSYAELFVKG--VREVYDYYCRRTM--KKIKRRTDTMRLL--ERPPEF 31692

Query: 164   ATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQP---SARVSVSEKNGMQVLEI 220
                L       G+  RF   IT  P+P VTW K    ++P     + +     G+  L I
Sbjct: 31693 TLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTI 31752

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
             + V  DD   YT +  N  G+ S  A+L++
Sbjct: 31753 NSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 58/249 (23%), Positives = 97/249 (38%), Gaps = 12/249 (4%)

Query: 1017 DNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVS--SDPPATIIWTLNGKTLKTTKF 1074
            D EK+ +     P FK+KL  + +        +C+++   DP   + W  +GK L+    
Sbjct: 1696 DKEKQQK-----PFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANR 1750

Query: 1075 IILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKS 1134
            + +  E   CS+    A   D G+  C A N  G    S  + V D    E +   E + 
Sbjct: 1751 LRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKD----EKSLVEESQL 1806

Query: 1135 RRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTG 1194
               +  L  +   E  A         T  K    P I+ +PE  +V  GE+     +VTG
Sbjct: 1807 PEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTG 1866

Query: 1195 TQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQV 1254
                   W    + I++S+  +V   +    L I+  +    G   +  EN  G  + +V
Sbjct: 1867 YPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKV 1925

Query: 1255 NLTVVDKPD 1263
             L +  + D
Sbjct: 1926 KLEIQQRED 1934



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 58/246 (23%), Positives = 97/246 (39%), Gaps = 46/246 (18%)

Query: 29   LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
            L E P+FI    +     G TA F+  ++G     VTW ++   IT       D  IR T
Sbjct: 4482 LREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITE------DDNIRMT 4535

Query: 89   F-----SLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR 143
            F     SL +  +  +  GKY C+A N +G ++ +  L+V+                   
Sbjct: 4536 FENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVK------------------- 4576

Query: 144  FSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQP 203
               PA  T  ++              + V +G       K +G  +    W K    L  
Sbjct: 4577 --EPATITEEAV-------------SIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTL 4621

Query: 204  SARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRE 263
             ++  +S  + + +L+I    + D G YT  V N  G++S  A +++  L     SF ++
Sbjct: 4622 GSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDL-IIPPSFTKK 4680

Query: 264  TKATNS 269
             K  +S
Sbjct: 4681 LKKMDS 4686



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 51/225 (22%), Positives = 83/225 (36%), Gaps = 35/225 (15%)

Query: 27   MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
            + + E P FI   + + + + +  + E  V G P  +VTW +N + I S  ++ L   + 
Sbjct: 4949 LKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRV- 5007

Query: 87   GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSA 146
              F+L I      D G+Y C  +N  G+   +  + ++                      
Sbjct: 5008 SVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKE--------------------- 5046

Query: 147  PAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSAR 206
                         PP F  K+            F   + G P   +TWLK +  L     
Sbjct: 5047 -------------PPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDN 5093

Query: 207  VSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQ 251
            V +S  + +  L+I  V+    G YTC   N SG     A L +Q
Sbjct: 5094 VYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQ 5138



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 57/244 (23%), Positives = 86/244 (35%), Gaps = 35/244 (14%)

Query: 24   VDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDC 83
            V ++ L E P F+    +L +  G  A+ +  + G     V W +  + +      +   
Sbjct: 5601 VCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRIT 5660

Query: 84   GIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR 143
             +    +L        + GKY C+  N  G R+    L V                    
Sbjct: 5661 FVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMV-------------------- 5700

Query: 144  FSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQP 203
               PAV                K G + V  G+     CK+ G P+  V W K    L  
Sbjct: 5701 -LEPAV-------------IVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTS 5746

Query: 204  SARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRE 263
            S +   S  N +  L I  V + D G YT  V N  GK+S +A + +    +   SF R 
Sbjct: 5747 SQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSD-RAVPPSFTRR 5805

Query: 264  TKAT 267
             K T
Sbjct: 5806 LKNT 5809



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 40/111 (36%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 1261  KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---CRS 1317
             KP PP   P   DI  SS+ LSW    YDGG  +Q Y +E  D +   W           
Sbjct: 22837 KPGPP-NNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINK 22895

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEV 1368
             T+  V+ LL  HEY FR+ AIN  G  E +       V EK E P  ++++
Sbjct: 22896 TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDL 22946



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 53/248 (21%), Positives = 95/248 (38%), Gaps = 47/248 (18%)

Query: 1030 AFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIE 1089
            AF ++L D  V  GK ++L+   +   P ++ W  +G  + T++   +      C + I 
Sbjct: 5987 AFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEIL 6046

Query: 1090 KALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTES 1149
             +   D G Y C  +N+AG+  C   V+  +                     PP   TE 
Sbjct: 6047 NSTKRDAGQYSCEIENEAGRDVCGALVSTLE---------------------PPYFVTEL 6085

Query: 1150 DATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQI 1209
            +           P +AA+               G+SV L  +V GT  IT +W K   ++
Sbjct: 6086 E-----------PLEAAV---------------GDSVSLQCQVAGTPEITVSWYKGDTKL 6119

Query: 1210 QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTP 1269
            + +   +   + N + L          G YT   EN +G+  ++    + ++  PP+   
Sbjct: 6120 RPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFAR 6179

Query: 1270 CASDIRSS 1277
               DI  +
Sbjct: 6180 QLKDIEQT 6187



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 61/234 (26%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

Query: 444   APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGVAELH 500
             AP     +KD     G+   L C + G P+P I W   G+ +  +R    + +     L 
Sbjct: 30532 APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLT 30591

Query: 501   IQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPS-KPTAPIFLQG 559
             +     ED G YTC+A N +G+V  S             S+ LL   P   P  P+  + 
Sbjct: 30592 VMTEEQEDEGVYTCIATNEVGEVETS-------------SKLLLQATPQFHPGYPLKEKY 30638

Query: 560   LSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPE 619
                +    GS + + V   G P P + W H    +Q SE+   E       L ++ V  +
Sbjct: 30639 YGAV----GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRK 30694

Query: 620   -DTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLIS 672
                G Y  +  N  G V   A+L V+      +P   + P  + A L  S +IS
Sbjct: 30695 THAGKYKVQLSNVFGTV--DAILDVEIQDKPDKP---TGPIVIEALLKNSAVIS 30743



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 14/152 (9%)

Query: 160  PPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
            PP   + L  V V EG+     C I+G P P VTW + +  ++ S    ++ ++G+  L 
Sbjct: 942  PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM 1001

Query: 220  IHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVI 279
            I     +D G +TC  VN +G  S S  L++Q     +  F +ET A        VT   
Sbjct: 1002 IREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ----VSEEFEKETTA--------VTEKF 1049

Query: 280  SKESK--LDSLEAAAKSKNCSSPQRGGSPPWA 309
            + E K  ++S +      + +  Q G   P A
Sbjct: 1050 TTEEKRFVESRDVVMTDTSLTEEQAGPGEPAA 1081



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

Query: 1206  RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG-----SRQAQVNLTVVD 1260
             +++      + V +       TI    + H   + ++ +NK G       + +    +  
Sbjct: 16256 KREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFS 16315

Query: 1261  KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL------AT 1314
              P  P   P  S +  +S+T++W    YDGGS V  Y +E+ D+ +K WK +      A 
Sbjct: 16316 VPGAP-DKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAM 16374

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                 S+ V  L+   +Y+FRV AIN  G    S  S+  T  +    P
Sbjct: 16375 TLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPP 16422



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 77/340 (22%), Positives = 133/340 (39%), Gaps = 57/340 (16%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             + V  G+ + +  +V   P   I WT  GK L   K + L Q+     + I++A+  D G
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 17977

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKP 1157
              Y   AKN +G A+ S  V V D P              P  +L     T+ + T+    
Sbjct: 17978 KYIISAKNSSGHAQGSAIVNVLDRPG-------------PCQNLKVTNVTKENCTIS--- 18021

Query: 1158  APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKV 1217
                            + P D                G   IT   +++RK  Q+   +  
Sbjct: 18022 --------------WENPLD---------------NGGSEITNFIVEYRKPNQKGWSIVA 18052

Query: 1218  ENSENGSKLTILAARQEHCGCYTLLVENKLG------SRQAQVNLTVVDKPDPPAGTPCA 1271
              +         L A  E+   + +  ENK+G      ++   + +  +D+P  P     A
Sbjct: 18053 SDVTKRLIKANLLANNEY--YFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIA 18110

Query: 1272  SDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDH 1329
              D   + + L W    YDGGS   SY +E     +  W+ +   + + T + V   + + 
Sbjct: 18111 -DKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQ 18169

Query: 1330  EYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
              Y+FRV+  N  G S+  +  E+  V E  ++P  ++++S
Sbjct: 18170 IYEFRVQTKNEGGESDWVKTEEV-VVKEDLQKPVLDLKLS 18208



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 25/182 (13%)

Query: 1015 TTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKF 1074
            T+  E   +++   P F Q+LQ + V +G ++ LQ +V+  P   + +  +G  ++++  
Sbjct: 90   TSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD 149

Query: 1075 IILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV---DDAPASE------ 1125
              +SQEG L S+ I +A PED G Y   A N  G+A  + ++ V   ++ PA +      
Sbjct: 150  FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVS 209

Query: 1126 NTKAPEMKSRRPKSSLPPVLGTESDATVK------------KKPAPKTPPK----AAMPP 1169
              +  E +  R +  +       S ATV+             K  P+ PPK    +  PP
Sbjct: 210  TAQISESRQTRIEKKIEAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPP 269

Query: 1170 QI 1171
             I
Sbjct: 270  SI 271



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 35/96 (36%), Positives = 46/96 (47%)

Query: 1688 KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSL 1747
            KP F       + +EG  ARFD K+ G P PE  WF D Q I      ++   EDG  SL
Sbjct: 1456 KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSL 1515

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
            II      D  ++T  A N  G ++ +  L VE +E
Sbjct: 1516 IIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVE 1551



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 91/433 (21%), Positives = 165/433 (38%), Gaps = 47/433 (10%)

Query: 314   PQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKR 373
             P+P  E ++ +     R  P+   + +   +I L A   +P+P A    +  P  E    
Sbjct: 10983 PKPVEEVEVPTVTKRERKIPEPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPT 11042

Query: 374   PAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFES-----KPQSQEVKEN 428
             P    P T P       ++    +AA  + P++G         E+     +P S   K  
Sbjct: 11043 PIAA-PVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPSPIEAERRKLRPGSGGEKPP 11101

Query: 429   QTVKFRCEGLAVMEVAPSFSSVLKDCAVIE----GQDFVLQCSVRGTPVPRIT-WLLNGQ 483
                 F  +   +  V   F   +KD  + E    G   + +C V  +P   IT W+ +G 
Sbjct: 11102 DEAPFTYQ---LKAVPLKFVKEIKDIILTESEFVGSSAIFECLV--SPSTAITTWMKDGS 11156

Query: 484   PIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKS 540
              I+ +   R   +    +LHI D    D G YTC+      + + +A + V E       
Sbjct: 11157 NIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEE------- 11209

Query: 541   EYLLPVAPSKPTAPIFLQGL-SDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED 599
                LPV         F++ L  ++ V+ G  + ++ ++  N   +V+W  +G  + E   
Sbjct: 11210 ---LPVR--------FVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGKIVVEKPG 11256

Query: 600   FHFE-QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKP 658
                    G   +L I +    D GTYT    N+     +  V  V+   D    W +   
Sbjct: 11257 RIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRD----WLVKPI 11312

Query: 659   RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL-CKDTGHFEVLQNEDVFTLVLKKVQP 717
             R        + + +C IA D  P + W +    +  +     E+L++ +   L +K   P
Sbjct: 11313 RDQHVKPKGTAIFACDIAKDT-PNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMP 11371

Query: 718   WHAGQYEILLKNR 730
                 +Y + ++ +
Sbjct: 11372 EDIAEYAVEIEGK 11384



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 44/140 (31%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

Query: 1239  YTLLVENKLGSRQAQVN---LTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQ 1295
             + ++ EN  G  +       +  +D  DPP G P   +I   ++TL W    Y GG  + 
Sbjct: 21331 FRVIAENMAGKSKPSKPSEPMLALDPIDPP-GKPVPLNITRHTVTLKWAKPEYTGGFKIT 21389

Query: 1296  SYSIEIWDSANKTW--KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQESEL 1352
             SY +E  D  N  W     +      F V  L  D  Y+FRV A N  G  S PS+ S+ 
Sbjct: 21390 SYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDA 21449

Query: 1353  TTVGEKPEEPKDEVEVSDDD 1372
              T  +  E PK +V+V   D
Sbjct: 21450 ITCRDDVEAPKIKVDVKFKD 21469



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 91/388 (23%), Positives = 134/388 (34%), Gaps = 60/388 (15%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             PAFK       V  G+ L +       P   + W  +   LK T  +      +   ++I
Sbjct: 22148 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTI 22207

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             + A  ED G Y     N AG+A  +  V V D P                   PP    +
Sbjct: 22208 KDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPG------------------PPTGPVK 22249

Query: 1149  SD-ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
              D  T         PP               K   G S+  +  V      T TW     
Sbjct: 22250 MDEVTADSITLSWGPP---------------KYDGGSSINNY-IVEKRDTSTTTWQIV-- 22291

Query: 1208  QIQESEHMKVENSENGSKLTILAARQEHCGC---YTLLVENKLG-SRQAQVNLTVVDKP- 1262
                         S   ++ TI A R +  GC   + +  EN+ G S       TV   P 
Sbjct: 22292 ------------SATVARTTIKACRLK-TGCEYQFRIAAENRYGKSTYLNSEPTVAQYPF 22338

Query: 1263  --DPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRST 1318
                 P GTP  +     S+ + W     DGGS V  Y +E  +  +  W +L       T
Sbjct: 22339 KVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQT 22398

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEV 1378
              F    L    EY+FRV A N+ G  +PS+ SE   V   P +P    E          +
Sbjct: 22399 KFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSE-CYVARDPCDPPGRPEAIIVTRNSVTL 22457

Query: 1379  DYRTVTINTEQKVSDFYDIEERLGSGKF 1406
              ++  T +   K++ +   ++ L  G++
Sbjct: 22458 QWKKPTYDGGSKITGYIVEKKELPEGRW 22485



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 82/331 (24%), Positives = 122/331 (36%), Gaps = 60/331 (18%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P +K  +  VH  E  K+     +   P  TI W    + L  T  + +       S+S+
Sbjct: 22547 PKYKDTIV-VHAGESFKV--DADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSV 22603

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             + A+  D G Y   AKN AG+   +  V V D P       PE          P V+   
Sbjct: 22604 KDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGP-----PEG---------PVVI--- 22646

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVT--GTQPITCTWMKFR 1206
             S  T +K      PP       II +  +++    E+  L   V     Q ++C      
Sbjct: 22647 SGVTAEKCTLAWKPPLQDGGSDIINYIVERR----ETSRLVWTVVDANVQTLSC------ 22696

Query: 1207  KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK----- 1261
                      KV     G++ T           + ++  NK G  +   +  VV K     
Sbjct: 22697 ---------KVTKLLEGNEYT-----------FRIMAVNKYGVGEPLESEPVVAKNPFVV 22736

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTS 1319
             PD P   P  + +   S+ + W   + DGGS +  Y +E  D     W            
Sbjct: 22737 PDAPKA-PEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELR 22795

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
               V  L+ +H+Y+FRV A N  G SEPS  S
Sbjct: 22796 LRVTGLIENHDYEFRVSAENAAGLSEPSPPS 22826



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 45/169 (26%), Positives = 67/169 (39%), Gaps = 12/169 (7%)

Query: 1202  WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
             W+K  K   +    K    + G +     + +   G         +G         V   
Sbjct: 24551 WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVG---------IGKPSKVSECFVARD 24601

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCRSTS 1319
             P  P G P A  I  +++TL W   +YDGGS +  Y +E  D  +  W +        T 
Sbjct: 24602 PCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETE 24661

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEPKDEVE 1367
             F V  L+ D  Y+FRV A N  G  SEPS  S   T  ++ + P   ++
Sbjct: 24662 FTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLD 24710



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 9/134 (6%)

Query: 1252  AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
             AQ+  TV D P    G P  S+I  +S+TL+W     DGGS +Q Y +E  +  +  W +
Sbjct: 28145 AQIQYTVPDAP----GIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVK 28200

Query: 1312  LATCR---STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGE--KPEEPKDEV 1366
             + + R    T F V  L   +EY+F V A N  G    S  S L    E   P  P   V
Sbjct: 28201 VISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVV 28260

Query: 1367  EVSDDDEKEPEVDY 1380
             +V+D  +    +++
Sbjct: 28261 KVTDTSKTTVSLEW 28274



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 27/81 (33%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 1700 VVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAK 1759
            ++ G +AR  CK++G P  +V WFK+++ + ES   ++ Y  +    L I+DV  +D   
Sbjct: 3749 MLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRM-YFVNSEAILDITDVKVEDSGS 3807

Query: 1760 YTCKAVNSLGEATCTAELIVE 1780
            Y+C+AVN +G  +C+ E++++
Sbjct: 3808 YSCEAVNDVGSDSCSTEIVIK 3828



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 49/235 (20%), Positives = 90/235 (38%), Gaps = 48/235 (20%)

Query: 1029 PAFKQKLQDVHVAE-GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVS 1087
            P F +KL+   + + G    L+C+++  P   ++W  N   L  +    ++   S+  + 
Sbjct: 5423 PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQ 5482

Query: 1088 IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGT 1147
            +     ED G + C A+N AG   CS +V V + P                SS PP++ T
Sbjct: 5483 MNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVF--------------SSFPPIVET 5528

Query: 1148 ESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
              +A                                  V L  +++GT P    W K ++
Sbjct: 5529 LKNA---------------------------------EVSLECELSGTPPFEVVWYKDKR 5555

Query: 1208 QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            Q++ S+  K+ +    + + IL       G Y    +N++GS      + + + P
Sbjct: 5556 QLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPP 5610



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC------ 1315
             P  P   P  +D   SS++L+W    YDGG+ V+ Y +E+ ++A   W    TC      
Sbjct: 25002 PPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW---TTCTPPTGL 25058

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVE 1367
             +   F V  L  + EY FR+ AIN  G  EP+         E+ E P+ E++
Sbjct: 25059 QGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELD 25110



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 72/342 (21%), Positives = 133/342 (38%), Gaps = 65/342 (19%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             +HV  G+ + L   ++  PP    W   G  L+ ++ + +     +  ++I +    D G
Sbjct: 29748 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTG 29807

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDAT---VK 1154
              Y    KN  G    + +V + D P                    P+   E DAT   + 
Sbjct: 29808 EYTLELKNVTGTTSETIKVIILDKPGPPTG---------------PIKIDEIDATSITIS 29852

Query: 1155  KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEH 1214
              +P P+    A +   +++  +  +          G +  ++ +T +  KF +  + +E+
Sbjct: 29853 WEP-PELDGGAPLSGYVVEQRDAHRP---------GWLPVSESVTRSTFKFTRLTEGNEY 29902

Query: 1215  MKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDI 1274
             +            + A  +   G Y   +++++   ++ + +     P PP  T    D+
Sbjct: 29903 V----------FRVAATNRFGIGSY---LQSEVIECRSSIRI-----PGPPE-TLQIFDV 29943

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCRSTSFNVQDLLP 1327
                 +TL+WY    DGGS V  Y +E        W   NK    +   RST      L  
Sbjct: 29944 SRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTG-----LTE 29998

Query: 1328  DHEYKFRVRAINVYGTSEPSQESELTTVGE------KPEEPK 1363
               EY+ RV AIN  G+ +PS+ S+     +      KP+ P+
Sbjct: 29999 GLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPR 30040



 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 2/112 (1%)

Query: 1682 EEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDE 1741
            +E P   P     ++D    EG  ARF C++ G  D +V W+  D+ I+ SR F++   E
Sbjct: 3338 QEMPVYPPAIITPLQDTVTSEGQPARFQCRVSG-TDLKVSWYSKDKKIKPSRFFRMTQFE 3396

Query: 1742 DGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEE 1793
            D    L I++   +D+  YT  A N++G+ + TA L +E  E    E  E+E
Sbjct: 3397 D-TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQE 3447



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 60/238 (25%), Positives = 90/238 (37%), Gaps = 41/238 (17%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F Q L  V V+EG+ + L C V    P  I W   G+ +K +     S       + +
Sbjct: 8346 PVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLEL 8405

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                  D G Y C A N AG               S+ TK                    
Sbjct: 8406 RDVAKADSGDYVCKASNVAG---------------SDTTK-------------------- 8430

Query: 1149 SDATVKKKPA--PKTPPKAAMPPQIIQFPEDQKVRAGE--SVELFGKVTGTQPITCTWMK 1204
            S  T+K KPA  P T  KAA+  ++    E Q +R  E  +     KV G       W K
Sbjct: 8431 SKVTIKDKPAVAPATK-KAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTK 8489

Query: 1205 FR-KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
             + +Q+ +   + +    + +KL I    +   G Y  +  N+ G  ++ VNL V ++
Sbjct: 8490 GKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDER 8547



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATCRST 1318
             P PPA  P   D   SS++LSW   +YDGGS +  Y +E+  + +  W         + T
Sbjct: 19589 PGPPA-FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 19647

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
              F V  L+ D +Y+FRV A+N  G S+PS
Sbjct: 19648 RFEVTGLMEDTQYQFRVYAVNKIGYSDPS 19676



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

Query: 1256  LTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC 1315
             +   ++P PP       D   SS  L+W    +DGGS +  Y +E+    +  W E    
Sbjct: 28540 IVATEQPAPPRRLDVV-DTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT 28598

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
             +  +F V+ L+   EY+FRV+A N  G SEP +      + E   EP
Sbjct: 28599 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEP 28645



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 28    PLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRG 87
             P++  P  +   ++  +   + AKF  +  G P P   W ++G+ IT GG++ L    +G
Sbjct: 32847 PISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLS-EDKG 32905

Query: 88    TFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVE 124
              F L IH     D G YTC   N +G+   + +LT++
Sbjct: 32906 GFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIK 32942



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATC 1315
             V KP PP G P   D   SS++++W    YDGGS +  Y +EI       W+ +   A  
Sbjct: 21753 VFKPGPP-GNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGL 21811

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             ++TS+ +  L  + EYK R+ A+N  G  EP+
Sbjct: 21812 KATSYTITGLTENQEYKIRIYAMNSEGLGEPA 21843



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 48/176 (27%), Positives = 72/176 (40%), Gaps = 16/176 (9%)

Query: 1202  WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
             W K  K +     MKV   + G               Y +  EN  G  +   +   V  
Sbjct: 25633 WSKANKILIADTQMKVSGLDEGLMYE-----------YRVYAENIAGIGKCSKSCEPVPA 25681

Query: 1262  PDP--PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCRS 1317
              DP  P G P  ++I   S++L W    YDGG+ +  Y +E  +  +  W +      + 
Sbjct: 25682 RDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQE 25741

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVY-GTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
             T F V +L  D  Y+FRV A N     SEPS+ +    V +  E P+  ++V   D
Sbjct: 25742 TYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRD 25797



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/318 (23%), Positives = 124/318 (38%), Gaps = 51/318 (16%)

Query: 430  TVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYAR 489
            T K   EG  V      F   L+D  V E     L+C V    +    W  N   ++   
Sbjct: 2257 TAKLIVEGAVV-----EFVKELQDIEVPESYSGELECIVSPENIEG-KWYHNDVELKSNG 2310

Query: 490  S---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPV 546
                T   G   L ++D   ED G Y+ + +                KK++ K +     
Sbjct: 2311 KYTITSRRGRQNLTVKDVTKEDQGEYSFVIDG---------------KKTTCKLKM---- 2351

Query: 547  APSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRG 606
               KP     LQGLSD KV +G  V + V+VS     E +W+ +G E+Q S+  H     
Sbjct: 2352 ---KPRPIAILQGLSDQKVCEGDIVQLEVKVSLESV-EGVWMKDGQEVQPSDRVHIVIDK 2407

Query: 607  TQHSLCIQEVFPEDTGTYT----CEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVT 662
              H L I+++  ED G Y+        +++G V   +V              I+  + V 
Sbjct: 2408 QSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV------------ITPLKDVN 2455

Query: 663  ASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQ 722
               G   ++ C ++     +V W  + + + K     + +       LV+ +      G 
Sbjct: 2456 VIEGTKAVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGP 2514

Query: 723  YEILLKNRVGECSCQVSL 740
            Y++++  RV E +C +S+
Sbjct: 2515 YKLIV-GRV-ETNCNLSV 2530



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 52/241 (21%), Positives = 87/241 (36%), Gaps = 54/241 (22%)

Query: 1015 TTDNEKRSESQGTA------PAFKQKLQDVHVA-EGKKLLLQCQVSSDPPATIIWTLNGK 1067
            T  NE  S S          P+F +K+   ++   G+   L C++   P   + W  N K
Sbjct: 3717 TASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNK 3776

Query: 1068 TLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENT 1127
             L  +  + +    S   + I     ED G Y C A ND G   CS ++ + +       
Sbjct: 3777 ELSESNTVRMYFVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKE------- 3829

Query: 1128 KAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVE 1187
                                                    PP  I+  E   +  G +  
Sbjct: 3830 ----------------------------------------PPSFIKTLEPADIVRGTNAL 3849

Query: 1188 LFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKL 1247
            L  +V+GT P   +W K +KQI+ S+  ++ + ++   L I +      G Y  +V N++
Sbjct: 3850 LQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEV 3909

Query: 1248 G 1248
            G
Sbjct: 3910 G 3910



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 73/351 (20%), Positives = 128/351 (36%), Gaps = 64/351 (18%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P+F +K++      G     Q  +    P T+ W  +   +     I ++ E ++ S+ +
Sbjct: 4486 PSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYL 4545

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDA----------------PASENTK---A 1129
                 +  G Y C AKNDAG   CS  ++V +                 PA+   K    
Sbjct: 4546 SGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGT 4605

Query: 1130 PEMKSRRPKSSLPPVLGTESDATV------------KKKPAP-----------KTPPKAA 1166
             E+ ++  K      LG++   +V            +KK +            ++  KA 
Sbjct: 4606 KEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKAR 4665

Query: 1167 M-------PPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVEN 1219
            +       PP   +  +      G  ++L   V G+ PI+  W K  ++I  SE  K   
Sbjct: 4666 INVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSF 4725

Query: 1220 SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP---DPPAGTPCASDIR- 1275
             +N + L I        G YT    NK G  Q   +LTV + P   + P       + R 
Sbjct: 4726 HDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRV 4785

Query: 1276 --------SSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRST 1318
                    ++ +T+ W+  + +  S     +  +W     T  EL   ++T
Sbjct: 4786 QLKALVGGTAPMTIKWFKDNKELHSGA---ARSVWKDDTSTSLELFAAKAT 4833



 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 28/92 (30%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            PYF K +  ++V  G +A   C++ G P+  V W+K D  +R +  +++ +  +   +L+
Sbjct: 7961 PYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHF-RNNVATLV 8019

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             + V  +D  +Y CKA NS+GE + +  L V+
Sbjct: 8020 FNQVDINDSGEYICKAENSVGEVSASTFLTVQ 8051



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 42/128 (32%), Positives = 59/128 (46%), Gaps = 2/128 (1%)

Query: 1652 SSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCK 1711
            ++ G  +S  N   LE+ E +    +E   E +    P   + I  LEV  G  A+F C+
Sbjct: 3420 NAVGQVSSTANLS-LEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCE 3478

Query: 1712 IEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEA 1771
            I+  P+    WFK  + I ES    I   +  + SL I      D  +YTCKA N  G  
Sbjct: 3479 IQSAPNVRFQWFKAGREIYESDKCSIRSSKYIS-SLEILRTQVVDCGEYTCKASNEYGSV 3537

Query: 1772 TCTAELIV 1779
            +CTA L V
Sbjct: 3538 SCTATLTV 3545



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 51/237 (21%), Positives = 86/237 (36%), Gaps = 44/237 (18%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F  +L+ +  A G  + LQCQV+  P  T+ W      L+ T         ++ ++  
Sbjct: 6079 PYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVF 6138

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             K    D G Y C A+N                                       +GT 
Sbjct: 6139 NKVNINDSGEYTCKAENS--------------------------------------IGTA 6160

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
            S  TV +        +  +PP   +  +D +   G  V L  ++ G+ PI   W +    
Sbjct: 6161 SSKTVFR------IQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVL 6214

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP 1265
            +++ E+++    +N + L IL     H G Y+    N LG+  +   LT  +    P
Sbjct: 6215 LRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSP 6271



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 41/157 (26%), Positives = 68/157 (43%), Gaps = 4/157 (2%)

Query: 1624 KWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEE 1683
            KW K G  + +  +   ++  + +SG K    +P S       E +  V +    A  + 
Sbjct: 7618 KWFKDGKELTSDNKYK-ISFFNKVSGLKIINVAP-SDSGVYSFEVQNPVGKDSCTASLQV 7675

Query: 1684 KPH-VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
                V P F++ +++   + GS+   +CK+ G P   V WF +   I   R +Q     D
Sbjct: 7676 SDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTL-TD 7734

Query: 1743 GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              C+L ++ +   D   YTC A N  G   C+A L V
Sbjct: 7735 NTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTV 7771



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 71/338 (21%), Positives = 128/338 (37%), Gaps = 62/338 (18%)

Query: 1062  WTLNGKTLKTTKFIILS-QEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDD 1120
             W     T+K TK  +    EGSL              +++  A+N  GQ++ +    ++D
Sbjct: 14130 WQTVDTTVKDTKCTVTPLTEGSLY-------------VFRVAAENAIGQSDYT---EIED 14173

Query: 1121  APASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKV 1180
             +  +++T           +  PP      D T +       PPK      I ++  ++K 
Sbjct: 14174 SVLAKDTFT---------TPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKE 14224

Query: 1181  RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYT 1240
             R G                  W+K  K      + +V +   G+++      +   G   
Sbjct: 14225 RLGTR----------------WVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAG--- 14265

Query: 1241  LLVENKLGSRQAQVNLTVVDKPDPPAGTPC---ASDIRSSSLTLSWYGSSYDGGSAVQSY 1297
                   +G       +  ++ P  P   P     +D     + ++W     +GGS +  Y
Sbjct: 14266 ------VGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGY 14319

Query: 1298  SIEIWDSANKTWKELAT--CRSTSFNVQD-LLPDHEYKFRVRAINVYGTSEPSQESELTT 1354
              +E+     + W  + +   +   F V++ ++PD EY  RVRA+N  G SEPS+ SE   
Sbjct: 14320 HVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVV 14379

Query: 1355  VGEKPEEPKDEVEVSDDDEKEPE-----VDYRTVTINT 1387
               +   +P  ++E  D    E E     V +R V + T
Sbjct: 14380 AKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPT 14417



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 75/315 (23%), Positives = 112/315 (35%), Gaps = 53/315 (16%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             V  G+   L+  V   P  TI W    K ++ +    +        + ++ A+  D G Y
Sbjct: 23637 VNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQY 23696

Query: 1100  KCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAP 1159
                A N AG       V V D P              P      V G  S+    K    
Sbjct: 23697 ILRASNVAGSKSFPVNVKVLDRPG-------------PPEGPVQVTGVTSE----KCSLT 23739

Query: 1160  KTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVEN 1219
              +PP       I  +  +++    E+  L   V  ++ +T                    
Sbjct: 23740 WSPPLQDGGSDISHYVVEKR----ETSRLAWTVVASEVVT-------------------- 23775

Query: 1220  SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGTPCASDI 1274
               N  K+T L    E+   + ++  NK G  +   +  V+ K     P PP      ++I
Sbjct: 23776 --NSLKVTKLLEGNEYV--FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLE-VTNI 23830

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFN--VQDLLPDHEYK 1332
                S+T+ W     DGGS +  Y +E  D +   W +    R T     V  L  DHEY+
Sbjct: 23831 AKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYE 23890

Query: 1333  FRVRAINVYGTSEPS 1347
             FRV A N  G  EPS
Sbjct: 23891 FRVSAENAAGVGEPS 23905



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 60/273 (21%), Positives = 100/273 (36%), Gaps = 48/273 (17%)

Query: 992  SASKEELKKDVKNDVN--CKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQ 1049
            +AS E ++ D+ +  N  C+  ++  + +   +      P+F  K     V  G  + L+
Sbjct: 4167 TASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSFVTKPGSKDVLPGSAVCLK 4226

Query: 1050 CQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQ 1109
                   P TI W    K L +     +++E    S+ +      D G Y C   N AG 
Sbjct: 4227 STFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGG 4286

Query: 1110 AECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPP 1169
             ECS  + V                             +  AT  +K  P          
Sbjct: 4287 VECSANLFV-----------------------------KEPATFVEKLEP---------- 4307

Query: 1170 QIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTIL 1229
                    Q ++ G++ +L  KVTGT PI  TW    ++I+ES   ++   E+ + L + 
Sbjct: 4308 -------SQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLT 4360

Query: 1230 AARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
                E  G Y    +N+ GS      + V + P
Sbjct: 4361 DVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESP 4393



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 63/295 (21%), Positives = 120/295 (40%), Gaps = 37/295 (12%)

Query: 438   LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARST---CEA 494
             L V+E  P F+  L+D   +E  + +LQC +     P + W  +G+ I+ +++     + 
Sbjct: 12011 LTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADG 12069

Query: 495   GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAP 554
                 L ++ AL  D G YTC      G    S  + + +++                   
Sbjct: 12070 KKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDREIK----------------- 12108

Query: 555   IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQ 614
               ++ L  ++VM+        ++S +      W   G  + ++ D   ++ G  HSL + 
Sbjct: 12109 -LVRPLHSVEVMETETARFETEISEDDI-HANWKLKGEALLQTPDCEIKEEGKIHSLVLH 12166

Query: 615   EVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCA 674
                 + TG    +A N    V++ A L V+    G     +   + VT + G++    C 
Sbjct: 12167 NCRLDQTGGVDFQAAN----VKSSAHLRVKPRVIG----LLRPLKDVTVTAGETATFDCE 12218

Query: 675   IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKN 729
             ++ +  P V W   GK L + +          V TL L+ V+   AG+ ++  K+
Sbjct: 12219 LSYEDIP-VEWYLKGKKL-EPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 12271



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 72/338 (21%), Positives = 118/338 (34%), Gaps = 53/338 (15%)

Query: 1021  RSESQGTAPAFKQKLQDVHVAE-GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFII-LS 1078
             R E      +   K +DV V   G+  +L+  +   P   ++W+ +GK L+ T   + + 
Sbjct: 24699 RDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIK 24758

Query: 1079  QEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPK 1138
                   ++ ++  +  D G Y     N  G       V V D P              P 
Sbjct: 24759 STIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPG-------------PP 24805

Query: 1139  SSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPI 1198
                  V G  ++        P     A +   II+  E  ++                  
Sbjct: 24806 EGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL------------------ 24847

Query: 1199  TCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
               +W +   ++Q   +          K+T L    E+   + ++  NK G  +   +  V
Sbjct: 24848 --SWTQVSTEVQALNY----------KVTKLLPGNEYI--FRVMAVNKYGIGEPLESGPV 24893

Query: 1259  VD----KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-- 1312
                   KP  P  TP  S I   S+ ++W     DGG+ ++ Y +E  D     W +   
Sbjct: 24894 TACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNK 24953

Query: 1313  ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
              T       V  L   H Y+FRV A N  G  EPS+ S
Sbjct: 24954 KTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 24991



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 56/243 (23%), Positives = 88/243 (36%), Gaps = 34/243 (13%)

Query: 31    EAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS 90
             EAP      +++  K G  A+   ++ G P P + W+R G+ +    ++ +    R T +
Sbjct: 30531 EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGR-THT 30589

Query: 91    LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVE 150
             L +    +ED G YTC ATN  G  + + +L ++ +     G P+  K  G         
Sbjct: 30590 LTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYG--------- 30640

Query: 151   TRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVS 210
                                     G   R      GRP P +TW  G   LQ S  +++ 
Sbjct: 30641 ----------------------AVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIE 30678

Query: 211   EKNGMQVLEIHGV-NQDDVGVYTCLVVNGSGKASMSAELSIQGL-DSANRSFVRETKATN 268
                    L +  V  +   G Y   + N  G      ++ IQ   D      V E    N
Sbjct: 30679 NTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKN 30738

Query: 269   SDV 271
             S V
Sbjct: 30739 SAV 30741



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

Query: 1260  DKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CRS 1317
             +KP  P G P  + +   S  ++W   + DGG+ +++Y +E  +     W  + T   R 
Sbjct: 30823 EKPGAP-GKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 30881

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKE 1375
             T F+V++L+   EY+FRV+  N+ G SE S+ SE       P  PK +V +     KE
Sbjct: 30882 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISE-------PITPKSDVPIQAPHFKE 30932



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 49/175 (28%), Positives = 74/175 (42%), Gaps = 22/175 (12%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEG-SLCSVS 1087
             P FK+ L +    EG+ +  + +VS  PP T+ W  +G+ L     I +  EG    ++ 
Sbjct: 31795 PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 31854

Query: 1088  IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAP-ASENTKAPEMKSRRPKSSLPPVL- 1145
             I   LPED G Y+  A N AG   C   + V+      +  K+ E   R  +  +   L 
Sbjct: 31855 IRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQIDKTLR 31914

Query: 1146  ------GTES------------DATVKKKPAPKTPP-KAAMPPQIIQFPEDQKVR 1181
                   GTES            +A V  KPA  T   K     +I +  E++K+R
Sbjct: 31915 MAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKGEFRLEIEEKKEERKLR 31969



 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 42/230 (18%), Positives = 82/230 (35%), Gaps = 47/230 (20%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P+F ++L++     G   +L+C+V+   P ++ W      + +      +   ++C++ +
Sbjct: 5800 PSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQL 5859

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                  D G Y CVA N AG  EC   +TV + P+                         
Sbjct: 5860 NSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPS------------------------- 5894

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                                   ++ PE  +V  G++V     + GT P    W +  ++
Sbjct: 5895 ----------------------FVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARE 5932

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
            + + +   +   +  ++L +        G YT +V N  G       L V
Sbjct: 5933 LVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFV 5982



 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 55/284 (19%), Positives = 97/284 (34%), Gaps = 65/284 (22%)

Query: 988  ENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLL 1047
            +N+ +     L      +  C   +   +D  +   +    P+F ++ + + V  GK + 
Sbjct: 5852 DNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNVT 5911

Query: 1048 LQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPE---------DRGL 1098
                +   PP  + W    + L          +G  C++  E  + E           G 
Sbjct: 5912 FTSVIRGTPPFKVNWFRGARELV---------KGDRCNIYFEDTVAELELFNIDISQSGE 5962

Query: 1099 YKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPA 1158
            Y CV  N+AGQA C+ ++ V +                                      
Sbjct: 5963 YTCVVSNNAGQASCTTRLFVKE-------------------------------------- 5984

Query: 1159 PKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVE 1218
                     P   ++   D  V  G+S+ L    TGT PI+ TW K    I  SE   + 
Sbjct: 5985 ---------PAAFLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIV 6035

Query: 1219 NSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
             +E    L IL + +   G Y+  +EN+ G       ++ ++ P
Sbjct: 6036 TTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPP 6079



 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 49/237 (20%), Positives = 84/237 (35%), Gaps = 44/237 (18%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F + L+ V    G+   LQC+V   P   I W      L++     +  + ++ S+ I
Sbjct: 7020 PYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVI 7079

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             K    D G Y C A N  G    S  + +              K+R+            
Sbjct: 7080 NKVDHSDVGEYSCKADNSVGAVASSAVLVI--------------KARK------------ 7113

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                              +PP   +  +D     G  V    ++ G++P+  +W K    
Sbjct: 7114 ------------------LPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVL 7155

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP 1265
            +++  +++     N + L IL   Q H G Y     N LG+  +   L + +   PP
Sbjct: 7156 LKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPP 7212



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD-EDGNCSL 1747
            PYF       ++VEG +  F C++ G P P V W K    +     +++ Y+ + G C L
Sbjct: 1082 PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKL 1141

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            +IS    DD  +YT    N  GE + +A L+ E
Sbjct: 1142 VISMTFADDAGEYTIVVRNKHGETSASASLLEE 1174



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 52/233 (22%), Positives = 90/233 (38%), Gaps = 50/233 (21%)

Query: 1033 QKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTT---KFIILSQEGSLCSVSIE 1089
            +K   + V  G+   L+C+V+  P  ++ W  +GK L ++   KF   ++  SL  +S+E
Sbjct: 5708 EKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVE 5767

Query: 1090 KALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTES 1149
            +   +D G Y    +N+ G++ C+  V V D                             
Sbjct: 5768 R---QDAGTYTFQVQNNVGKSSCTAVVDVSD----------------------------- 5795

Query: 1150 DATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQI 1209
                            A+PP   +  ++     G S  L  KV G+ PI+  W   + +I
Sbjct: 5796 ---------------RAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKI 5840

Query: 1210 QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
                  +   S+N   L + +      G YT +  N  GS + +  LTV + P
Sbjct: 5841 VSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPP 5893



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPA--GTPCASDIRSSSLTLSWYGSSYDGGSAVQS 1296
             + ++ EN+ G       +  V   +PP+  G    +D+  +S +L W    +DGGS V  
Sbjct: 24187 FRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLG 24246

Query: 1297  YSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             Y +E+     + W  +A  +  +  V  L    EY+FRV+A N  G S+P
Sbjct: 24247 YVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDP 24296



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 1670  EDVSQAFLEAVAEEKPH---VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1726
             ED  +A L       P    ++P F + + + E  EG +  F+ ++ G P P + W KD 
Sbjct: 31773 EDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDG 31832

Query: 1727  QSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGE 1786
             Q +    + +I ++     +L I D   +D   Y   A N+ G  +C A L VE +   +
Sbjct: 31833 QPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKK 31892

Query: 1787  GEGEEEEE 1794
              E + +EE
Sbjct: 31893 QEFKSKEE 31900



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 65/290 (22%), Positives = 112/290 (38%), Gaps = 42/290 (14%)

Query: 444  APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ----YARSTCEAGVAEL 499
            A      LK+  V E QD V    +    V  + W+ NG  ++    YA S  +  +  L
Sbjct: 2706 AVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV-KGTIYSL 2764

Query: 500  HIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQG 559
             I++    D   Y       LG++  SA + V   K  +K +                  
Sbjct: 2765 RIKNCAIVDESVYGF----RLGRLGASARLHVETVKIIKKPK------------------ 2802

Query: 560  LSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPE 619
              D+  ++ + V   V VS +  P V W H   EI+ S+          H L +Q + P 
Sbjct: 2803 --DVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPS 2859

Query: 620  DTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDP 679
            D G YT       G++  +A L V+  H       I  P + TAS        C ++   
Sbjct: 2860 DAGEYTA----VVGQLECKAKLFVETLHITKTMKNIEVPETKTAS------FECEVSHFN 2909

Query: 680  FPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKN 729
             P++ WL++G  + + +  F+++    +  L++       + +Y  +  N
Sbjct: 2910 VPSM-WLKNGVEI-EMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGN 2957



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG-NCSL 1747
            P   + ++ + V  G  ARF   I G P P++ W+K++Q +  S  F+  +  DG   +L
Sbjct: 3239 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL--STGFKCKFLHDGQEYTL 3296

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
            ++ +   +D A YTC+A N  G AT +A L VE  E
Sbjct: 3297 LLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3332



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 50/237 (21%), Positives = 87/237 (36%), Gaps = 47/237 (19%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F +K+ D+    G+ + LQ  V    P ++ W    + ++    I +S    +  + I
Sbjct: 3924 PTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLII 3983

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                    G Y C+A+N+AG      Q +V +    E                       
Sbjct: 3984 PDVQISFGGKYTCLAENEAGS-----QTSVGELIVKE----------------------- 4015

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                               P +II+  E  +V AG+   L   V GT  +   W K  + 
Sbjct: 4016 -------------------PAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRP 4056

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP 1265
            +  S+  ++    N ++L   +A     G YT  + N++GS   +   TV+D+   P
Sbjct: 4057 LVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAP 4113



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 2/93 (2%)

Query: 1689 PYFSKTIRDLEVV-EGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSL 1747
            P F K +   +V  +G + + +CKI G P+ +V WF++D  + ES  + + +  +    L
Sbjct: 6364 PKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSF-INSVALL 6422

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             I++   +D   Y C+A N +G+A+C+  L V+
Sbjct: 6423 TINEASAEDSGDYICEAHNGVGDASCSTALTVK 6455



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 27/92 (29%), Positives = 49/92 (53%), Gaps = 1/92 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F K    +E ++G+    +C+++G P   V W+KD + +R  + ++I   E+   S+ 
Sbjct: 7399 PIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKI-MSENFLTSIH 7457

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            I +V   D  +Y CKA N +G  TC   + ++
Sbjct: 7458 ILNVDAADIGEYQCKATNDVGSDTCVGSIALK 7489



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 41/118 (34%), Positives = 56/118 (47%), Gaps = 8/118 (6%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---C 1315
             V KP PP       D   +S+TL+W    YDGGS +  Y +EI  +  + W+ +      
Sbjct: 23917 VFKPGPPTNAHIV-DTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGL 23975

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDE 1373
             R T F +  L    EYK RV A+N  G  E +  S   TV  KPE+  +  E+  D E
Sbjct: 23976 RVTRFEISKLTEHQEYKIRVCALNKVGLGEAT--SVPGTV--KPEDKLEAPELDLDSE 24029



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 3/119 (2%)

Query: 1233  QEHCGCY-TLLVENKLG-SRQAQVNLTV-VDKPDPPAGTPCASDIRSSSLTLSWYGSSYD 1289
             QE C  Y  +L  N+ G    A+    V V +P  P G     D+  ++ T+ W     D
Sbjct: 25263 QEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESD 25322

Query: 1290  GGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1348
             GGS +  Y +E+    ++ W      ++    +  L    EY FRV A+N  G S+P Q
Sbjct: 25323 GGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQ 25381



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 45/160 (28%), Positives = 76/160 (47%), Gaps = 8/160 (5%)

Query: 1624 KWQKTGNAVRAIGRLSSMAMISGLSG-RKSSTGSPTSPLNAEKLESEEDVSQ--AFLEAV 1680
            KW K G  +    R  SM+  + ++  R  S     S     K+E++   S   A+L  +
Sbjct: 5173 KWLKDGKQI-VPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVL 5231

Query: 1681 AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD 1740
             +  P   P F+K +  ++ V GS+   +CK+ G       WFKD + I  S  +++   
Sbjct: 5232 DQNIP---PSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCH 5288

Query: 1741 EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            E  + SL ++++  +D A YTCK  N  G+  C+  L V+
Sbjct: 5289 E-RSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVK 5327



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 1/84 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            PYF   +  LE   G +    C++ G P+  V W+K D  +R +  ++  Y  +   +L+
Sbjct: 6079 PYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYR-TYFTNNVATLV 6137

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEAT 1772
             + V  +D  +YTCKA NS+G A+
Sbjct: 6138 FNKVNINDSGEYTCKAENSIGTAS 6161



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 55/269 (20%), Positives = 96/269 (35%), Gaps = 62/269 (23%)

Query: 1031 FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEK 1090
            F ++L D  V  G  ++L+   +  PP ++ W  +   +  ++   ++       + I +
Sbjct: 6929 FVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILE 6988

Query: 1091 ALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESD 1150
            +  ED   Y C+ +N+AGQ  C   V+V +                              
Sbjct: 6989 STIEDYAQYSCLIENEAGQDICEALVSVLE------------------------------ 7018

Query: 1151 ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQ 1210
                             PP  I+  E  +   GE   L  KV GT  I  +W K   +++
Sbjct: 7019 -----------------PPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLR 7061

Query: 1211 ESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP----- 1265
             +   K++   N + L I        G Y+   +N +G+  +   L +  +  PP     
Sbjct: 7062 SAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARK 7121

Query: 1266 -------AGTPCASDIR---SSSLTLSWY 1284
                    G P A + R   S  L +SWY
Sbjct: 7122 LKDVHETLGFPVAFECRINGSEPLQVSWY 7150



 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 30/93 (32%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 1689 PYFSKTIRDLEVV-EGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSL 1747
            P F K +    +V +    R++CKI G P+ +V+W+KD+  I+ES  F++ +  D    L
Sbjct: 7305 PRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSF-VDSVAVL 7363

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             + ++  +D   YTC+A N+ G A+ +  L V+
Sbjct: 7364 EMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVK 7396



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 68/317 (21%), Positives = 120/317 (37%), Gaps = 58/317 (18%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             V  G  + +   VS  PP T+ W +N +TL     I  +   S  S+ I+      +G+Y
Sbjct: 16536 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISS--SMVIKNCQRSHQGVY 16593

Query: 1100  KCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAP 1159
               +AKN+AG+ + +  V V D P    T  P +       S                   
Sbjct: 16594 SLLAKNEAGERKKTIIVDVLDVPGPVGT--PFLAHNLTNESC------------------ 16633

Query: 1160  KTPPKAAMPPQIIQF-PEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVE 1218
                       ++  F PED                G  PIT  ++  +++        V 
Sbjct: 16634 ----------KLTWFSPEDD---------------GGSPIT-NYVIEKRESDRRAWTPVT 16667

Query: 1219  NSENGSKLTILAARQEHCGCYTLLVENKLG------SRQAQVNLTVVDKPDPPAGTPCAS 1272
              +      T+    Q     + +  EN +G      + +A V    +  P+ P       
Sbjct: 16668 YTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLE-VK 16726

Query: 1273  DIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA--TCRSTSFNVQDLLPDHE 1330
             ++  +++TL+W    YDGGS + +Y +E      + + ++      S  + V+ L     
Sbjct: 16727 EVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDT 16786

Query: 1331  YKFRVRAINVYGTSEPS 1347
             Y++RV A+N+ G  +PS
Sbjct: 16787 YEYRVSAVNIVGQGKPS 16803



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 66/316 (20%), Positives = 112/316 (35%), Gaps = 53/316 (16%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G  + ++  V   P  T+ W    + LK T+ +      +   ++I + +  D G Y   
Sbjct: 21080 GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLT 21139

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
             A+N  G+      + V D P                   PP    + D            
Sbjct: 21140 ARNIVGEVGDVITIQVHDIPG------------------PPTGPIKFDE----------- 21170

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
                 +    + F  D     G        V   Q  + TW++    +       +  +  
Sbjct: 21171 ----VSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTV-------IRTTYK 21219

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGTPCASDIRSS 1277
              ++LT     Q     + +  +N+ G      +  +V       P PP GTP  + +   
Sbjct: 21220 ATRLTTGLEYQ-----FRVKAQNRYGVGPGITSACIVANYPFKVPGPP-GTPQVTAVTKD 21273

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYKFRV 1335
             S+T+SW+    DGGS +  Y +E  +     W+ +  A      F    L     Y+FRV
Sbjct: 21274 SMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRV 21333

Query: 1336  RAINVYGTSEPSQESE 1351
              A N+ G S+PS+ SE
Sbjct: 21334 IAENMAGKSKPSKPSE 21349



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 74/390 (18%), Positives = 140/390 (35%), Gaps = 53/390 (13%)

Query: 988   ENLKSASKEELKKDVKNDVNCKRGH-AGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKL 1046
             E L   ++ E +   KND        A ++   K  + + TA       Q +    G   
Sbjct: 28606 ERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPF 28665

Query: 1047  LLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKND 1106
              +   +S  P   + W L    LK T  + ++      +++++ ++  D G Y    +N 
Sbjct: 28666 TIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENT 28725

Query: 1107  AGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAA 1166
             AG    S  V V   P              P +    V    +++ V     PK      
Sbjct: 28726 AGVKTFSVTVVVIGRPG-------------PVTGPIEVSSVSAESCVLSWGEPKDGGGTE 28772

Query: 1167  MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKL 1226
             +   I++  E                      T  W      ++ ++           K+
Sbjct: 28773 ITNYIVEKRESG--------------------TTAWQLVNSSVKRTQ----------IKV 28802

Query: 1227  TILAARQEHCGCYTLLVENKLG-SRQAQVNLTVVDKPDPPAGTPCASD---IRSSSLTLS 1282
             T L    E+   + +  EN+ G S+  +    + + P  P   P   +   + ++++++ 
Sbjct: 28803 THLTKYMEY--SFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIR 28860

Query: 1283  WYGSSYDGGSAVQSYSIEIWDSANKTW--KELATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             W    +DGGS +  Y +E  +     W  +    C   ++ V  L+   EY+FR  A+N 
Sbjct: 28861 WEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNA 28920

Query: 1341  YGTSEPSQESELTTVGEKPEEPKDEVEVSD 1370
              G S+ S+ S    + + P +     EV+D
Sbjct: 28921 AGVSKASEASR-PIMAQNPVDAPGRPEVTD 28949



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 44/209 (21%), Positives = 76/209 (36%), Gaps = 34/209 (16%)

Query: 44   IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV-IHAVHEEDRG 102
            + +G  A  + +  G  E    W ++GQ +T G ++ +   +  T S++ I +  ++D G
Sbjct: 4590 VTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKIS--VTDTVSILKIISTEKKDSG 4647

Query: 103  KYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPK 162
            +YT E  N  G       + V                                    PP 
Sbjct: 4648 EYTFEVQNDVGRSSCKARINVLDLII-------------------------------PPS 4676

Query: 163  FATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHG 222
            F  KL ++   +G      C + G     + W K +  +  S +   S  +    LEI  
Sbjct: 4677 FTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQ 4736

Query: 223  VNQDDVGVYTCLVVNGSGKASMSAELSIQ 251
            +   D G YTC   N +G    S  L+++
Sbjct: 4737 LEGTDSGTYTCSATNKAGHNQCSGHLTVK 4765



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 1/89 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F++    +  ++GS     C+I G P  EVVW KD + +R S+ F+I   +  + SL 
Sbjct: 6458 PVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKIT-SKHFDTSLH 6516

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAEL 1777
            I ++   D  +Y CKA N +G  TC+  +
Sbjct: 6517 ILNLEASDVGEYHCKATNEVGSDTCSCSV 6545



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 3/109 (2%)

Query: 1671 DVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIR 1730
            +VS +    V E+K  + P FS+ +RD++   G    FDC I G     V W+KD + ++
Sbjct: 8041 EVSASTFLTVQEQK--LPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLK 8098

Query: 1731 ESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
            +S + Q  +  D   +L I         +Y+C A N +G A+ +A LI+
Sbjct: 8099 DSPNVQTSF-LDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLIL 8146



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 41/142 (28%), Positives = 62/142 (43%), Gaps = 13/142 (9%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---CRST 1318
             P  P   P  +D    S +L+W    YDGG  +  Y +E     ++ W +  T    R T
Sbjct: 20672 PPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRIT 20731

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEV 1378
              F V DL    +Y FR+ AIN  G  EP+   ++  V         E E++ D E + E+
Sbjct: 20732 QFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIV---------EREMAPDFELDAEL 20782

Query: 1379  DYRTVTINTEQKVSDFYDIEER 1400
               RT+ +     +  F  I+ R
Sbjct: 20783 -RRTLVVRAGLSIRIFVPIKGR 20803



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 35/102 (34%), Positives = 48/102 (47%), Gaps = 5/102 (4%)

Query: 445   PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARST--CEAGVA--ELH 500
             P F  +L +    EGQ    +  V G P P + W  +GQP+    +      G+    LH
Sbjct: 31795 PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 31854

Query: 501   IQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEY 542
             I+D LPED G Y   A N  G  SC A + V E+   +K E+
Sbjct: 31855 IRDTLPEDTGYYRVTATNTAGSTSCQAHLQV-ERLRYKKQEF 31895



 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 4/130 (3%)

Query: 1657 PTSPLNAEKLESEEDVSQ--AFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEG 1714
            P      +++E  E ++   A      ++K   KP        + V+EG  ARF C++ G
Sbjct: 1807 PEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTG 1866

Query: 1715 YPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCT 1774
            YP P+V W+ + Q IR+S+ F++ Y  DG   L I D    D  +    A N  G     
Sbjct: 1867 YPQPKVNWYLNGQLIRKSKRFRVRY--DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHK 1924

Query: 1775 AELIVETMEE 1784
             +L ++  E+
Sbjct: 1925 VKLEIQQRED 1934



 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

Query: 1237  GC---YTLLVENKLGSRQAQVNLTVV---DKPDPPAGTPCASDIRSSSLTLSWYGSSYDG 1290
             GC   + ++ EN+ G  +       V   + P PP       DI  S+++L+W    +DG
Sbjct: 20934 GCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIM-DITKSTVSLAWPKPKHDG 20992

Query: 1291  GSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
             GS +  Y IE     +  W  + T +     V++L    EY F+V A+N  G S P +ES
Sbjct: 20993 GSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAP-RES 21051

Query: 1351  ELTTVGEKPEEPK 1363
                 V E+   P+
Sbjct: 21052 RPVIVKEQTMLPE 21064



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 52/241 (21%), Positives = 83/241 (34%), Gaps = 46/241 (19%)

Query: 1028 APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKF--IILSQEGSLCS 1085
            AP F Q LQ V V EG     +  +S  P   + W  +G+ + T+    + +S       
Sbjct: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 1086 VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVL 1145
            ++I      + G Y   A N +GQA  + ++ V    A                      
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA---------------------- 102

Query: 1146 GTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF 1205
                                  PP  +Q  +   VR G  V L  +VTG       + + 
Sbjct: 103  ----------------------PPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRD 140

Query: 1206 RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP 1265
              +IQ S   ++    +   L I  A  E  G Y++   N +G   +   L V  + + P
Sbjct: 141  GAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVP 200

Query: 1266 A 1266
            A
Sbjct: 201  A 201



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 1/91 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F    + L    G AA+F C + G P  E +W KD  ++  S +++I  D +    L 
Sbjct: 3551 PTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRIS-DAENKHILE 3609

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
            +S++   D   Y+CKA N  G   C AELI+
Sbjct: 3610 LSNLTIQDRGVYSCKASNKFGADICQAELII 3640



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 67/319 (21%), Positives = 123/319 (38%), Gaps = 53/319 (16%)

Query: 1013 AGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTT 1072
            + + D   R   Q   P+F +KL  +    G  + ++C+VS   P +  W  +GK + T+
Sbjct: 5221 SSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTS 5280

Query: 1073 -KFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE 1131
             K+ ++  E S+ S+ +     ED   Y C   N AG   CS  +TV + P S   K P 
Sbjct: 5281 AKYRLVCHERSV-SLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKE-PPSFLVK-PG 5337

Query: 1132 MKSRRPKSSL---------PP---------------------VLGTESDATVKKKPAPKT 1161
             +   P S++         PP                     + G+ S   +    A KT
Sbjct: 5338 RQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKT 5397

Query: 1162 PPKAAM------------------PPQIIQFPEDQK-VRAGESVELFGKVTGTQPITCTW 1202
                                    PP+ ++  E  K V+AG+S  L  K+ G+  I   W
Sbjct: 5398 GQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVW 5457

Query: 1203 MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
             +   ++  S+  ++   ++ + + +     E  G +    +N  GS      + V + P
Sbjct: 5458 FRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPP 5517

Query: 1263 DPPAGTPCASDIRSSSLTL 1281
               +  P    ++++ ++L
Sbjct: 5518 VFSSFPPIVETLKNAEVSL 5536



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 31/98 (31%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 1684 KPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG 1743
            +P   P+F      ++V+ G +A F+C + G     + W KD++ IR   ++ I     G
Sbjct: 6266 EPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITC--VG 6323

Query: 1744 NC-SLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            N   L I  V   D  +YTC+A N +G+  C+A+L V+
Sbjct: 6324 NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVK 6361



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 1685  PHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQS-IRESRHFQIDYDEDG 1743
             P   P+F + +R+L V   S A   CK+ G+P P V W++  +  I +   ++I   + G
Sbjct: 30924 PIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGG 30983

Query: 1744  NCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
                LII+ V  DD   Y  +A N  G  + TA L VE
Sbjct: 30984 YHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE 31020



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
             P F    R   + EG    F C+I G P PE+ WFK++  I  S +  I    +   SL 
Sbjct: 33134 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRN-VYSLE 33192

Query: 1749  ISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
             I +    D  KYT KA N  G+ + TA L+V  + E
Sbjct: 33193 IRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVE 33228



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 41/159 (25%), Positives = 71/159 (44%), Gaps = 5/159 (3%)

Query: 1622 RRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVA 1681
            R  W   GN + AI +   ++ I GL+  + S G+          E+  D   A      
Sbjct: 4892 RVSWYLDGNEITAIQK-HGISFIDGLATFQIS-GARVENSGTYVCEARNDAGTA--SCSI 4947

Query: 1682 EEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDE 1741
            E K    P F + ++ +EVV+ S    +C++ G P  EV W K+++ IR S+ + +  D 
Sbjct: 4948 ELKVKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLT-DR 5006

Query: 1742 DGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
                +L I+     D  +Y C   N  G  +C+  + ++
Sbjct: 5007 VSVFNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALK 5045



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 28/85 (32%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P FS     +E ++ +    +C++ G P  EVVW+KD + +R S+ ++I   ++ + S+ 
Sbjct: 5517 PVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKRQLRSSKKYKI-ASKNFHTSIH 5575

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATC 1773
            I +V   D  +Y CKA N +G  TC
Sbjct: 5576 ILNVDTSDIGEYHCKAQNEVGSDTC 5600



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 35/113 (30%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CRSTS 1319
             P PP   P  +D   SS  L W     DGGS V  Y +E  +   + W++      R T 
Sbjct: 16422 PGPPF--PKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTK 16479

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
               V  L     YKFRVRA+N+ G  EP + +++  + ++   P  +++ S  D
Sbjct: 16480 LVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRD 16532



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

Query: 1261  KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATCRS 1317
             KP  P   P   D    +  L W     DGGS +  Y +E        W  +      R 
Sbjct: 17802 KPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 17861

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
              +F V  L+  +EY+FR++A N+ G  EP + +E     +    P+ E++V+  D
Sbjct: 17862 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRD 17916



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 60/243 (24%), Positives = 94/243 (38%), Gaps = 33/243 (13%)

Query: 1147  TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFG--KVTG-----TQPIT 1199
             TES   + K    K  P    PP++ +  +++        E  G   +TG      +  +
Sbjct: 18382 TESKPVIAKTKYDK--PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHS 18439

Query: 1200  CTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV 1259
               W+   K       MKV+N              +H   + +  EN++G  +  +    V
Sbjct: 18440 TRWVPVNKSAIPERRMKVQN-----------LLPDHEYQFRVKAENEIGIGEPSLPSRPV 18488

Query: 1260  DKPDP--PAGTPC---ASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWD-----SANKTW 1309
                DP  P G P      D    S+TL W    YDGG+ +  Y +E+       S ++ W
Sbjct: 18489 VAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGW 18548

Query: 1310  KEL---ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEV 1366
             K     A      F V  L  + EY+FRV A N  G   P++  E     E  E P+ ++
Sbjct: 18549 KRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDL 18608

Query: 1367  EVS 1369
             + S
Sbjct: 18609 DAS 18611



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 1273  DIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRST--SFNVQDLLPDHE 1330
             D+  S++TL+W    YDGGS +  Y +E   +  + W ++ T + T     V  L    +
Sbjct: 29645 DVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQ 29704

Query: 1331  YKFRVRAINVYGTSEPSQESELTTV 1355
             Y FR+RA N  G SEP +     TV
Sbjct: 29705 YLFRIRAQNEKGVSEPRETVTAVTV 29729



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 65/266 (24%), Positives = 104/266 (39%), Gaps = 36/266 (13%)

Query: 444   APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI-----QYARSTCEAGVAE 498
             AP F   L++  V    +  L C V G P P + W   G+ I     +Y     + G  +
Sbjct: 30927 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQ 30986

Query: 499   LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQ 558
             L I     +D   Y   A N  G VS +A + V                P+K   P  L+
Sbjct: 30987 LIIASVTDDDATVYQVRATNQGGSVSGTASLEVE--------------VPAKIHLPKTLE 31032

Query: 559   GLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFP 618
             G+  +  + G  V++ +  SG P P + W   G ++ ++   H++   T+    +  VFP
Sbjct: 31033 GMGAVHALRGEVVSIKIPFSGKPDPVITW-QKGQDLIDNNG-HYQVIVTRSFTSL--VFP 31088

Query: 619   -----EDTGTYTCEAWNSAG---EVRTQAVLTVQEPHDGTQPWFISKPR-----SVTASL 665
                  +D G Y   A N  G   +     V  V +P  G +   +S+       +  AS 
Sbjct: 31089 NGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASD 31148

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKA 691
             G S + +  +         WLR G+A
Sbjct: 31149 GGSKITNYIVEKCATTAERWLRVGQA 31174



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEI--WD---SANKTWKEL--AT 1314
             PDPP        I  +++ LSW     DGGS V  Y +E   WD   +  + W++     
Sbjct: 16012 PDPPIKLKIGL-ITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD 16070

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG----EKPEEP 1362
                  F V+DL+   EY+FRV+A+N  G S+PS      TVG    ++P+ P
Sbjct: 16071 VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPS-----ATVGPCDCQRPDMP 16117



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 12/132 (9%)

Query: 1239  YTLLVENKLG--SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQS 1296
             + +  EN  G  S       T+   P  P GTP   D+   ++TL W     DGGS +  
Sbjct: 27829 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 27888

Query: 1297  YSIEIWDSANKTW-----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQES 1350
             YSIE     N+ W      +++ C+   + V  L P   Y+FR+ A N  GT S PSQ S
Sbjct: 27889 YSIE-KRQGNERWVRCNFTDVSECQ---YTVTGLSPGDRYEFRIIARNAVGTISPPSQSS 27944

Query: 1351  ELTTVGEKPEEP 1362
              +    ++   P
Sbjct: 27945 GIIMTRDENVPP 27956



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 1677 LEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQ 1736
            +EAV  +   VKP F + ++++ + EGS      +  G P+P++VW K+   I   ++ +
Sbjct: 1547 VEAVEHQ---VKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPK 1603

Query: 1737 IDYD-EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEE 1792
            I  +   G  +L I      D A YT  A+N  G  T   ++ VE +E  E E E +
Sbjct: 1604 IRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE-VEFAEPEPERK 1659



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 82/353 (23%), Positives = 125/353 (35%), Gaps = 50/353 (14%)

Query: 1031  FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLN-GKTLKTTKFIILSQEGSLCSVSIE 1089
             F+ KL    +  G+   L  + S  P   + W  +    L+  +  I +   +L    I 
Sbjct: 16824 FRDKLT---IRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKI- 16879

Query: 1090  KALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTES 1149
             KA   D G Y  V +N  G  +  CQV V D P                   PPV     
Sbjct: 16880 KAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPG------------------PPVGPVSF 16921

Query: 1150  DATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQI 1209
             D   K        P        I     +K   G+ V +    + +   TC   K  K +
Sbjct: 16922 DEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWM-PVTSASAKTTC---KVSKLL 16977

Query: 1210  QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTP 1269
             +  +++   ++EN                Y +       S +A+    V D PD P  T 
Sbjct: 16978 EGKDYIFRIHAEN---------------LYGISDPLVSDSMKAKDRFRVPDAPDQPIVTE 17022

Query: 1270  CASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS---TSFNVQDLL 1326
                D    S  ++W    +DGG  + +Y +E  ++ +K W  +        T F V DLL
Sbjct: 17023 VTKD----SALVTW-NKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLL 17077

Query: 1327  PDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVD 1379
                +Y+FRV A N  G  +PS  S+     +   +P   V     D     VD
Sbjct: 17078 EGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVD 17130



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

Query: 129   KQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRP 188
             +QL  PV++K L                   PP F        V  G+  +      GRP
Sbjct: 22133 RQLSVPVIAKDL-----------------VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRP 22175

Query: 189   QPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKA 242
              P VTW K NVPL+ + RV+        +L I    ++DVG Y   + N +G+A
Sbjct: 22176 TPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEA 22229



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 44/77 (57%)

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             V+ GQ  +    I+GRP+P +TW K  +PL+ + R++V++   +  L I   ++DD G Y
Sbjct: 23241 VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 23300

Query: 232   TCLVVNGSGKASMSAEL 248
                V N  G+ + S E+
Sbjct: 23301 GITVANVVGQKTASIEI 23317



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIR---ESRHFQIDYDEDGNC 1745
             P F+  + +     G   RF   I  +P+P V W+K  Q I+     + +  + D+ G  
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDK-GLY 31748

Query: 1746  SLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              L I+ V  DDDA+YT  A N  GE +C A+L V
Sbjct: 31749 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 51/230 (22%), Positives = 81/230 (35%), Gaps = 35/230 (15%)

Query: 22   SRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLL 81
            +R++ + L   P+F    + +   +G+    E  V G     + W ++ Q I++  ++  
Sbjct: 4664 ARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKF 4723

Query: 82   DCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLG 141
                   F L I  +   D G YTC ATN +G  Q +  LTV+                 
Sbjct: 4724 SFHDNTAF-LEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKE---------------- 4766

Query: 142  DRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPL 201
                              PP F  K     V      +    + G     + W K N  L
Sbjct: 4767 ------------------PPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKEL 4808

Query: 202  QPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQ 251
               A  SV + +    LE+      D G Y C + N  G A+  A L ++
Sbjct: 4809 HSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVK 4858



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 1/111 (0%)

Query: 1678  EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQI 1737
             E  A E    KP     ++D  V   S A+F  K  G P P  +W KD ++I +   +++
Sbjct: 32841 EPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKL 32900

Query: 1738  DYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGE 1788
               D+ G   L I      D   YTC   NS G  + + +L ++ +++ E +
Sbjct: 32901 SEDK-GGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQ 32950



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 66/288 (22%), Positives = 114/288 (39%), Gaps = 41/288 (14%)

Query: 448  SSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGVAELHIQDA 504
            +  +K+  V E +    +C V    VP + WL NG  I+ +       +  + +L I + 
Sbjct: 2885 TKTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNT 2943

Query: 505  LPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQG-LSDL 563
              ED   YT +  N   QVS +  VT                       PI +   L D+
Sbjct: 2944 STEDSAEYTFVCGN--DQVSATLTVT-----------------------PIMITSMLKDI 2978

Query: 564  KVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGT 623
               +   +T  V V+        WL NG EI+ ++      +   HSL I+ V   D   
Sbjct: 2979 NAEEKDTITFEVTVNYEGI-SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAAD 3037

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
            YT      AG+  + A L V+  H      F    + +     +  +  C ++ +P  TV
Sbjct: 3038 YTF----VAGKATSTATLYVEARHIE----FRKHIKDIKVLEKKRAMFECEVS-EPDITV 3088

Query: 684  HWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRV 731
             W++D + L + T   ++ + + V  L++   +   AG+Y ++    V
Sbjct: 3089 QWMKDDQEL-QITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNV 3135



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 26/89 (29%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            PYF+K  + +EV++        ++ G P  E+ WFKD+  +R  R ++  + +D   SL 
Sbjct: 4393 PYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYK-TFIQDHLVSLQ 4451

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAEL 1777
            I      D  +Y C+  N +G + C+A +
Sbjct: 4452 ILKFVAADAGEYQCRVTNEVGSSICSARV 4480



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 37/110 (33%), Positives = 60/110 (54%), Gaps = 6/110 (5%)

Query: 1677 LEAVAEEKPHVKPY-FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHF 1735
            LE  AE +   +P  F+K I+++ V E  +A F+C++  + D  V W+K    + ES+ +
Sbjct: 8821 LETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEV-SFDDAIVTWYKGPTELTESQKY 8879

Query: 1736 QIDYDEDGNCS-LIISDVCGDDDAKYTCKA-VNSLGEATCTAELIVETME 1783
              ++  DG C  + I +V  DD+  Y+  A +   GEA  TAEL + T E
Sbjct: 8880 --NFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKE 8927



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 25/93 (26%), Positives = 54/93 (58%), Gaps = 2/93 (2%)

Query: 1689 PYFSKTIRDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSL 1747
            P F K +   ++V+ G ++R +CKI G P+  VVWF+++  +  S  +++ +  D    +
Sbjct: 5423 PKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTF-IDSVAVI 5481

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             ++++  +D   + C+A N  G  +C+ ++IV+
Sbjct: 5482 QMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVK 5514



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 95/436 (21%), Positives = 157/436 (36%), Gaps = 67/436 (15%)

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             ++ G   R    I GRP P+V W K +  ++ +A + V+      VL+   VN+ D G Y
Sbjct: 22954 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLD--NVNRYDSGKY 23011

Query: 232   TCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAA 291
             T  + N SG  + SA ++++ LD+        +   N  V +   + +S   +   L+  
Sbjct: 23012 TLTLENSSG--TKSAFVTVRVLDT-------PSPPVNLKVTEITKDSVSITWEPPLLDGG 23062

Query: 292   AKSKNCSSPQRGGS-PPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAA 350
             +K KN    +R  +   +AA          K++  ++    +    V  +    I L A 
Sbjct: 23063 SKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEG--CSYYFRVTAENEYGIGLPAQ 23120

Query: 351   RVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRD 410
                P   A    V  P G+           +    +P     D  SK     + M+ +  
Sbjct: 23121 TADPIKVAE---VPQPPGKITVDDVTRNSVSLSWTKP---EHDGGSKIIQYIVEMQAKHS 23174

Query: 411   SAFPKFESKPQSQEVKENQT----VKFRC-----------EGLAVMEVA------PSFSS 449
               + +       Q V  N T      FR              LAV  VA      P    
Sbjct: 23175 EKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKP 23234

Query: 450   VLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALP 506
                  +V  GQD  ++  + G P P ITW  +G P++       T    +  L I++   
Sbjct: 23235 AFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHK 23294

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM 566
             +D G Y     N +GQ + S  +   +K             P  P  P+    +S     
Sbjct: 23295 DDGGQYGITVANVVGQKTASIEIVTLDK-------------PDPPKGPVKFDDVS----- 23336

Query: 567   DGSQVTMTVQVSGNPP 582
                    ++ +S NPP
Sbjct: 23337 -----AESITLSWNPP 23347



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/82 (29%), Positives = 41/82 (50%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +++K G+  R    + GRP P+VTW K  V ++    + +++  G   L +    +D  G
Sbjct: 27968 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 28027

Query: 230   VYTCLVVNGSGKASMSAELSIQ 251
             VYT    N SG A    ++ +Q
Sbjct: 28028 VYTVEAKNASGSAKAEIKVKVQ 28049



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/92 (26%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
             P   K ++D+    G AA+  C+I G P P++ W++  + + +SR +++  D   +   +
Sbjct: 30533 PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTV 30592

Query: 1749  ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             +++   +D+  YTC A N +GE   +++L+++
Sbjct: 30593 MTEE-QEDEGVYTCIATNEVGEVETSSKLLLQ 30623



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 1702 EGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYT 1761
            +G A +  CK+ G P  ++ WF +D+ I+ES   ++ + E     L ++DV  +D  +Y 
Sbjct: 4313 KGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVE-STAVLRLTDVGIEDSGEYM 4371

Query: 1762 CKAVNSLGEATCTAELIVE 1780
            C+A N  G   C++ +IV+
Sbjct: 4372 CEAQNEAGSDHCSSIVIVK 4390



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 37/113 (32%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 1668 SEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQ 1727
            S E  S +    VA ++P   P F K I +   V  S+A F   + G P   + W KDDQ
Sbjct: 5030 SNEGGSCSCSTRVALKEP---PSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQ 5086

Query: 1728 SIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             + E  +  I +  D   +L I  V      +YTC+A N  G   C A L+V+
Sbjct: 5087 ILDEDDNVYISF-VDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQ 5138



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 50/235 (21%), Positives = 84/235 (35%), Gaps = 48/235 (20%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
            P F  K   V +A G+    +C V+   P  I W  + + ++      ++   +  ++++
Sbjct: 7212 PFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTV 7271

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             K    D G Y C A N AG+  CS Q+ V +                            
Sbjct: 7272 LKVGKGDAGQYTCYASNIAGKDSCSAQLGVQE---------------------------- 7303

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQK-VRAGESVELFGKVTGTQPITCTWMKFRK 1207
                               PP+ I+  E  + V+  E      K+ G+  I   W K   
Sbjct: 7304 -------------------PPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDET 7344

Query: 1208 QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            +IQES   ++   ++ + L +     E  G YT    N  GS  +  +L V + P
Sbjct: 7345 EIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPP 7399



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 48/199 (24%), Positives = 78/199 (39%), Gaps = 12/199 (6%)

Query: 551   PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHS 610
             PT  +       + V  G  V + + ++G PPP   W   G++++ESE    E       
Sbjct: 29736 PTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAK 29795

Query: 611   LCIQEVFPEDTGTYTCEAWNSAGEV-RTQAVLTVQEPHDGTQPWFISK--PRSVTASL-- 665
             L I+E    DTG YT E  N  G    T  V+ + +P   T P  I +    S+T S   
Sbjct: 29796 LTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEP 29855

Query: 666   ----GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAG 721
                 G + L    +         WL   +++ + T  F  L   + +   +     +  G
Sbjct: 29856 PELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIG 29915

Query: 722   QYEILLKNRVGECSCQVSL 740
              Y   L++ V EC   + +
Sbjct: 29916 SY---LQSEVIECRSSIRI 29931



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 32   APAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR-GTFS 90
            AP FI  P    + EG +  F  +V G P+P V W ++G P+T+G R+ +    + G   
Sbjct: 1081 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1140

Query: 91   LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSF 127
            LVI     +D G+YT    N  G    +  L  E  +
Sbjct: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADY 1177



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F KT+   ++V G+ A   C++ G    E+ WFKD + IR S+ +++ + +     L 
Sbjct: 3831 PSFIKTLEPADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRL-FSQKSLVCLE 3889

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTA 1775
            I      D  +Y C   N +G+  C A
Sbjct: 3890 IFSFNSADVGEYECVVANEVGKCGCMA 3916



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 2/119 (1%)

Query: 1661  LNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEV 1720
             ++A+  +   D  Q  +  +A++   + P F        V+ G   + D    G P P V
Sbjct: 22121 VSAQNEKGISDPRQLSVPVIAKDLV-IPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAV 22179

Query: 1721  VWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              W KD+  ++++     +  E+ N  L I D C +D   Y  K  NS GEA  T  +IV
Sbjct: 22180 TWHKDNVPLKQTTRVNAESTEN-NSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIV 22237



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 94/441 (21%), Positives = 159/441 (36%), Gaps = 63/441 (14%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V ++ G   R    ++GRP P +TW K  + L   A +  +E   + +++   VN+ D G
Sbjct: 29456 VTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVD--KVNRYDAG 29513

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSF-VRETKATNSDVRKE---------VTNVI 279
              YT    N SGK S +  + +        S  V+E    +  +  E         V N I
Sbjct: 29514 KYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYI 29573

Query: 280   SKESKLDSLEAAAKSKNCSSPQRGGSP------------PWAANSQPQPPRESKLESCKD 327
              ++ +         +  CS      S             P       +P   S      +
Sbjct: 29574 VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSE 29633

Query: 328   SPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQP 387
              P    +  V+  T S++TL       +P   G   L+    E  +    R     T +P
Sbjct: 29634 VPLVPAKLEVVDVTKSTVTL----AWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKP 29689

Query: 388   GLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSF 447
              +    V S         EG++     + +++    E +E  T     + L V+      
Sbjct: 29690 TVLEHTVTSL-------NEGEQYLFRIRAQNEKGVSEPRETVTA-VTVQDLRVLPTIDLS 29741

Query: 448   SSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-RSTCE--AGVAELHIQDA 504
             +   K   V  G+   L   + G P P  +W   G  ++ + R T E    VA+L I++ 
Sbjct: 29742 TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRET 29801

Query: 505   LPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLK 564
                D G YT   +N  G  S +  V + +K             P  PT PI       + 
Sbjct: 29802 TIRDTGEYTLELKNVTGTTSETIKVIILDK-------------PGPPTGPI------KID 29842

Query: 565   VMDGSQVTMTVQVSGNPPPEV 585
              +D + +T++ +     PPE+
Sbjct: 29843 EIDATSITISWE-----PPEL 29858



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 62/233 (26%), Positives = 97/233 (41%), Gaps = 22/233 (9%)

Query: 1155  KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFG---KVTGTQPITCTWMKFRKQIQE 1211
             K   P TP     PP+    P +       SV L     K  G   +T  +++ ++   +
Sbjct: 30315 KSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTD 30374

Query: 1212  S--EHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG-SRQAQVNLTVV-----DKPD 1263
                 H K + +     +T L    E+   + ++ +N +G S  +  +  VV     DKP 
Sbjct: 30375 KWVRHNKTQITTTMYTVTGLVPDAEYQ--FRIIAQNDVGLSETSPASEPVVCKDPFDKPS 30432

Query: 1264  PPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCRSTSFN 1321
              P      S I   S+TL W     DGG  +  Y +E   S +  WK+      +   F 
Sbjct: 30433 QPGELEILS-ISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFT 30491

Query: 1322  VQDLLPDHEYKFRVRAINVYGTSEP-----SQESELTTVGEKPEEPKDEVEVS 1369
             +  LL   EY+FRV A N  G S P     S +++LT+ GE P   K+  +V+
Sbjct: 30492 IGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTS-GEAPGIRKEMKDVT 30543



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 171   VVKEGQMGRFSCKITGRPQP-QVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V +EG   ++ CKI    Q  QVTW  G   L+ S +  ++ ++G+ +L +  + + D G
Sbjct: 31578 VGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDG 31637

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRET 264
              Y C VVN  G+ S  AEL ++G+      + R T
Sbjct: 31638 TYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRT 31672



 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 54/233 (23%), Positives = 82/233 (35%), Gaps = 48/233 (20%)

Query: 1031 FKQKLQDVHVAE-GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIE 1089
            F +KL+   + + G    L C+V+  PP  I W  N + +K +    +S   S   + + 
Sbjct: 4301 FVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLT 4360

Query: 1090 KALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTES 1149
                ED G Y C A+N+AG   CS  V V ++P                           
Sbjct: 4361 DVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPY-------------------------- 4394

Query: 1150 DATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQI 1209
              T + KP                     +V     V L  +V GT P   TW K    +
Sbjct: 4395 -FTKEFKPI--------------------EVLKEYDVMLLAEVAGTPPFEITWFKDNTIL 4433

Query: 1210 QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
            +     K    ++   L IL       G Y   V N++GS      +T+ + P
Sbjct: 4434 RSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPP 4486



 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 72/338 (21%), Positives = 111/338 (32%), Gaps = 54/338 (15%)

Query: 1036  QDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPED 1095
             ++ H+  G  L L   +   P   + W    +   T   I ++  GS   + I  A  ED
Sbjct: 17226 REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEIRNAAHED 17283

Query: 1096  RGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKK 1155
              G+Y    +N AG    S +V V D P              P+      +  +S     K
Sbjct: 17284 GGIYSLTVENPAGSKTVSVKVLVLDKPGP------------PRDLEVSEIRKDSCYLTWK 17331

Query: 1156  KPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM 1215
             +P                         G SV     V      +  W       ++  H 
Sbjct: 17332 EPLDD----------------------GGSVITNYVVERRDVASAQWSPLSATSKKKSHF 17369

Query: 1216  KVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP--PAGTPCAS- 1272
                 +E    L  +AA            EN+ G          +   DP  P G P    
Sbjct: 17370 AKHLNEGNQYLFRVAA------------ENQYGRGPFVETPKPIKALDPLHPPGPPKDLH 17417

Query: 1273  --DIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHE 1330
               D+  + ++L W     DGGS +  Y +E  +   + W +  T  +    V  L     
Sbjct: 17418 HVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECVVTGLQQGKT 17477

Query: 1331  YKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEV 1368
             Y+FRV+A N+ G   P     +    EK   P  E++V
Sbjct: 17478 YRFRVKAENIVGLGLPDTTIPI-ECQEKLVPPSVELDV 17514



 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             L IK G + + +  V+G P P+VTW ++G  I       +   + G+ SL +     + R
Sbjct: 27968 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTSLFVRDATRDHR 28026

Query: 102   GKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFS 145
             G YT EA N SG+ +  +++ V+ +  K +G    +   G++ +
Sbjct: 28027 GVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMT 28070



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 51/244 (20%), Positives = 83/244 (34%), Gaps = 55/244 (22%)

Query: 1028 APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTT-KFIILSQEGSLCSV 1086
            AP F + L++V         L C+++   P  + W  +GK +  + ++ I   EG+  S+
Sbjct: 4112 APFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGT-ASL 4170

Query: 1087 SIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLG 1146
             I +    D G + C A N  G  + S  + V +                          
Sbjct: 4171 EIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQE-------------------------- 4204

Query: 1147 TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
                                 PP  +  P  + V  G +V L     G+ P+T  W K  
Sbjct: 4205 ---------------------PPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGN 4243

Query: 1207 KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNL------TVVD 1260
            K++       +      S L +   +    G YT  V N  G  +   NL      T V+
Sbjct: 4244 KELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVE 4303

Query: 1261 KPDP 1264
            K +P
Sbjct: 4304 KLEP 4307



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 1696 RDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGD 1755
            + ++V E      +C + G P+ +V W KD + I  SR+F + + E+   S  I  V   
Sbjct: 5148 KSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSF-ENNVASFRIQSVMKQ 5206

Query: 1756 DDAKYTCKAVNSLGEATCTAELIV 1779
            D  +YT K  N  G ++C A L V
Sbjct: 5207 DSGQYTFKVENDFGSSSCDAYLRV 5230



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 90/418 (21%), Positives = 158/418 (37%), Gaps = 69/418 (16%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VV+ G   R    I GRP P+VTW K N+ L+  A +  +E     +L I   N+ D G
Sbjct: 20786 LVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTE--SFTLLIIPECNRYDTG 20843

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSF-VRETKATNSDVR-----------KEVTN 277
              +   + N +GK   S  ++++ LD+      +R T  T   V              +TN
Sbjct: 20844 KFVMTIENPAGK--KSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITN 20901

Query: 278   VISKE---SKLDSLEAAAKSKNCSSPQRGGSP-------PWAANSQ--PQPPRESKLESC 325
              I ++   ++     A  K   C+    G S          A N     +P   ++    
Sbjct: 20902 YIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKA 20961

Query: 326   KDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTR 385
              ++P       ++  T S+++L      P+P+  G   ++    E +R    +     T 
Sbjct: 20962 SEAPSPPDSLNIMDITKSTVSL----AWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTV 21017

Query: 386   QPGLGSQDVVSKAANR-----RIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAV 440
             +   G + VV           ++        + P+ ES+P    + + QT+      L  
Sbjct: 21018 K---GLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESRP---VIVKEQTM------LPE 21064

Query: 441   MEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI---QYARSTCEAGVA 497
             +++   +  ++   A   G +  ++  V G P P +TW    Q +   Q       A   
Sbjct: 21065 LDLRGIYQKLVIAKA---GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATST 21121

Query: 498   ELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPI 555
              L+I + +  D G Y   A N +G+V     + VH+              P  PT PI
Sbjct: 21122 ILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHD-------------IPGPPTGPI 21166



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 18/153 (11%)

Query: 1202  WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG---SRQAQVNLTV 1258
             W K  K +  + H KV     G               + +  EN  G          +  
Sbjct: 26716 WQKANKLVIRTTHFKVTTISAGLIYE-----------FRVYAENAAGVGKPSHPSEPVLA 26764

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCR 1316
             +D  +PP      +DI  +S++LSW   ++DGGS +  Y +E  D  +  W +       
Sbjct: 26765 IDACEPPRNVRI-TDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVT 26823

Query: 1317  STSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQ 1348
              T F +  L  + +Y+FRV A N  G+ S PS+
Sbjct: 26824 ETQFIISGLTQNSQYEFRVFARNAVGSISNPSE 26856



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 55/198 (27%), Positives = 76/198 (38%), Gaps = 39/198 (19%)

Query: 452  KDCAVIEGQDFVLQCSVRGTPVPRITWLLNG---QPIQYARSTCEAGVAELHIQDALPED 508
            KD   +E      + SV    VP + W       +P    R   E  V +L +Q+  P D
Sbjct: 2802 KDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSD 2860

Query: 509  HGTYTCLAENALGQVSCSAWV---TVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKV 565
             G YT +    +GQ+ C A +   T+H  K+ +  E      P   TA            
Sbjct: 2861 AGEYTAV----VGQLECKAKLFVETLHITKTMKNIE-----VPETKTA------------ 2899

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYT 625
                  +   +VS    P + WL NG EI+ SE F    +G  H L I     ED+  YT
Sbjct: 2900 ------SFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYT 2952

Query: 626  CEAWNSAGEVRTQAVLTV 643
                N     +  A LTV
Sbjct: 2953 FVCGND----QVSATLTV 2966



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 28/94 (29%), Positives = 46/94 (48%), Gaps = 1/94 (1%)

Query: 1687 VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
            V P F + ++D+  + G++   +C++ G     V WF+D   I      Q  + E+  C+
Sbjct: 6739 VPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSEN-VCT 6797

Query: 1747 LIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            L +S +   D   YTC A N  G   C+A L V+
Sbjct: 6798 LNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQ 6831



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 34/92 (36%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKD-DQSIRESRHFQIDYDEDGNCSL 1747
            P F K + D+  V G   +    IEG     VVWFKD  + +RES +  I Y E+   +L
Sbjct: 7492 PRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSEN-IATL 7550

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              S V   +  KYTC+  N  G   C A L V
Sbjct: 7551 QFSRVEPANAGKYTCQIKNDAGMQECFATLSV 7582



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CR 1316
             +  P PP   P  +D  S+++ L W   +++GG  +  Y ++        W        +
Sbjct: 15000 ISPPGPPI--PRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIK 15057

Query: 1317  STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
                + V+++    +YK RV A+N  G   P  E++  TV E  E P  E++VS
Sbjct: 15058 VRQYTVKEIREGADYKLRVSAVNAAGEGPPG-ETQPVTVAEPQEPPAVELDVS 15109



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 1687 VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
            V P F++ +++   V G++   +CK+ G     V WF +   I     +Q  +  D  C+
Sbjct: 5798 VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTF-SDNVCT 5856

Query: 1747 LIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            L ++ +   D   YTC A N  G   C A L V+
Sbjct: 5857 LQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQ 5890



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 71/323 (21%), Positives = 113/323 (34%), Gaps = 62/323 (19%)

Query: 1056  PPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSC- 1114
             PP T+ W  + K L +     +    S   ++I +    D G Y    +N  G+ + S  
Sbjct: 27299 PPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTV 27358

Query: 1115  QVTVDDAPASENTKAPEMKSRRPKSSL--PPVLGTES---DATVKKKPAPKTPPKAAMPP 1169
              V V D PA+      +  SR   + L  PP++   S   +  ++K+ A K         
Sbjct: 27359 SVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKR-------- 27410

Query: 1170  QIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTIL 1229
                                            TW     +   +    ++ SE        
Sbjct: 27411 -------------------------------TWSVVSHKCSSTSFKLIDLSEKTPFF--- 27436

Query: 1230  AARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCAS--DIRSSSLTLSWYGSS 1287
                      + +L EN++G  +       V   + PA     S  D   +S+ LSW    
Sbjct: 27437 ---------FRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPD 27487

Query: 1288  YDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             +DGGS +  Y +E      +TW      ++    V  L      +FRV A N  G S+P 
Sbjct: 27488 FDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPV 27547

Query: 1348  QESELTTVGEKPEEPKDEVEVSD 1370
                 + TV E    P  EV++SD
Sbjct: 27548 TIGPI-TVKELIITP--EVDLSD 27567



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 41/157 (26%), Positives = 69/157 (43%), Gaps = 9/157 (5%)

Query: 1220  SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQ--VNLTVVDKPDPPAGTPCA---SDI 1274
             SE   K+T L    E+   + ++ EN  G   A     L    +P  P G P     +D 
Sbjct: 28208 SETRFKVTGLTEGNEYE--FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDT 28265

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYK 1332
               ++++L W    +DGG  +  Y IE+  +    W ++    C  T + V DL    EYK
Sbjct: 28266 SKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYK 28325

Query: 1333  FRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
             FRV AIN  G  +  + +      ++   P+ +++ +
Sbjct: 28326 FRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDAN 28362



 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 31/92 (33%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F K + DL  + G        + G     V W K  + IRE    ++ +  +G   LI
Sbjct: 3924 PTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFS-NGVAVLI 3982

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            I DV      KYTC A N  G  T   ELIV+
Sbjct: 3983 IPDVQISFGGKYTCLAENEAGSQTSVGELIVK 4014



 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 1673 SQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRES 1732
            S A L   A + P   P+F++ ++D+    G    F+C+I G    +V W+KD   +++ 
Sbjct: 7103 SSAVLVIKARKLP---PFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDD 7159

Query: 1733 RHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
             + Q  +  +   +L I         +Y C A N LG A+ +A+LI+   E
Sbjct: 7160 ANLQTSFVHN-VATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHE 7209



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 55/281 (19%), Positives = 99/281 (35%), Gaps = 50/281 (17%)

Query: 972  AKPAETLKPMGNAKPD--ENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAP 1029
            AK    ++P GN K    EN  + +  ++ K       C   +    D+          P
Sbjct: 7246 AKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPP 7305

Query: 1030 AFKQKLQDVHVAEGKKLL-LQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             F +KL+   + +  +    +C++   P   ++W  +   ++ +    +S   S+  + +
Sbjct: 7306 RFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEM 7365

Query: 1089 EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
                 ED G Y C A N AG A  S  + V +                     PP+    
Sbjct: 7366 HNLSVEDSGDYTCEAHNAAGSASSSTSLKVKE---------------------PPIF--- 7401

Query: 1149 SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                 +KKP P    K                  G  V L  ++ GT P   +W K +++
Sbjct: 7402 -----RKKPHPIETLK------------------GADVHLECELQGTPPFHVSWYKDKRE 7438

Query: 1209 IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGS 1249
            ++  +  K+ +    + + IL       G Y     N +GS
Sbjct: 7439 LRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGS 7479



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

Query: 649   GTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVF 708
             G  P    + + VT  LG++  +SC I G P P + W R GK L + +  +++  +    
Sbjct: 30530 GEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQ-SRKYKMSSDGRTH 30588

Query: 709   TLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
             TL +   +    G Y  +  N VGE      L+LQ
Sbjct: 30589 TLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQ 30623



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 1687 VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
            V P+F      +++  G +  F C + G    ++ W KD++ IR   ++++   E+   +
Sbjct: 7210 VPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVEN-TAT 7268

Query: 1747 LIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            L +  V   D  +YTC A N  G+ +C+A+L V+
Sbjct: 7269 LTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQ 7302



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 12/155 (7%)

Query: 145   SAPAVETRPSIWGECPPKF--ATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQ 202
             S P  E +     E P  F     L  + VK G        +TG+P+P++TW K ++ L+
Sbjct: 13673 SRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILK 13732

Query: 203   PSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQG---------- 252
                R+++        + I    + D G Y    VN  G+A+   E+++            
Sbjct: 13733 QDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDI 13792

Query: 253   LDSANRSFVRETKATNSDVRKEVTNVISKESKLDS 287
              D  N S +        D   ++TN + +    DS
Sbjct: 13793 TDVTNESCLLTWNPPRDDGGSKITNYVVERRATDS 13827



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 10/118 (8%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC------ 1315
             P PP G P        S+ +SW     +GGS +  Y +E  +  +  W  ++        
Sbjct: 15599 PGPP-GKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 15657

Query: 1316  -RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK--PEEPKDEVEVSD 1370
              +   FNV  LL   +Y+FR  AIN  G   PS+ S+    G+   P  P    EV D
Sbjct: 15658 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKD 15715



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 76/335 (22%), Positives = 109/335 (32%), Gaps = 60/335 (17%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G  + L   V   PP  I W+     L+    + +        +  E     D G Y   
Sbjct: 19708 GVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILT 19767

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
              +N  G+ E +  V V D P                   PPV  T  + +         P
Sbjct: 19768 LENSCGKKEYTIVVKVLDTPG------------------PPVNVTVKEISKDSAYVTWEP 19809

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
             P       II +   ++       +   K   T    C+   FR          V N E 
Sbjct: 19810 PIIDGGSPIINYVVQKR-------DAERKSWSTVTTECSKTSFR----------VANLEE 19852

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS---SSL 1279
             G               + +  EN+ G          V     P G      +RS   SS 
Sbjct: 19853 GKSYF-----------FRVFAENEYGIGDPGETRDAVKASQTP-GPVVDLKVRSVSKSSC 19900

Query: 1280  TLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAIN 1339
             ++ W     DGGS +  Y ++     NK W+ +    S  ++ +DL    EY FRV A N
Sbjct: 19901 SIGWKKPHSDGGSRIIGYVVDFLTEENK-WQRVMKSLSLQYSAKDLTEGKEYTFRVSAEN 19959

Query: 1340  VYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEK 1374
               G   P   SE+T V       +D+V   D D K
Sbjct: 19960 ENGEGTP---SEITVVA------RDDVVAPDLDLK 19985



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             S +  +GQ + I   I+G P PT+ W +DG  L K T    V  + D+ TL +K+     
Sbjct: 23238 SYSVQVGQDLKIEVPISGRPKPTITWTKDGLPL-KQTTRINVTDSLDLTTLSIKETHKDD 23296

Query: 720   AGQYEILLKNRVGECSCQVSLM 741
              GQY I + N VG+ +  + ++
Sbjct: 23297 GGQYGITVANVVGQKTASIEIV 23318



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 1/92 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F K I     + G  A F   ++G     V W KD   I E  + ++ + E+   SL 
Sbjct: 4486 PSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTF-ENNVASLY 4544

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            +S +    D KY C+A N  G   C+A L V+
Sbjct: 4545 LSGIEVKHDGKYVCQAKNDAGIQRCSALLSVK 4576



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 24/81 (29%), Positives = 40/81 (49%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             + VK G        + G+P P V+W K    L+P+  + ++ +  +  LE+  VN+ D G
Sbjct: 19305 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 19364

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              YT    N SG  S + +L +
Sbjct: 19365 DYTITAENSSGSKSATIKLKV 19385



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 67/319 (21%), Positives = 114/319 (35%), Gaps = 50/319 (15%)

Query: 1062  WTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDA 1121
             W+  GK ++ +    ++   +   ++I+ A  +D G Y   A N  G      +VTV D 
Sbjct: 20413 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDV 20472

Query: 1122  PASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVR 1181
             P                   PP     S+ + +K     TPP       I  +  +++  
Sbjct: 20473 PG------------------PPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKR-- 20512

Query: 1182  AGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTL 1241
               E+  L             W    + IQ   H+  +  + G++     +   H G    
Sbjct: 20513 --ETSRLL------------WTVVSEDIQSCRHVATKLIQ-GNEYIFRVSAVNHYG---- 20553

Query: 1242  LVENKLGSRQAQVNLTVVDK--PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
                   G       + +VD+  P  P   P  S++  ++ T+SW     DGGS +  Y +
Sbjct: 20554 -----KGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 20608

Query: 1300  EIWDSANKTWKELATCRSTSF--NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGE 1357
             E  +  +  W        +     V  L     Y+FRV A N  G   PS+ S+   + +
Sbjct: 20609 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 20668

Query: 1358  K--PEEPKDEVEVSDDDEK 1374
                P  P     V+D  +K
Sbjct: 20669 AAYPPGPPSNPHVTDTTKK 20687



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 92/445 (20%), Positives = 156/445 (35%), Gaps = 76/445 (17%)

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             +K G   R S  I G P P+VTW K +      AR+ V+       LEI     +D G+Y
Sbjct: 17230 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK--LEIRNAAHEDGGIY 17287

Query: 232   TCLVVNGSGKASMSAELSIQGLDSANR----SFVRET------KATNSDVRKEVTNVISK 281
             +  V N +G  ++S ++ +       R    S +R+       K    D    +TN + +
Sbjct: 17288 SLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVE 17347

Query: 282   ESKLDS-----LEAAAKSKN--CSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQ 334
                + S     L A +K K+        G    +   ++ Q  R   +E+ K      P 
Sbjct: 17348 RRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPL 17407

Query: 335   TPV--------LQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQ 386
              P         +    + ++L   +   +  +P  G L    EE                
Sbjct: 17408 HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEE---------------- 17451

Query: 387   PGLGSQDVV--SKAANRRIPMEGQRDSAFPKFESKPQS--QEVKENQTVKFRCEGLAVME 442
                G+QD +      N    + G +     +F  K ++       + T+   C+   V  
Sbjct: 17452 ---GTQDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPP 17508

Query: 443   VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI---QYARSTCEAGVAEL 499
                    +++   V  G        +RG PVP   W  +G  I   ++     +   + L
Sbjct: 17509 SVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVL 17568

Query: 500   HIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQG 559
              I++ L  D G Y     NA G  + +  +TV +              P  PT PI    
Sbjct: 17569 TIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD-------------VPGPPTGPI---- 17611

Query: 560   LSDLKVMDGSQVTMTVQVSGNPPPE 584
                  ++D +   MT  +S  PP +
Sbjct: 17612 ----NILDVTPEHMT--ISWQPPKD 17630



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 15/123 (12%)

Query: 12    ISKTSLSVDPSRVDSMPLTEAPAFILPPRN---------LCIKEGATAKFEGRVRGYPEP 62
             I++T++++ P    S P+T   A  +PPR          L +K G     +  V G P P
Sbjct: 19267 IARTAVNISPPSEPSDPVTIL-AENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMP 19325

Query: 63    QVTWHRNGQPI--TSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
              V+W ++G  +    G +  +    R   +L + +V+ +D G YT  A N SG++  T++
Sbjct: 19326 TVSWKKDGTLLKPAEGIKMAMQ---RNLCTLELFSVNRKDSGDYTITAENSSGSKSATIK 19382

Query: 121   LTV 123
             L V
Sbjct: 19383 LKV 19385



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V+ K G+  +      GRP P VTW K    L   AR S+   +   +L I  V ++D G
Sbjct: 27281 VIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTG 27340

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDS 255
              Y   + NG G+   S+ +S++ LD+
Sbjct: 27341 KYILTIENGVGEPK-SSTVSVKVLDT 27365



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 1256  LTVVDKPDPPAG--TPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA 1313
             +  +D   PP     P  +D   +S++L+W     +GGS V  Y IE+       W +  
Sbjct: 30024 IVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK-- 30081

Query: 1314  TCRSTSFNVQDLLPDH-----EYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVE 1367
              C +T   +++    H     EY+FRV A N  G  EP++      V E  E P  E++
Sbjct: 30082 -CNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELD 30139



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 88/408 (21%), Positives = 158/408 (38%), Gaps = 69/408 (16%)

Query: 179   RFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG 238
             R    I GRP P+V W + +   +   + S+   +   +L +  VN+ D G Y   V N 
Sbjct: 21879 RLFVPIKGRPAPEVKWARDHG--ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENS 21936

Query: 239   SGKASMSAELSIQGLDSANRSF---VRETKATNS---------DVRKEVTNVISKESKLD 286
             SG  S SA ++++ LD+        V+E   T+          D   ++ N I ++ +  
Sbjct: 21937 SG--SKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKREST 21994

Query: 287   SLEAAAKSKNCSSP-------QRGGSPPWAANSQPQP----PRESKLESCKDSPRTAP-- 333
                 +  + NC          Q G S  +   ++ +     P E+  ES K S R  P  
Sbjct: 21995 RKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETA-ESVKASERPLPPG 22053

Query: 334   QTPVLQKTSSSITLQAARVQPEPRAPGLGVL---SPSGEERKRPAPPRPATFPTRQPGLG 390
             +  ++  T +S++L   + + +  +  LG +      G ++         T  T   GL 
Sbjct: 22054 KITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATIT-GL- 22111

Query: 391   SQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSV 450
                +  +  + R+  + ++  + P+  S P   +                + + P+F  +
Sbjct: 22112 ---IQGEEYSFRVSAQNEKGISDPRQLSVPVIAKD---------------LVIPPAFKLL 22153

Query: 451   LKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCEA--GVAELHIQDALPE 507
                  V+ G+D  +     G P P +TW  +  P+ Q  R   E+    + L I+DA  E
Sbjct: 22154 FNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACRE 22213

Query: 508   DHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPI 555
             D G Y     N+ G+   +  V V +K             P  PT P+
Sbjct: 22214 DVGHYVVKLTNSAGEAIETLNVIVLDK-------------PGPPTGPV 22248



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 19/126 (15%)

Query: 129   KQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRP 188
             +QLG PV+++          +E +PS+  E P  F T      VK  +  +      GRP
Sbjct: 25380 RQLGVPVIARD---------IEIKPSV--ELP--FHT----FNVKAREQLKIDVPFKGRP 25422

Query: 189   QPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAEL 248
             Q  V W K    L+ + RV+VS    +  L I   +++DVG Y   V N +G  S++  +
Sbjct: 25423 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG--SITVPI 25480

Query: 249   SIQGLD 254
             +I  LD
Sbjct: 25481 TIIVLD 25486



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

Query: 106   CEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGEC--PPKF 163
             C  TN         ELT +  +  +    V ++   D  S P+  T P I  +   PP+ 
Sbjct: 25734 CNYTNIQETYFEVTELTEDQRYEFR----VFARNAADSVSEPSESTGPIIVKDDVEPPRV 25789

Query: 164   ATKL---GRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEI 220
                +     +VVK G++ + +  I GRP P ++W K  + ++  AR  +   +   +L +
Sbjct: 25790 MMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTV 25849

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
                 + D G Y   + N +G  S++    +
Sbjct: 25850 KDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 25879



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 38/158 (24%), Positives = 63/158 (39%), Gaps = 9/158 (5%)

Query: 1631  AVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPY 1690
             AV +  + S M   S +   KS        L++ +  +  ++  A LE  + E+      
Sbjct: 32495 AVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRK 32554

Query: 1691  FSKTI--------RDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
                T+        R + V EG +ARF C  +G P P V W +  Q +  S   Q+   + 
Sbjct: 32555 IKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTK- 32613

Query: 1743  GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
                +  IS V   D+  Y+    NS G+      L ++
Sbjct: 32614 YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 32651



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 38/132 (28%), Positives = 58/132 (43%), Gaps = 14/132 (10%)

Query: 546  VAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH--FE 603
            ++ S+     F   + + ++++G  VT   ++SG P P++ W  +G  I+  E +   F 
Sbjct: 1283 ISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFL 1342

Query: 604  QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS------- 656
            Q G + SL I  V PED G YT  A N  G       L V+       P +I        
Sbjct: 1343 QDG-RASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSR 1401

Query: 657  ----KPRSVTAS 664
                 PRSV+ S
Sbjct: 1402 IRSLSPRSVSRS 1413



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

Query: 1682 EEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVV--WFKDDQSIRESRHFQIDY 1739
            +++   KP+F K +  L +     A F+C++    DP +V  W  D + +  +   ++  
Sbjct: 1696 DKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRM-I 1754

Query: 1740 DEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            +E G CSL        D    TC+A N  G    +A LIV+
Sbjct: 1755 NEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVK 1795



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 1/92 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F K    LEV+ G    F   I G P  +V WF+  + + +     I Y ED    L 
Sbjct: 5893 PSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNI-YFEDTVAELE 5951

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            + ++      +YTC   N+ G+A+CT  L V+
Sbjct: 5952 LFNIDISQSGEYTCVVSNNAGQASCTTRLFVK 5983



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 9/182 (4%)

Query: 1194  GTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQ 1253
             G  P+T  ++  ++++      KV +     + T+    Q     + +   NK G  +  
Sbjct: 13515 GGSPLT-GYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 13573

Query: 1254  -----VNL-TVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANK 1307
                  VN+ T    PDPP       D  ++S+ L+W     DGGS ++ Y +E     + 
Sbjct: 13574 YVDEPVNMSTPATVPDPPENVKWR-DRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSD 13632

Query: 1308  TWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEV 1366
              W         T   V  L     Y +RV+A+N  G S+PS+ +E     +  E P+  +
Sbjct: 13633 KWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFL 13692

Query: 1367  EV 1368
             +V
Sbjct: 13693 DV 13694



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             VT  +G +V +     G P P++ WL+DG  L K++      + E+  TL +K  +  H 
Sbjct: 27573 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPL-KESEFVRFSKTENKITLSIKNAKKEHG 27631

Query: 721   GQYEILLKNRVGECSCQVSLMLQNSSARALPRG 753
             G+Y ++L N V  C   V + +      + P+G
Sbjct: 27632 GKYTVILDNAV--CRIAVPITVITLGPPSKPKG 27662



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 17/144 (11%)

Query: 506   PEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLP----VAPSKPTAPIFLQGLS 561
             P D   +  +A NA+G +S            S+ S  ++     V P     P +  GL 
Sbjct: 27920 PGDRYEFRIIARNAVGTIS----------PPSQSSGIIMTRDENVPPIVEFGPEYFDGLI 27969

Query: 562   DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
                +  G  + +   V G P P V W  +G EI++  +          SL +++   +  
Sbjct: 27970 ---IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHR 28026

Query: 622   GTYTCEAWNSAGEVRTQAVLTVQE 645
             G YT EA N++G  + +  + VQ+
Sbjct: 28027 GVYTVEAKNASGSAKAEIKVKVQD 28050



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 1683 EKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
            ++  + P F++ ++D+E   G      C++ G    +V W++D   +R+  + Q  +  D
Sbjct: 6169 QERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSF-VD 6227

Query: 1743 GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAEL 1777
               +L I         +Y+C A N LG A+ +A L
Sbjct: 6228 NVATLKILQTDLSHSGQYSCSASNPLGTASSSARL 6262



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 117/571 (20%), Positives = 206/571 (36%), Gaps = 81/571 (14%)

Query: 158   ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQV 217
             E  P F  KL      E       C+++      V W K    + PS + S+      ++
Sbjct: 11660 EADPYFTVKLHDKTAVEKDEITLKCEVS--KDVPVKWFKDGEEIVPSPKYSIKADGLRRI 11717

Query: 218   LEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDS---ANRSFVRET-----KATNS 269
             L+I   +  D G Y C       KA+++ E  +  ++        FV ET     + +  
Sbjct: 11718 LKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEP 11777

Query: 270   DVR---KEVTNVISKESKLDSLEAAAKS----KNCSSPQRGGSPPWAANSQPQPPRESK- 321
             DV    K     ++     + +E   K      NC     G     AAN++     + K 
Sbjct: 11778 DVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKE 11837

Query: 322   LESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPAT 381
             L     +P +     V +K  +    + +R +P+      G    +G++R          
Sbjct: 11838 LPLIFITPLS--DVKVFEKDEAKFECEVSR-EPKTFRWLKGTQEITGDDR---------- 11884

Query: 382   FPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVM 441
             F   + G     V+  AA          D A   FE++       ++ + K   EG+ + 
Sbjct: 11885 FELIKDGTKHSMVIKSAA--------FEDEAKYMFEAE------DKHTSGKLIIEGIRLK 11930

Query: 442   EVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELHI 501
              + P     LKD    E +  V    +    + R+ W  N Q +   RS        + +
Sbjct: 11931 FLTP-----LKDVTAKEKESAVFTVELSHDNI-RVKWFKNDQRLHTTRS--------VSM 11976

Query: 502   QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
             QD       T+  L+ +   Q+   A            SE  L V       P F   L 
Sbjct: 11977 QDEGKTHSITFKDLSIDDTSQIRVEA--------MGMSSEAKLTVLEGD---PYFTGKLQ 12025

Query: 562   DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
             D   ++  +V +  ++S    P V W  +G EI+ S++   +  G +  L +++    D 
Sbjct: 12026 DYTGVEKDEVILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDI 12084

Query: 622   GTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFP 681
             G YTC+     G  +T   L +++     +   +    SV     ++      I+ D   
Sbjct: 12085 GQYTCD----CGTDKTSGKLDIED----REIKLVRPLHSVEVMETETARFETEISEDDI- 12135

Query: 682   TVHWLRDGKALCKDTGHFEVLQNEDVFTLVL 712
               +W   G+AL + T   E+ +   + +LVL
Sbjct: 12136 HANWKLKGEALLQ-TPDCEIKEEGKIHSLVL 12165



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCR 1316
             +++P PP     +SD   SS+ L W     DGGS +  Y IE  +     W    +    
Sbjct: 13289 IERPSPPVNLT-SSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVP 13347

Query: 1317  STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1371
               ++ V  L   ++Y +RV A N  G S+PS+     T  +   EP  ++    D
Sbjct: 13348 ELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKD 13402



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 7/133 (5%)

Query: 505   LPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPS-KPTAPIFLQGLSDL 563
             +P++  T T L E A  Q    A   V+    S  S+ +  +A +  P   + +   S L
Sbjct: 19246 IPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLL 19305

Query: 564   KVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFP---ED 620
              V  G+ V +   V G P P V W  +G  ++ +E     +   Q +LC  E+F    +D
Sbjct: 19306 TVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGI---KMAMQRNLCTLELFSVNRKD 19362

Query: 621   TGTYTCEAWNSAG 633
             +G YT  A NS+G
Sbjct: 19363 SGDYTITAENSSG 19375



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 25/82 (30%), Positives = 36/82 (43%)

Query: 171   VVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGV 230
             + KE    R    I G+P P V+W KG  PL    RVSV        L ++   + D G 
Sbjct: 19993 LAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGK 20052

Query: 231   YTCLVVNGSGKASMSAELSIQG 252
             YT  + N +G    +  + + G
Sbjct: 20053 YTITLKNVAGTKEGTISIKVVG 20074



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 29    LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
             LT  P+  LP     I+ G   K E  V G P P ++W ++G+P+    R  ++     T
Sbjct: 24308 LTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATST 24367

Query: 89    FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
               L I   +++D GKYT  ATN +G     + + V
Sbjct: 24368 V-LHIKEGNKDDFGKYTVTATNSAGTATENLSVIV 24401



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 1/119 (0%)

Query: 1662  NAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVV 1721
             NA    S    S   +    E  P +  +  +    L +  G + R    ++G P P V 
Sbjct: 27932 NAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVT 27991

Query: 1722  WFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             WFKD   I +  + +I  D  G+ SL + D   D    YT +A N+ G A    ++ V+
Sbjct: 27992 WFKDGVEIEKRMNMEIT-DVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA---TCRST 1318
             P PP G P         + + W     DGG+ + +Y ++  +  +  W  +        T
Sbjct: 29240 PSPP-GIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDT 29298

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                V  L+   +Y+FRV A+N  G SEPS+ S   +  E    P
Sbjct: 29299 RLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTP 29342



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 4     VKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQ 63
             V +   S  S++   ++P     +P  E    +   + + I+ GA+ +    V G P P 
Sbjct: 29420 VNVKGMSEYSESIAEIEPVERIEIPDLELADDL--KKTVTIRAGASLRLMVSVSGRPPPV 29477

Query: 64    VTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
             +TW + G  + S  R ++D        L++  V+  D GKYT EA N SG +  TV + V
Sbjct: 29478 ITWSKQGIDLAS--RAIIDT-TESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKV 29534



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 104/465 (22%), Positives = 165/465 (35%), Gaps = 67/465 (14%)

Query: 115   RQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKL-----GR 169
             RQ TV+   EG+  K     V +   G     P  ET+P    E     A +L     G 
Sbjct: 15059 RQYTVKEIREGADYKLRVSAVNAAGEG-----PPGETQPVTVAEPQEPPAVELDVSVKGG 15113

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             + +  G+  R    +TGRP P   W K    L    RV +        L I    + D G
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKD-RVVIDNVGTKSELIIKDALRKDHG 15172

Query: 230   VYTCLVVNGSGKASMSAE----------LSIQGLDSANRSFVRETKATNSDVRKEVTNVI 279
              Y     N  G    +A           L ++ + +  +  +        D   E+T  I
Sbjct: 15173 RYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFI 15232

Query: 280   --SKESKLDS----LEAAAKSKNCSSPQRGGSPPWAANSQPQ----PPRESKLESCKD-- 327
                K++K+ +    +E      + +    G    +   ++ +    PP E       D  
Sbjct: 15233 IERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPL 15292

Query: 328   SPRTAPQT-PVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPP-----RPAT 381
              P T+P+     ++T S+ITL       EPR+ G   +     E++R   P         
Sbjct: 15293 GPPTSPERLTYTERTKSTITLD----WKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL 15348

Query: 382   FPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVM 441
              PT    + + D   +    R+    +   + P        Q+ +   T+K R       
Sbjct: 15349 CPTTSFLVENLDE-HQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRL------ 15401

Query: 442   EVAPSFSSVLKDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEA------ 494
                    SV  D   ++ G+   +   V G P+P+I W  N   I+      +       
Sbjct: 15402 -------SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVS 15454

Query: 495   ---GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKS 536
                   EL I  A+ ED GTYT  A N LG V  +  V V+++ S
Sbjct: 15455 RSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPS 15499



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 109/532 (20%), Positives = 188/532 (35%), Gaps = 89/532 (16%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             L I+ G      GR  G P+P+V+W ++   +    R  +      T +L        D 
Sbjct: 16828 LTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKT-TPATLALEKIKAKRSDS 16886

Query: 102   GKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPP 161
             GKY     N +G+R+   ++ V       +G     +   D      +  +P +      
Sbjct: 16887 GKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYM---VISWKPPL-----D 16938

Query: 162   KFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLK-GNVPLQPSARVSVSEKNGMQVLEI 220
                +K+   ++++ ++G+              W+   +   + + +VS   +    +  I
Sbjct: 16939 DGGSKITNYIIEKKEVGKD------------VWMPVTSASAKTTCKVSKLLEGKDYIFRI 16986

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNS--------DVR 272
             H  N    G+   LV +     SM A+   +  D+ ++  V E    ++        D  
Sbjct: 16987 HAENL--YGISDPLVSD-----SMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGG 17039

Query: 273   KEVTNVISKESKLDSLEAAAKSKN----------------CSSPQRGGSPPWAANSQPQP 316
             K +TN I ++ +  S   A  +K+                C    R  +        P P
Sbjct: 17040 KPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSP 17099

Query: 317   PRE---SKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGV-LSPSGEERK 372
             P +   +K    K SP   P+       S  +T Q  R     +  G  V     G+E  
Sbjct: 17100 PSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEW 17159

Query: 373   RPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKF---------ESKPQSQ 423
             R A   P + P                  +  + G RD    KF         ES P   
Sbjct: 17160 RRANHTPESCP----------------ETKYKVTGLRDGQTYKFRVLAVNAAGESDPA-- 17201

Query: 424   EVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ 483
              V E   VK R E   ++  A    ++ ++  +  G    L   ++G P P++TW    +
Sbjct: 17202 HVPEPVLVKDRLEPPELILDA----NMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDR 17257

Query: 484   PIQY-ARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEK 534
                  AR       ++L I++A  ED G Y+   EN  G  + S  V V +K
Sbjct: 17258 DAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDK 17309



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 74/370 (20%), Positives = 134/370 (36%), Gaps = 58/370 (15%)

Query: 1042  EGKKLLLQCQVSS-DPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYK 1100
             EG  +   C++ + D    + W    + L+ ++   ++ E  +  + ++     D G Y+
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 31640

Query: 1101  CVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKK-KPAP 1159
             C   ND G+     ++ V         +  +   RR               T+KK K   
Sbjct: 31641 CKVVNDYGEDSSYAELFVKGV-----REVYDYYCRR---------------TMKKIKRRT 31680

Query: 1160  KTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK--- 1216
              T      PP+      ++    GE+V     +T       TW K  ++I+  ++ K   
Sbjct: 31681 DTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYT 31740

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP----------- 1265
              E+ +   +LTI +   +    YT++  NK G    +  LTV   P P            
Sbjct: 31741 FESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRL 31800

Query: 1266  -------AGTPCASDIRSSSL---TLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC 1315
                     G     +IR S +   TL W     DG       +IEI       +      
Sbjct: 31801 LANAECQEGQSVCFEIRVSGIPPPTLKW---EKDGQPLSLGPNIEIIHEGLDYY------ 31851

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKE 1375
                + +++D LP+    +RV A N  G++      ++  +  K +E K + E     +K+
Sbjct: 31852 ---ALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQ 31908

Query: 1376  PEVDYRTVTI 1385
              +   R   I
Sbjct: 31909 IDKTLRMAEI 31918



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 47/217 (21%), Positives = 87/217 (40%), Gaps = 29/217 (13%)

Query: 1582 CYILNRLDCTQCLQH------PWLMKDTKNMEAKKLSKDRMKKYMARR-----KWQKTGN 1630
            C   N+    QC  H      P+ ++  ++ +    ++ ++K  +        KW K   
Sbjct: 4747 CSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNK 4806

Query: 1631 -----AVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV--AEE 1683
                 A R++ +  +   +   + + + +G+    L+        DV  A  +A    +E
Sbjct: 4807 ELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLS-------NDVGTATSKATLFVKE 4859

Query: 1684 KPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG 1743
             P    +  K    L +  G +  F+C+I G P   V W+ D   I   +   I +  DG
Sbjct: 4860 PPQ---FIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISF-IDG 4915

Query: 1744 NCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
              +  IS    ++   Y C+A N  G A+C+ EL V+
Sbjct: 4916 LATFQISGARVENSGTYVCEARNDAGTASCSIELKVK 4952



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 23/95 (24%), Positives = 51/95 (53%), Gaps = 2/95 (2%)

Query: 1687 VKPYFSKTIRD-LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNC 1745
            + P F+K + + +E  EG++ + + ++ G     V W+K++  I+ + + +I + ++   
Sbjct: 8247 IPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITF-KNNTL 8305

Query: 1746 SLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             L +     +D   YTCK  N  G A CT+ ++++
Sbjct: 8306 VLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIK 8340



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 37    LPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAV 96
             LP      KE +  + +  ++G P P V+W +   P+ +  R  ++     T +L+++  
Sbjct: 19987 LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNT-TLIVYDC 20045

Query: 97    HEEDRGKYTCEATNGSGARQVTVELTVEG 125
              + D GKYT    N +G ++ T+ + V G
Sbjct: 20046 QKSDAGKYTITLKNVAGTKEGTISIKVVG 20074



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 34/121 (28%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

Query: 1648  SGRKSSTGSPTSPLNAEKLESE----EDVSQAFLEAVAEEKPHVKPYFSKTIRDLE-VVE 1702
             S ++  +  P+ P      E++    E V    + A  +    +K   SK I  L  VVE
Sbjct: 32681 SPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVE 32740

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTC 1762
              S  R           EV W+KD + ++E+ HFQ  Y  DG   L I+++   D  +Y C
Sbjct: 32741 SSVLRAK---------EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVC 32791

Query: 1763  K 1763
             +
Sbjct: 32792 E 32792



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 1035 LQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPE 1094
            L+DV+V EG K +L+C+VS     ++ W LN + +K    +    +G+   + I +    
Sbjct: 2451 LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHAS 2510

Query: 1095 DRGLYKCVAKNDAGQAECSCQVTVD 1119
            D G YK +     G+ E +C ++V+
Sbjct: 2511 DEGPYKLI----VGRVETNCNLSVE 2531



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKD-DQSIRESRHFQIDYDEDGNCSL 1747
            P F K + D   + G A      +EG+    VVW KD  + IRES + +I +  D   +L
Sbjct: 6551 PRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISF-IDNIATL 6609

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             +      +  KY C+  N  G   C+A L V
Sbjct: 6610 QLGSPEASNSGKYICQIKNDAGMRECSAVLTV 6641



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 1/102 (0%)

Query: 1679 AVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQID 1738
            ++  ++P   P F + +  + V EG   +  C ++G     + W K  + I+ S      
Sbjct: 8336 SIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFS 8395

Query: 1739 YDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            +   G   L + DV   D   Y CKA N  G  T  +++ ++
Sbjct: 8396 F-ASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIK 8436



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 1685  PHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGN 1744
             PHV+  F + + DL+V E   ARF+C++    + +V WFKD   I++ + + I   +   
Sbjct: 12372 PHVE--FLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDI-ISKGAV 12427

Query: 1745  CSLIISDVCGDDDAKYTCK 1763
               L+I+    DD+A+Y+C+
Sbjct: 12428 RILVINKCLLDDEAEYSCE 12446



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 440   VMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGV 496
             ++E  P +   L    +  G+   ++  V+G PVPR+TW  +G  I+   +   T   G 
Sbjct: 27957 IVEFGPEYFDGL---IIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS 28013

Query: 497   AELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHE 533
               L ++DA  +  G YT  A+NA G       V V +
Sbjct: 28014 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQD 28050



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 88/439 (20%), Positives = 162/439 (36%), Gaps = 71/439 (16%)

Query: 263   ETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQ-----RGGSPPWAA------- 310
             E     S  ++EVT +   E + +  + A +  + S+ +     R  SP +         
Sbjct: 32229 EKSRKKSRRQREVTEITEIEEEYEISKHAQRESSSSASRLLRRRRSLSPTYIELMRPVSE 32288

Query: 311   --NSQPQPPRESKLESCKDSP---RTAPQTP--VLQKTSSSITLQAARVQPEPRAPGLGV 363
                S+PQP  E + ++ + SP   RT P++P  V  + S S   ++AR     R   +  
Sbjct: 32289 LIRSRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKA 32348

Query: 364   L---SPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420
                   + E +      +P T         +  +  +  + R+P  GQ        +SKP
Sbjct: 32349 ALKTQKTSERKYEVLSQQPFTLDH------APRITLRMRSHRVPC-GQNTRFILNVQSKP 32401

Query: 421   QSQ--------EVKENQTVKF-RCEGLAVME--------------VAPSFSSVLKDCAVI 457
              ++        E++E+  + +    G+  +E              V  ++     D A +
Sbjct: 32402 TAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATL 32461

Query: 458   E--GQDFVLQCSVR-GTPVPRITWLLNGQPIQYARST------CEAGVAELHIQDALPED 508
             +  G D+    S R    VPR  +    +   YA S+       EA  +   ++  + E 
Sbjct: 32462 DVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTET 32521

Query: 509   HGTYTCLAENALGQVSCSAWV--TVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM 566
               + +    +A  ++  +A    ++ EK ++RK +  L        A   L     + V 
Sbjct: 32522 RESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTL--------AARILTKPRSMTVY 32573

Query: 567   DGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTC 626
             +G     +    G P P V WL  G  +  S          + +  I  V   D G Y+ 
Sbjct: 32574 EGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSV 32633

Query: 627   EAWNSAGEVRTQAVLTVQE 645
                NS G+   +  LT+Q+
Sbjct: 32634 VVENSEGKQEAEFTLTIQK 32652



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 1683 EKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
            E  H++  F K I+D++V+E   A F+C++   PD  V W KDDQ ++ +   +I  ++ 
Sbjct: 3054 EARHIE--FRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKY 3110

Query: 1743 GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             +  L+I      D  KYT  A    G    TA+L VE
Sbjct: 3111 VH-RLLIPSTRMSDAGKYTVVA----GGNVSTAKLFVE 3143



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 1/92 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F +T   +EV+ G +  F   I G P  +V WFK  + +       I   ED    L 
Sbjct: 6834 PSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISL-EDFVTELE 6892

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            + +V   +   Y+C   N  G A+CT  L V+
Sbjct: 6893 LFEVQPLESGDYSCLVTNDAGSASCTTHLFVK 6924



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 565   VMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTY 624
             +  G  + + + V G P P + W+ +G  ++++   + E+  T   L I+E   +D G Y
Sbjct: 24323 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 24382

Query: 625   TCEAWNSAG-EVRTQAVLTVQEP 646
             T  A NSAG      +V+ +++P
Sbjct: 24383 TVTATNSAGTATENLSVIVLEKP 24405



 Score = 45.1 bits (105), Expect = 6e-04
 Identities = 57/219 (26%), Positives = 87/219 (39%), Gaps = 16/219 (7%)

Query: 1159  PKTPPKAAMPPQIIQFPED-QKVRAGESVELFGKVTGTQPITCTWM--KFRKQIQESEHM 1215
             P  PP A   P++     +   +R  E         G   I   W+  K R  I   +  
Sbjct: 28837 PFVPPSAPTRPEVYHVSANAMSIRWEEPYH-----DGGSKIIGYWVEKKERNTILWVKEN 28891

Query: 1216  KVENSENGSKLTILAARQEH-CGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDI 1274
             KV   E   K+T L    E+    Y L       + +A   +   +  D P G P  +D+
Sbjct: 28892 KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAP-GRPEVTDV 28950

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIE---IWDSANKTWKE--LATCRSTSFNVQDLLPDH 1329
               S+++L W   +YDGGS V  Y IE   + +  +  W +          F V  L    
Sbjct: 28951 TRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGD 29010

Query: 1330  EYKFRVRAINVYGT-SEPSQESELTTVGEKPEEPKDEVE 1367
              Y+FRV A N  G  S+ S+ +   T  ++   PK E++
Sbjct: 29011 TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELD 29049



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 41/156 (26%), Positives = 64/156 (41%), Gaps = 6/156 (3%)

Query: 587   WLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEP 646
             W+ +G+ I+ES    F   G    L I +V   D G YTC       E  + A L V+E 
Sbjct: 11151 WMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 11210

Query: 647   HDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNED 706
                   +  +    VT   GQ + +SC +  +    V W +DGK + +  G         
Sbjct: 11211 ---PVRFVKTLEEEVTVVKGQPLYLSCELNKE--RDVVWRKDGKIVVEKPGRIVPGVIGL 11265

Query: 707   VFTLVLKKVQPWHAGQYEILLKNRVG-ECSCQVSLM 741
             +  L +       AG Y + ++N    ECS  V ++
Sbjct: 11266 MRALTINDADDTDAGTYTVTVENANNLECSSCVKVV 11301



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 4/112 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC----RS 1317
             P  P G P   D+  S+++L W    +DGGS +  Y +E        W    T       
Sbjct: 19189 PVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQ 19248

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
               +    L    +Y+FR  A      S PS+ S+  T+  +   P+ ++ V+
Sbjct: 19249 EEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVA 19300



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQN-EDVFTLVLKKVQPWHAGQYE 724
             G SV +   I+G P PT+ W +D K L   T     ++N  D+ ++++K     ++G YE
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKDDKEL--QTNALVCVENTTDLASILIKDADRLNSGCYE 26944

Query: 725   ILLKNRVGECSCQVSLML 742
             + L+N +G  S  + + +
Sbjct: 26945 LKLRNAMGSASATIRVQI 26962



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 183/961 (19%), Positives = 338/961 (35%), Gaps = 154/961 (16%)

Query: 180   FSCKITGRPQPQVTWLKG--NVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVN 237
             F+C I  +  P + W KG   +P +P+ +  +        L+I     +D+  Y   +  
Sbjct: 11325 FACDIA-KDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEG 11383

Query: 238   GSGKASMS-AELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKN 296
                 A ++  E  ++ L       + E ++ + D      + I  + KL   E    S  
Sbjct: 11384 KRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEAD-IPGQWKLKG-ELLRPSPT 11441

Query: 297   CSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEP 356
             C     GG      +          L    ++  TA  T    +   ++ L+   V    
Sbjct: 11442 CEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERR 11501

Query: 357   RAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQR------D 410
             +A    VL+          P                D++  +    I  +G++      D
Sbjct: 11502 QARFECVLTREANVIWSKGP----------------DIIKSSDKFDIIADGKKHILVIND 11545

Query: 411   SAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRG 470
             S F   +    + EV+  +T       L V  +   F S L+D  V EG+     C +  
Sbjct: 11546 SQFD--DEGVYTAEVEGKKT----SARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSH 11599

Query: 471   TPVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVT 530
               +  + W  N   +  +R+   +   + H  +           + E  L  +S      
Sbjct: 11600 EKM-HVVWFKNDAKLHTSRTVLISSEGKTHKLE-----------MKEVTLDDIS-QIKAQ 11646

Query: 531   VHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHN 590
             V E  S+ + + L          P F   L D   ++  ++T+  +VS + P  V W  +
Sbjct: 11647 VKELSSTAQLKVL-------EADPYFTVKLHDKTAVEKDEITLKCEVSKDVP--VKWFKD 11697

Query: 591   GNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWN--SAGEVRTQA-VLTVQEPH 647
             G EI  S  +  +  G +  L I++   +D G Y C+     +   V  +A ++ V++P 
Sbjct: 11698 GEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPL 11757

Query: 648   DGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVH--WLRDGKALCKDTGHFEVLQNE 705
              G +  F+ +       L +             P VH  W   G+ L       E++++ 
Sbjct: 11758 YGVEV-FVGETAHFEIELSE-------------PDVHGQWKLKGQPLTASPD-CEIIEDG 11802

Query: 706   DVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS-----LMLQNSSARALPR-------- 752
                 L+L   Q    G+      N     + +V       +   S  +   +        
Sbjct: 11803 KKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECE 11862

Query: 753   -GREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETR 811
               REP +   L G     +  G DR+  ++ G   +    ++    ED    +    +  
Sbjct: 11863 VSREPKTFRWLKGT---QEITGDDRFELIKDG--TKHSMVIKSAAFEDEAKYMFEAED-- 11915

Query: 812   QHTE-----EAIRQQEVEQLDFRDLLGKK----VSTKTLSEDDLKEIPAEQMDFRANLQR 862
             +HT      E IR + +  L  +D+  K+    V T  LS D+++      + +  N QR
Sbjct: 11916 KHTSGKLIIEGIRLKFLTPL--KDVTAKEKESAVFTVELSHDNIR------VKWFKNDQR 11967

Query: 863   QVKPKTVS-EEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKK 921
                 ++VS ++E K HS   + F+  L+   TS+  V                 +  + K
Sbjct: 11968 LHTTRSVSMQDEGKTHS---ITFKD-LSIDDTSQIRVEAMG-------------MSSEAK 12010

Query: 922   LPAENGSS--SAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLK 979
             L    G    + +  +   VE  + +   + S    PV   K  + +KP  NA       
Sbjct: 12011 LTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAV------ 12064

Query: 980   PMGNAKPDENLKSASKEE---LKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQ 1036
                       +K+  K+    LKK +K+D+       GT     + + +       + L 
Sbjct: 12065 ----------IKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH 12114

Query: 1037  DVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDR 1096
              V V E +    + ++S D      W L G+ L  T    + +EG + S+ +     +  
Sbjct: 12115 SVEVMETETARFETEISED-DIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQT 12173

Query: 1097  G 1097
             G
Sbjct: 12174 G 12174



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS--LVIHAVHEE 99
             L +K G T +F   +RG P P   W  +G  I +   + ++      FS  L I      
Sbjct: 17520 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE---TDNFSSVLTIKNCLRR 17576

Query: 100   DRGKYTCEATNGSGARQVTVELTV 123
             D G+Y    +N +G++ V V LTV
Sbjct: 17577 DTGEYQITVSNAAGSKTVAVHLTV 17600



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 2/123 (1%)

Query: 532   HEKKSSRKSEYLLPV-APSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHN 590
             +EK  S   +  +PV A      P F    +   V+ G  + + V   G P P V W  +
Sbjct: 22125 NEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKD 22184

Query: 591   GNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE-VRTQAVLTVQEPHDG 649
                ++++   + E       L I++   ED G Y  +  NSAGE + T  V+ + +P   
Sbjct: 22185 NVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPP 22244

Query: 650   TQP 652
             T P
Sbjct: 22245 TGP 22247



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 81/396 (20%), Positives = 141/396 (35%), Gaps = 56/396 (14%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             VV++     R    I GRP+P+V W K    L   A++ V+  +   +L I  V + D G
Sbjct: 25117 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVT--SSFTMLVIDNVTRFDSG 25174

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSF---VRETKATN---------SDVRKEVTN 277
              Y   + N SG  S +A ++++ LDS +      +RE K  +          D   ++TN
Sbjct: 25175 RYNLTLENNSG--SKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITN 25232

Query: 278   VISKESKLDSLEAAAKSKNCSSP-------QRGGSPPWAANSQPQPPRESKLESCKDSPR 330
              I ++ +      A  + NC+         Q G S  +   +  +       E+ +    
Sbjct: 25233 YIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKV 25292

Query: 331   TAPQTPVLQKTSSSITLQAARVQPE-------PRAPGLGVLSPSGEERKRPAPPRPATFP 383
             + P  P  + T   +T   A ++ E        +  G  V   +    K     +  T  
Sbjct: 25293 SEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLE 25352

Query: 384   TRQPGL--GSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVM 441
                 GL  G + V   AA         R    P      +  E+K +  + F    +   
Sbjct: 25353 ATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVI---ARDIEIKPSVELPFHTFNVKAR 25409

Query: 442   EVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ---YARSTCEAGVAE 498
             E                     +    +G P   + W  +GQ ++       +    V  
Sbjct: 25410 E------------------QLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTS 25451

Query: 499   LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEK 534
             L I++A  ED GTY     N+ G ++    + V ++
Sbjct: 25452 LSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 25487



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 23/78 (29%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 1698 LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
            + V  G     +CK+ G P+  V W+KD + +  S+  +  +  +   SL I  V   D 
Sbjct: 5713 MTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSF-YNKISSLRILSVERQDA 5771

Query: 1758 AKYTCKAVNSLGEATCTA 1775
              YT +  N++G+++CTA
Sbjct: 5772 GTYTFQVQNNVGKSSCTA 5789



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 1698 LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
            ++V  G     +C + G P+    WFKD + +     ++I +    +  L I +V   D 
Sbjct: 7595 IKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVS-GLKIINVAPSDS 7653

Query: 1758 AKYTCKAVNSLGEATCTAELIV 1779
              Y+ +  N +G+ +CTA L V
Sbjct: 7654 GVYSFEVQNPVGKDSCTASLQV 7675



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 1/92 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P F +    ++V+ G+   F   ++G P   V WFK    +       +   ED    L 
Sbjct: 7775 PSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSL-EDSVAELE 7833

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            + DV      +YTC   N  G+A+CT  L ++
Sbjct: 7834 LFDVDTSQSGEYTCIVSNEAGKASCTTHLYIK 7865



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 160   PPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
             PPK      ++ +K G+  R    + G+P P   W KG   +  S+ ++V + +   +L 
Sbjct: 18899 PPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILI 18957

Query: 220   IHGVNQDDVGVYTCLVVNGSG 240
             I  V + D G Y+    N SG
Sbjct: 18958 IKDVTRKDSGYYSLTAENSSG 18978



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 112/518 (21%), Positives = 191/518 (36%), Gaps = 68/518 (13%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLD-CGIRGTFSLVIHAVHEEDRG 102
             I+ G+    +  V G PEP++ W +  + +    +  L   G R T   VI      D G
Sbjct: 29059 IRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT--AVIKFCDRSDSG 29116

Query: 103   KYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR----FSAPAVETRPSIWGE 158
             KYT    N SG + V+V + V  S     G+  VS+   ++    +S P  +    I   
Sbjct: 29117 KYTLTVKNASGTKAVSVMVKVLDS-PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHY 29175

Query: 159   CPPKFATKLGRVVVKEGQMGRFSCKITGRPQP-----QVTWLKGNVPLQPSARVSVSEKN 213
                +  T     V+ EG+    S  +T   +      +V  +    P  P     +  +N
Sbjct: 29176 IVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARN 29235

Query: 214   GMQVLEIHGVNQD-DVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNS--- 269
                +    G+ ++   G    ++     ++    E+S   +D   +  +R T+       
Sbjct: 29236 SFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVV 29295

Query: 270   -DVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKD- 327
              D R +VT+++               + C    R  +   A NS+P     S   SC++ 
Sbjct: 29296 YDTRLKVTSLM---------------EGCDYQFRVTAVNAAGNSEPS--EASNFISCREP 29338

Query: 328   ----SPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEER-------KRPAP 376
                  P +AP+  V+  T  SI+L   +   +     +G +    E+           A 
Sbjct: 29339 SYTPGPPSAPR--VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNAT 29396

Query: 377   PRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCE 436
              R   F      +G +     AA   + ++G  +           S+ + E + V+ R E
Sbjct: 29397 IRNTEFTVPDLKMGQKYSFRVAA---VNVKGMSE----------YSESIAEIEPVE-RIE 29442

Query: 437   GLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGV 496
              +  +E+A     + K   +  G    L  SV G P P ITW   G  +           
Sbjct: 29443 -IPDLELA---DDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTES 29498

Query: 497   AELHIQDALPE-DHGTYTCLAENALGQVSCSAWVTVHE 533
               L I D +   D G YT  AEN  G+ S +  V V++
Sbjct: 29499 YSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 29536



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 1/92 (1%)

Query: 1688 KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSL 1747
            KP+F K +  ++         +C+++      V W KD Q +   + ++I + ED   +L
Sbjct: 3643 KPHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICF-EDKIATL 3701

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             I      D   Y C A N  G ++C+A + V
Sbjct: 3702 EIPLAKLKDSGTYVCTASNEAGSSSCSATVTV 3733



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

Query: 4     VKLVASSHISKTSLSVDP---SRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60
             VK V ++ +SK S +V P    R D  P  +   F+       ++EG       +++G P
Sbjct: 16091 VKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFME------VEEGTNVNIVAKIKGVP 16144

Query: 61    EPQVTWHR-------NGQPI---TSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATN 110
              P +TW +       N +P+   T   + ++D     T +LVI      D G YT  A N
Sbjct: 16145 FPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVD----DTCTLVIPQSRRSDTGLYTITAVN 16200

Query: 111   GSGARQVTVELTVEG 125
               G     + L V G
Sbjct: 16201 NLGTASKEMRLNVLG 16215



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 1690 YFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLII 1749
            + +KT++++EV E   A F+C++  +  P  +W K+   I  S  F+I      +  LII
Sbjct: 2883 HITKTMKNIEVPETKTASFECEVSHFNVPS-MWLKNGVEIEMSEKFKIVVQGKLH-QLII 2940

Query: 1750 SDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEE 1793
             +   +D A+YT    N    AT T   I+ T    +   EE++
Sbjct: 2941 MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKD 2984



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 1698  LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDE-------DGNCSLIIS 1750
             +EV EG+      KI+G P P + WFK      +++   + YD        D  C+L+I 
Sbjct: 16126 MEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKE-PVLYDTHVNKLVVDDTCTLVIP 16184

Query: 1751  DVCGDDDAKYTCKAVNSLGEAT 1772
                  D   YT  AVN+LG A+
Sbjct: 16185 QSRRSDTGLYTITAVNNLGTAS 16206



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 7/118 (5%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             + V+ GQ  R   ++ GRP+P +TW K    L    RV + +      L+I    + D G
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 17977

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDS 287
              Y     N SG A  SA +++  LD       +  K TN  V KE    IS E+ LD+
Sbjct: 17978 KYIISAKNSSGHAQGSAIVNV--LDRPGP--CQNLKVTN--VTKE-NCTISWENPLDN 18028



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 1/102 (0%)

Query: 1678  EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQI 1737
             E V E K  + P        + +  G   R +  + G P P   W K +  +  S H  +
Sbjct: 18888 EGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV 18947

Query: 1738  DYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              +  D +  LII DV   D   Y+  A NS G  T   +++V
Sbjct: 18948 -HKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 36/121 (29%), Positives = 49/121 (40%), Gaps = 7/121 (5%)

Query: 1662  NAEKLESEEDVSQAFLEAVAEEKP---HVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDP 1718
             NA  + SE   S   + A  E  P    + P +  TI    V  G + + D  I G P P
Sbjct: 22517 NAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTI---VVHAGESFKVDADIYGKPIP 22573

Query: 1719  EVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELI 1778
              + W K DQ +  +   +I    D   SL + D    D   Y  KA N  GE + T  + 
Sbjct: 22574 TIQWIKGDQELSNTARLEIK-STDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVK 22632

Query: 1779  V 1779
             V
Sbjct: 22633 V 22633



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFN 1321
             P PP      S +   S+TL W     DGGS +  Y IE  +  +  W  +         
Sbjct: 25983 PSPPTSLEITS-VTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLR 26041

Query: 1322  VQD--LLPDHEYKFRVRAINVYGTSEPSQESEL 1352
             V+   L    EY++RV A N  G S PS+ S L
Sbjct: 26042 VKSTGLREGCEYEYRVYAENAAGLSLPSETSPL 26074



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 57/243 (23%), Positives = 94/243 (38%), Gaps = 58/243 (23%)

Query: 1025 QGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATII--WTLNGKTLKTT-KFIILSQEG 1081
            +G    F ++LQD+ V E     L+C VS   P  I   W  N   LK+  K+ I S+ G
Sbjct: 2263 EGAVVEFVKELQDIEVPESYSGELECIVS---PENIEGKWYHNDVELKSNGKYTITSRRG 2319

Query: 1082 SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSL 1141
               +++++    ED+G Y  V                                       
Sbjct: 2320 RQ-NLTVKDVTKEDQGEYSFV--------------------------------------- 2339

Query: 1142 PPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCT 1201
              + G ++   +K KP P           I+Q   DQKV  G+ V+L  KV+  + +   
Sbjct: 2340 --IDGKKTTCKLKMKPRPIA---------ILQGLSDQKVCEGDIVQLEVKVS-LESVEGV 2387

Query: 1202 WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
            WMK  +++Q S+ + +   +    L I    +E  G Y+  +     S   +V++  VD 
Sbjct: 2388 WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV 2447

Query: 1262 PDP 1264
              P
Sbjct: 2448 ITP 2450



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 10/98 (10%)

Query: 1691  FSKTIRDLEVVE----GSAARFDCKIEGYPDPEVV-WFKDDQSIRES-RHFQIDYDEDGN 1744
             F K I+D+ + E    GS+A F+C +   P   +  W KD  +IRES +H  I   +D  
Sbjct: 11117 FVKEIKDIILTESEFVGSSAIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKDRK 11174

Query: 1745  CSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETM 1782
               +I  DV   D  +YTC       E T TA+L+VE +
Sbjct: 11175 LHII--DVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 11210



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 33/143 (23%), Positives = 57/143 (39%), Gaps = 12/143 (8%)

Query: 117   VTVELTVEGSFAKQLGQ-PVVSKTLGDRFSAPAVETRPSIWGE--------CPPKFATKL 167
             +  + TV G    Q  +  V++K      S P+  T P    +          PKF    
Sbjct: 23576 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDT- 23634

Query: 168   GRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDD 227
               +VV  G+  R    + G+P P + WL+G+  ++ SAR  +   +   +L +    + D
Sbjct: 23635 --IVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRID 23692

Query: 228   VGVYTCLVVNGSGKASMSAELSI 250
              G Y     N +G  S    + +
Sbjct: 23693 GGQYILRASNVAGSKSFPVNVKV 23715



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

Query: 990  LKSASKEELK-KDVKNDVNCKRGHAGTTDNEKRSESQGTAPA----------FKQKLQDV 1038
            +KS  K +++ K + + +N +  H G   +      + T+ A          F++ ++D+
Sbjct: 3008 IKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDI 3067

Query: 1039 HVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGL 1098
             V E K+ + +C+VS +P  T+ W  + + L+ T  I + +E  +  + I      D G 
Sbjct: 3068 KVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGK 3126

Query: 1099 YKCVAKNDAGQAE 1111
            Y  VA  +   A+
Sbjct: 3127 YTVVAGGNVSTAK 3139



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 21/72 (29%), Positives = 34/72 (47%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             ++++ G   R    + GRP P++TW K NV L+    + +   +    L    VN+ D G
Sbjct: 19703 LILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG 19762

Query: 230   VYTCLVVNGSGK 241
              Y   + N  GK
Sbjct: 19763 KYILTLENSCGK 19774



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G  + + + V G P P V W      +++++  +FE   T   L I E    D+G Y   
Sbjct: 21080 GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLT 21139

Query: 628   AWNSAGEVRTQAVLTVQ 644
             A N  GEV    V+T+Q
Sbjct: 21140 ARNIVGEVGD--VITIQ 21154



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 25/148 (16%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCEAG--VAELHIQDALPE 507
             KD  V+  G+ F +   + G P+P I W+   Q +   AR   ++      L ++DA+  
Sbjct: 22550 KDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRV 22609

Query: 508   DHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLK--- 564
             D G Y   A+N  G+ S    VTV+ K   R         P  P  P+ + G++  K   
Sbjct: 22610 DSGNYILKAKNVAGERS----VTVNVKVLDR---------PGPPEGPVVISGVTAEKCTL 22656

Query: 565   -----VMDGSQVTMTVQVSGNPPPEVIW 587
                  + DG    +   V       ++W
Sbjct: 22657 AWKPPLQDGGSDIINYIVERRETSRLVW 22684



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 1684  KPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG 1743
             +P VKP FS       V  G   + +  I G P P + W KD   ++++    +  D   
Sbjct: 23229 EPDVKPAFSS----YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVT-DSLD 23283

Query: 1744  NCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELI 1778
               +L I +   DD  +Y     N +G+ T + E++
Sbjct: 23284 LTTLSIKETHKDDGGQYGITVANVVGQKTASIEIV 23318



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 667   QSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEIL 726
             + + I     G P  TV+W +DG+ L K+T    V  ++ V +L +K+      G YE+ 
Sbjct: 25410 EQLKIDVPFKGRPQATVNWRKDGQTL-KETTRVNVSSSKTVTSLSIKEASKEDVGTYELC 25468

Query: 727   LKNRVGECSCQVSLMLQNSSARALPRGREPASCEDL 762
             + N  G  +  +++++ +      P   +  SC+ +
Sbjct: 25469 VSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSI 25504



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 520   LGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLK----VMDGSQVTMTV 575
             +GQ        V+ K  S  SE +  + P +      L+   DLK    +  G+ + + V
Sbjct: 29409 MGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMV 29468

Query: 576   QVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEV 635
              VSG PPP + W   G  I  +     +   +   L + +V   D G YT EA N +G+ 
Sbjct: 29469 SVSGRPPPVITWSKQG--IDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKK 29526

Query: 636   RTQAVLTVQE 645
                 ++ V +
Sbjct: 29527 SATVLVKVYD 29536



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

Query: 1031  FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNG-KTLKTTKFIILSQEGSLCSVSIE 1089
             F + L+D  V EG   +L+C+VS +  A + W  NG + LK+ K+ I++ +G +  + I 
Sbjct: 12287 FTKPLEDQTVEEGATAVLECEVSREN-AKVKWFKNGTEILKSKKYEIVA-DGRVRKLVIH 12344

Query: 1090  KALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
                PED   Y C    DA   + SC + V
Sbjct: 12345 DCTPEDIKTYTC----DAKDFKTSCNLNV 12369



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 49/222 (22%), Positives = 76/222 (34%), Gaps = 44/222 (19%)

Query: 29    LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
             L E   F     N+ + E  T K    V   P  +V W++  + I   GR+ +    R  
Sbjct: 12459 LEEEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKR 12517

Query: 89    FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPA 148
               LVI   H ED G Y C   +     +V V                             
Sbjct: 12518 I-LVIQNAHLEDAGNYNCRLPSSRTDGKVKVH---------------------------- 12548

Query: 149   VETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVS 208
                      E   +F +K   + + EG+   F C I+    P V W + +  L+   +  
Sbjct: 12549 ---------ELAAEFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYD 12598

Query: 209   VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
             V      +VL +      D+G Y  +V    G A  +A L++
Sbjct: 12599 VIADGKKRVLVVKDATLQDMGTYVVMV----GAARAAAHLTV 12636



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 26/93 (27%), Positives = 39/93 (41%)

Query: 551   PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHS 610
             P+  + ++ +  L V  G+ V     + G P P   W  +G+EI+  E +  E       
Sbjct: 17508 PSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV 17567

Query: 611   LCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTV 643
             L I+     DTG Y     N+AG       LTV
Sbjct: 17568 LTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 17600



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +T   G +V +   + G P PTV W +DG  L K     ++    ++ TL L  V    +
Sbjct: 19305 LTVKAGTNVCLDATVFGKPMPTVSWKKDG-TLLKPAEGIKMAMQRNLCTLELFSVNRKDS 19363

Query: 721   GQYEILLKNRVGECSCQVSL 740
             G Y I  +N  G  S  + L
Sbjct: 19364 GDYTITAENSSGSKSATIKL 19383



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 171   VVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGV 230
             VV+ G   R      GRP P   W K +  L  S R  +   +    L +   N++D G 
Sbjct: 28368 VVRAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNRNDAGK 28425

Query: 231   YTCLVVNGSGKASMSAELSI 250
             YT  V N SG  S++  + +
Sbjct: 28426 YTLTVENNSGSKSITFTVKV 28445



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 13/142 (9%)

Query: 512   YTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDL-KVMDGSQ 570
             +  LA+NA G +S  +  T      + + EY    AP K      L G  DL  +  GS 
Sbjct: 29014 FRVLAKNAAGVISKGSEST---GPVTCRDEY----APPKAELDARLHG--DLVTIRAGSD 29064

Query: 571   VTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWN 630
             + +   V G P P++IW     E+   E    +  G + +  I+     D+G YT    N
Sbjct: 29065 LVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKN 29124

Query: 631   SAGEVRTQAVLTVQEPHDGTQP 652
             ++G   T+AV  + +  D   P
Sbjct: 29125 ASG---TKAVSVMVKVLDSPGP 29143



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

Query: 139   TLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGN 198
             T  D ++ P  E    + G+           V ++ G        + G+P+P++ W KG+
Sbjct: 29036 TCRDEYAPPKAELDARLHGDL----------VTIRAGSDLVLDAAVGGKPEPKIIWTKGD 29085

Query: 199   VPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDS 255
               L    +VS+          I   ++ D G YT  V N SG  ++S  + +  LDS
Sbjct: 29086 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV--LDS 29140



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 1691  FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
             F+K + ++EV E    +  C++   P  EV+W+K D+ I E+  ++I   E     L+I 
Sbjct: 12465 FTKNLANIEVSETDTIKLVCEVSK-PGAEVIWYKGDEEIIETGRYEI-LTEGRKRILVIQ 12522

Query: 1751  DVCGDDDAKYTCKAVNSLGEATCTA-ELIVETMEEGEG----EGEEEE 1793
             +   +D   Y C+  +S  +      EL  E + + +     EGE+ E
Sbjct: 12523 NAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAE 12570



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 12/122 (9%)

Query: 8     ASSHISKTSLSVDPSRVDSMPLTEAPAFILPPR---NLCIKEGATAKFEGRVRGYPEPQV 64
             A+  ISK S S  P  + +    E P   + P+    + +  G T + E  V G P P +
Sbjct: 23600 AAGAISKPSDSTGP--ITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTI 23657

Query: 65    TWHRNGQPITSGGRFLLDCGIRGT---FSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
              W R  + I    R    C I+ T     L++      D G+Y   A+N +G++   V +
Sbjct: 23658 EWLRGDKEIEESAR----CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNV 23713

Query: 122   TV 123
              V
Sbjct: 23714 KV 23715



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 8/105 (7%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             ++VK G     +    GRP P V W K +  L+  A V  ++      L I   N++D G
Sbjct: 26196 LIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSR--TSLTIENANRNDSG 26253

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKE 274
              YT  + N    AS++  L ++ LD+        T  T  DV KE
Sbjct: 26254 KYTLTIQNVLSAASLT--LVVKVLDTPG----PPTNITVQDVTKE 26292



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 34/133 (25%), Positives = 51/133 (38%), Gaps = 9/133 (6%)

Query: 105   TCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFA 164
             TCE        Q  +E  V     K L  PV   T+G       + T      + P    
Sbjct: 27517 TCEIEVSQLKEQSVLEFRVFAKNEKGLSDPV---TIGPITVKELIITPEVDLSDIPG--- 27570

Query: 165   TKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVN 224
                 +V V+ G          G+P+P ++WLK  +PL+ S  V  S+      L I    
Sbjct: 27571 ---AQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAK 27627

Query: 225   QDDVGVYTCLVVN 237
             ++  G YT ++ N
Sbjct: 27628 KEHGGKYTVILDN 27640



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

Query: 1687  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSI--RESRHFQIDYDEDGN 1744
             + P       D+ + EG      C   G P PEV W    + I  +E   F I+ + D  
Sbjct: 33327 IPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIE-NTDDL 33385

Query: 1745  CSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETM 1782
              +LII DV   D   YT    N  G  + T  + + ++
Sbjct: 33386 TTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI 33423



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 24/96 (25%), Positives = 43/96 (44%)

Query: 158   ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQV 217
             +C P    +   ++V EG+           P P V+W K    ++ S R+++   +    
Sbjct: 14384 DCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 14443

Query: 218   LEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGL 253
             LE+    + D G+YT  + N  G A+ S  + + GL
Sbjct: 14444 LEVPKSVRADAGIYTITLENKLGSATASINVKVIGL 14479



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

Query: 445   PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-RSTCEAG--VAELHI 501
             P+      D  VIEG+   +    R  PVP ++W  +G+ ++ + R T +     A L +
Sbjct: 14387 PTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEV 14446

Query: 502   QDALPEDHGTYTCLAENALGQVSCSAWVTV 531
               ++  D G YT   EN LG  + S  V V
Sbjct: 14447 PKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 25/87 (28%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

Query: 1693  KTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDV 1752
             K I  L V  G+  RF   I G P P   W  D   I+   H+ ++ D   +  L I + 
Sbjct: 17515 KLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV-LTIKNC 17573

Query: 1753  CGDDDAKYTCKAVNSLGEATCTAELIV 1779
                D  +Y     N+ G  T    L V
Sbjct: 17574 LRRDTGEYQITVSNAAGSKTVAVHLTV 17600



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 23/80 (28%), Positives = 36/80 (45%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +    G++ ++   I G P P V W +DGK L +     E+       TLV+K       
Sbjct: 24717 IVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 24776

Query: 721   GQYEILLKNRVGECSCQVSL 740
             GQY + L N  G  S  +++
Sbjct: 24777 GQYILKLSNVGGTKSIPITV 24796



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 26/85 (30%), Positives = 34/85 (40%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V +  G  L+L   V   P   IIWT   K L   + + L   G   +  I+     D G
Sbjct: 29057 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 29116

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAP 1122
              Y    KN +G    S  V V D+P
Sbjct: 29117 KYTLTVKNASGTKAVSVMVKVLDSP 29141



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 27/93 (29%), Positives = 38/93 (40%), Gaps = 3/93 (3%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F K + D  V  GS    +    G P   V W KD+  I +S    I   E      I+ 
Sbjct: 6929 FVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILE 6988

Query: 1751 DVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
                +D A+Y+C   N  G+  C  E +V  +E
Sbjct: 6989 STI-EDYAQYSCLIENEAGQDIC--EALVSVLE 7018



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 535   KSSRKSEYLLPVAPSK-PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNE 593
             K SR +E +  V   + P   + ++ L+ L V  G+++ +   V+G P P++ W      
Sbjct: 13671 KPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMI 13730

Query: 594   IQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTV 643
             +++ +    E    + ++ I +    DTGTY  EA N  G  R  AV+ V
Sbjct: 13731 LKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG--RATAVVEV 13778



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 1693  KTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDV 1752
             K +  L V  G+       + G P+P++ W K D  +++ +   I+ +     ++ I D 
Sbjct: 13695 KLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVPKKSTVTIVDS 13753

Query: 1753  CGDDDAKYTCKAVNSLGEATCTAELIV 1779
                D   Y  +AVN  G AT   E+ V
Sbjct: 13754 KRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSF 1320
             P PP      + I  ++  L W     DGGS + +Y +E  D   K W+ +  T + T  
Sbjct: 14084 PSPPRWLEVIN-ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKC 14142

Query: 1321  NVQDLLPDHEYKFRVRAINVYGTSE 1345
              V  L     Y FRV A N  G S+
Sbjct: 14143 TVTPLTEGSLYVFRVAAENAIGQSD 14167



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 1/91 (1%)

Query: 33    PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
             P  IL P  + IK G   + E  V G P P   W +    + +     +      +  L+
Sbjct: 18899 PPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI-LI 18957

Query: 93    IHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
             I  V  +D G Y+  A N SG     +++ V
Sbjct: 18958 IKDVTRKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 20/81 (24%), Positives = 39/81 (48%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VV  G+  +    I G+P P + W+KG+  L  +AR+ +   +    L +    + D G
Sbjct: 22553 IVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSG 22612

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              Y     N +G+ S++  + +
Sbjct: 22613 NYILKAKNVAGERSVTVNVKV 22633



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             ++ G   K E  + G P+P +TW ++G P+    R  +   +  T +L I   H++D G+
Sbjct: 23241 VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT-TLSIKETHKDDGGQ 23299

Query: 104   YTCEATNGSGARQVTVEL 121
             Y     N  G +  ++E+
Sbjct: 23300 YGITVANVVGQKTASIEI 23317



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 1687  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
             ++P          +  G   + +  + G P P + W KD + ++++    ++ +   +  
Sbjct: 24310 IQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVE-ETATSTV 24368

Query: 1747  LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             L I +   DD  KYT  A NS G AT    +IV
Sbjct: 24369 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIV 24401



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/74 (31%), Positives = 33/74 (44%)

Query: 570   QVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAW 629
             Q+ + V   G P   V W  +G  ++E+   +     T  SL I+E   ED GTY     
Sbjct: 25411 QLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVS 25470

Query: 630   NSAGEVRTQAVLTV 643
             NSAG +     + V
Sbjct: 25471 NSAGSITVPITIIV 25484



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 14/111 (12%)

Query: 642   TVQEPHDGTQPWFISK----PRS---------VTASLGQSVLISCAIAGDPFPTVHWLRD 688
             +V EP + T P  +      PR          +    G+ + I+  IAG P P + W +D
Sbjct: 25767 SVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKD 25826

Query: 689   GKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS 739
             G  + ++    E++  ++   L +K       GQY + LKN  G  S  V+
Sbjct: 25827 GIEI-EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVN 25876



 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 1691  FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
             F+K + D  V EG+ A  +C++    + +V WFK+   I +S+ ++I  D      L+I 
Sbjct: 12287 FTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEILKSKKYEIVADGRVR-KLVIH 12344

Query: 1751  DVCGDDDAKYTCKA 1764
             D   +D   YTC A
Sbjct: 12345 DCTPEDIKTYTCDA 12358



 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             + ++ G T +   RV+G PEP +TW + G+ +    R  L   +     L I      D 
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDL-PRVELQIKEAVRADH 17976

Query: 102   GKYTCEATNGSGARQ 116
             GKY   A N SG  Q
Sbjct: 17977 GKYIISAKNSSGHAQ 17991



 Score = 40.4 bits (93), Expect = 0.016
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTC---EAGVAELHIQDALPEDHGTYTCL 515
             GQ   +   V+G P P ITW   G+ +   +      +    EL I++A+  DHG Y   
Sbjct: 17923 GQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIIS 17982

Query: 516   AENALGQVSCSAWVTVHEK 534
             A+N+ G    SA V V ++
Sbjct: 17983 AKNSSGHAQGSAIVNVLDR 18001



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 46/201 (22%), Positives = 72/201 (35%), Gaps = 29/201 (14%)

Query: 1622 RRKWQKTGNAVRAIGRLS-----SMAMISGLSGRKSSTGS----PTSPLNAEKLESEEDV 1672
            R +W K G  ++   R S       A++      K+ +G      ++   ++  +S+  +
Sbjct: 8376 RIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTI 8435

Query: 1673 SQAFLEAVAEEKPHV--KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIR 1730
                  A A +K  V  + +F    + + VVE + A F  K+ G P P V W K      
Sbjct: 8436 KDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQL 8495

Query: 1731 ESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGE---- 1786
                    + +     L I D    D   Y C A N  GE      L V+  ++ E    
Sbjct: 8496 NQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEG 8555

Query: 1787 --------------GEGEEEE 1793
                          G GEEEE
Sbjct: 8556 DLRAMLKKTPILKKGAGEEEE 8576



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 46/180 (25%), Positives = 74/180 (41%), Gaps = 21/180 (11%)

Query: 7    VASSHISKTSLSVDPSRVDSMPLTEAPA------FILPPRNLCIKEGATAKFEGRVRGYP 60
            VA S  +K+ +++      + P T+  A      F+  P+++ + E  TA F  +V G P
Sbjct: 8423 VAGSDTTKSKVTIKDKPAVA-PATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDP 8481

Query: 61   EPQVTWHR-NGQPITSGGR-FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVT 118
             P V W +   + +  GGR F+   G      L I    + D G Y C A N  G  +  
Sbjct: 8482 IPNVKWTKGKWRQLNQGGRVFIHQKGDEA--KLEIRDTTKTDSGLYRCVAFNEHGEIESN 8539

Query: 119  VELTV---------EGSFAKQLGQ-PVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLG 168
            V L V         EG     L + P++ K  G+      +E   ++  +   K+A   G
Sbjct: 8540 VNLQVDERKKQEKIEGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYG 8599



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 20    DPSRVDSMPLT----EAPAFILPP---RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQP 72
             DP+ V    L     E P  IL     R   IK G T +    ++G P P+VTW +  + 
Sbjct: 17199 DPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRD 17258

Query: 73    ITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
               +  R  +D    G+   + +A H ED G Y+    N +G++ V+V++ V
Sbjct: 17259 APTKAR--IDVTPVGSKLEIRNAAH-EDGGIYSLTVENPAGSKTVSVKVLV 17306



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 529   VTVHEKKSSRKSEYLLP-VAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIW 587
             V V+EK  S      +P VA      P      S   V  G  + + V +SG P P + W
Sbjct: 23204 VAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITW 23263

Query: 588   LHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE-VRTQAVLTVQEP 646
               +G  ++++   +        +L I+E   +D G Y     N  G+   +  ++T+ +P
Sbjct: 23264 TKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKP 23323



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQ--YARSTCEAGVAE--LHIQDALP 506
             KD  V+  G+ FVL+  +RG P+P + W  +G+ ++   AR   ++ + +  L ++D + 
Sbjct: 24714 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIR 24773

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
              D G Y     N  G  S    V V ++             P  P  P+ + G++
Sbjct: 24774 TDGGQYILKLSNVGGTKSIPITVKVLDR-------------PGPPEGPLKVTGVT 24815



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 20/73 (27%), Positives = 29/73 (39%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G  V + +   G PPP V W  +   +     +  E   +   L I +V   DTG Y   
Sbjct: 27286 GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILT 27345

Query: 628   AWNSAGEVRTQAV 640
               N  GE ++  V
Sbjct: 27346 IENGVGEPKSSTV 27358



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 71/346 (20%), Positives = 136/346 (39%), Gaps = 57/346 (16%)

Query: 800   VRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRAN 859
             ++ + K++V  +    E     +VE    +   G+K   K L E   K  P E++  ++ 
Sbjct: 10900 LKAIPKKKVPEKPQVPE-----KVELTPLKVPGGEKKVRKLLPER--KPEPKEEVVLKSV 10952

Query: 860   LQR---QVKPKTVSEEERKVHSP-----------QQVDFRSVLAKKGTSKTPVPEKVPPP 905
             L++   + +PK   ++  KV  P           ++V+  +V  ++   K P P KVP  
Sbjct: 10953 LRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRE--RKIPEPTKVPEI 11010

Query: 906   KPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAET 965
             KPA P           LPA       E   A+      P    +P+    PV    P   
Sbjct: 11011 KPAIP-----------LPAPEPKPKPE---AEVKTIKPPPVEPEPTPIAAPV--TVPVVG 11054

Query: 966   LKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQ 1025
              K    A   E  KP G   P + +   +   ++ + +       G     +     + +
Sbjct: 11055 KKAEAKAPKEEAAKPKG---PIKGVPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLK 11111

Query: 1026  GTAPAFKQKLQDVHVAE----GKKLLLQCQVSSDPPATII--WTLNGKTLKTT---KFII 1076
                  F ++++D+ + E    G   + +C VS   P+T I  W  +G  ++ +   +FI 
Sbjct: 11112 AVPLKFVKEIKDIILTESEFVGSSAIFECLVS---PSTAITTWMKDGSNIRESPKHRFIA 11168

Query: 1077  LSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAP 1122
               ++  L  + ++ +   D G Y CV +    +   + ++ V++ P
Sbjct: 11169 DGKDRKLHIIDVQLS---DAGEYTCVLRLGNKEKTSTAKLVVEELP 11211



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 1668  SEEDVSQAFLEAV---AEEKPHV---KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVV 1721
             S +D SQ  +EA+   +E K  V    PYF+  ++D   VE       C+I    D  V 
Sbjct: 11991 SIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISK-ADAPVK 12049

Query: 1722  WFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTC 1762
             WFKD + I+ S++  I  D      LI+      D  +YTC
Sbjct: 12050 WFKDGKEIKPSKNAVIKADGKKR-MLILKKALKSDIGQYTC 12089



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 8/110 (7%)

Query: 21    PSR----VDSMPLTEAPAFILPPR---NLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPI 73
             PSR    + ++   EAP   L  +    L +K G   +    V G PEP++TW +    +
Sbjct: 13672 PSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMIL 13731

Query: 74    TSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
                 R  ++  +    ++ I      D G Y  EA N  G     VE+ V
Sbjct: 13732 KQDKRITIE-NVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 23/81 (28%), Positives = 34/81 (41%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VVK G   RF   I G P P   W      ++     +V   N   VL I    + D G
Sbjct: 17520 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTG 17579

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              Y   V N +G  +++  L++
Sbjct: 17580 EYQITVSNAAGSKTVAVHLTV 17600



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 34/124 (27%), Positives = 52/124 (41%), Gaps = 19/124 (15%)

Query: 446   SFSSVLKDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAG----VAELH 500
             S     +D  V+  G+ F L+  V G P+P I WL   + I+ + + CE       A L 
Sbjct: 23626 SMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEES-ARCEIKNTDFKALLI 23684

Query: 501   IQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGL 560
             ++DA+  D G Y   A N  G  S    V V ++             P  P  P+ + G+
Sbjct: 23685 VKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDR-------------PGPPEGPVQVTGV 23731

Query: 561   SDLK 564
             +  K
Sbjct: 23732 TSEK 23735



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 29/123 (23%), Positives = 52/123 (42%), Gaps = 6/123 (4%)

Query: 4     VKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPP---RNLCIKEGATAKFEGRVRGYP 60
             +++ A + +     +  P  V      EAP   L     + + ++ G +A+     +G P
Sbjct: 23993 IRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRP 24052

Query: 61    EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
              P++TW R     T   +  ++ G+  T  L I      D GKY  +  N SG++   V 
Sbjct: 24053 TPEITWSREEGEFTD--KVQIEKGVNYT-QLSIDNCDRNDAGKYILKLENSSGSKSAFVT 24109

Query: 121   LTV 123
             + V
Sbjct: 24110 VKV 24112



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V +  G  L L   VS  PP  I W+  G  L +   I  ++  SL  + ++K    D G
Sbjct: 29456 VTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL--LIVDKVNRYDAG 29513

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAP 1122
              Y   A+N +G+   +  V V D P
Sbjct: 29514 KYTIEAENQSGKKSATVLVKVYDTP 29538



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 65/327 (19%), Positives = 119/327 (36%), Gaps = 37/327 (11%)

Query: 652 PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDT-GHFEVLQNEDVFTL 710
           P F    +SV    G +      I+G P P V W RDG+ +   T    ++  ++    L
Sbjct: 6   PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65

Query: 711 VLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGAD 770
            +  V   ++G+Y +   N  G+ +    L+++  +A        P   + L    +   
Sbjct: 66  TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA-------PPNFVQRL--QSMTVR 116

Query: 771 GGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQH------TEEAIRQQEVE 824
            G   R      G P     +    DG +++  L  ++            E         
Sbjct: 117 QGSQVRLQVRVTGIPTPVVKFY--RDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174

Query: 825 QLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDF 884
            ++  + +G+  ST  L     +E+PA++     +   Q+     +  E+K+ +    D 
Sbjct: 175 SVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVS-TAQISESRQTRIEKKIEA--HFDA 231

Query: 885 RSV----LAKKGTSKTPVPEKVPPPKPATPDFRS----VLGGKKKLPAENGSSSAETLNA 936
           RS+    +   G +   +P K PP  P  P  RS     +  K +L  +   S       
Sbjct: 232 RSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIR---- 287

Query: 937 KAVESSKPLSNAQPSGPLKPVGNAKPA 963
               S  P+ + +   P  PV +  PA
Sbjct: 288 ---HSPSPVRHVRAPTP-SPVRSVSPA 310



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 27/102 (26%), Positives = 38/102 (37%), Gaps = 1/102 (0%)

Query: 1678  EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQI 1737
             E V  + P  KP       D+ V+EG            P P V W KD + ++ S    +
Sbjct: 14376 ENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTM 14435

Query: 1738  DYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
               D   +  L +      D   YT    N LG AT +  + V
Sbjct: 14436 KNDHI-SAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 34/126 (26%), Positives = 52/126 (41%), Gaps = 7/126 (5%)

Query: 449   SVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCE--AGVAELHIQDALP 506
             SV     ++ G+   +   V G PVP   W      +   R   +     +EL I+DAL 
Sbjct: 15109 SVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALR 15168

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM 566
             +DHG Y   A N+ G    +A V V +         +L + P      + L   SD +  
Sbjct: 15169 KDHGRYVITATNSCGSKFAAARVEVFDVPGP-----VLDLKPVVTNRKMCLLNWSDPEDD 15223

Query: 567   DGSQVT 572
              GS++T
Sbjct: 15224 GGSEIT 15229



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKA--LCKDTGH-------FEVLQNEDVFTLVLKKVQ 716
             G  + I   I G P P   W  DGKA    KD  H        E  +N  V  +++ + +
Sbjct: 15825 GSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSV--IIIPECK 15882

Query: 717   PWHAGQYEILLKNRVGE--CSCQVSLM 741
               H G+Y I  KN+ G+   +C+V +M
Sbjct: 15883 RSHTGKYSITAKNKAGQKTANCRVKVM 15909



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 34/144 (23%), Positives = 58/144 (40%), Gaps = 9/144 (6%)

Query: 599   DFHFEQRGT--QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS 656
             D HFE  G    H    + +     G ++ E   S G +  +    V  P     P +  
Sbjct: 22495 DTHFEVTGLVEDHRYEFRVIARNAAGVFS-EPSESTGAITARD--EVDPPRISMDPKYKD 22551

Query: 657   KPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQ 716
                ++    G+S  +   I G P PT+ W++  + L  +T   E+   +   +L +K   
Sbjct: 22552 ---TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKSTDFATSLSVKDAV 22607

Query: 717   PWHAGQYEILLKNRVGECSCQVSL 740
                +G Y +  KN  GE S  V++
Sbjct: 22608 RVDSGNYILKAKNVAGERSVTVNV 22631



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 1/82 (1%)

Query: 1698 LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
            ++V +G  A    K  G  +    WFKD Q +     ++I   +  +   IIS     D 
Sbjct: 4588 IDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTE-KKDS 4646

Query: 1758 AKYTCKAVNSLGEATCTAELIV 1779
             +YT +  N +G ++C A + V
Sbjct: 4647 GEYTFEVQNDVGRSSCKARINV 4668



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 22/81 (27%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 1699 EVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDA 1758
            + +  S   F   ++G P  ++ WFKDD  +       I   E     L +  V      
Sbjct: 5340 QAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIGL-EGSTSFLNLYSVDASKTG 5398

Query: 1759 KYTCKAVNSLGEATCTAELIV 1779
            +YTC   N +G  +CT  L+V
Sbjct: 5399 QYTCHVTNDVGSDSCTTMLLV 5419



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 56/243 (23%), Positives = 87/243 (35%), Gaps = 50/243 (20%)

Query: 2     GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
             G+V   A + I+   L+V    +D         F +P +++ + E   A+FE  +    E
Sbjct: 11464 GEVLYQALNAITTAILTVKEIELD---------FAVPLKDVTVPERRQARFECVLTR--E 11512

Query: 62    PQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
               V W +    I S  +F +    +    LVI+    +D G YT E              
Sbjct: 11513 ANVIWSKGPDIIKSSDKFDIIADGKKHI-LVINDSQFDDEGVYTAE-------------- 11557

Query: 122   TVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFS 181
              VEG            K    R     +            KF + L    VKEG+   F 
Sbjct: 11558 -VEG------------KKTSARLFVTGIRL----------KFMSPLEDQTVKEGETATFV 11594

Query: 182   CKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGK 241
             C+++   +  V W K +  L  S  V +S +     LE+  V  DD+      V   S  
Sbjct: 11595 CELS-HEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSST 11653

Query: 242   ASM 244
             A +
Sbjct: 11654 AQL 11656



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 163   FATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHG 222
             FA  L  V V E +  RF C +T   +  V W KG   ++ S +  +       +L I+ 
Sbjct: 11488 FAVPLKDVTVPERRQARFECVLTR--EANVIWSKGPDIIKSSDKFDIIADGKKHILVIND 11545

Query: 223   VNQDDVGVYTCLVVNGSGKASMSAELSIQGL 253
                DD GVYT  V    GK + SA L + G+
Sbjct: 11546 SQFDDEGVYTAEV---EGKKT-SARLFVTGI 11572



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 21/81 (25%), Positives = 35/81 (43%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             + V  G  + +  +V G P P++ W   G  +   +     Q   +  L I+E    D G
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 17977

Query: 623   TYTCEAWNSAGEVRTQAVLTV 643
              Y   A NS+G  +  A++ V
Sbjct: 17978 KYIISAKNSSGHAQGSAIVNV 17998



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 1/124 (0%)

Query: 628   AWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLR 687
             A N+ G    +    V E  +   P  I  P  +T   G+ + I   + G P PT  W +
Sbjct: 18875 ARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKW-K 18933

Query: 688   DGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSA 747
              G+     + H  V + +    L++K V    +G Y +  +N  G  + ++ +++ ++  
Sbjct: 18934 KGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG 18993

Query: 748   RALP 751
                P
Sbjct: 18994 PPQP 18997



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             SV A  G+ V +     G P PTV W +D K L  D   + +   +    L + +V    
Sbjct: 27280 SVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSD-ARYSIENTDSSSLLTIPQVTRND 27338

Query: 720   AGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDL 762
              G+Y + ++N VGE           SS  ++     PA+C+ L
Sbjct: 27339 TGKYILTIENGVGE---------PKSSTVSVKVLDTPAACQKL 27372



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPI---QYARSTCEAGVAELHIQDALPEDHGTYTCL 515
             G +  L+   +G P P I+WL +G P+   ++ R +       L I++A  E  G YT +
Sbjct: 27578 GHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVI 27637

Query: 516   AENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPI 555
              +NA+ +++    V             L P  PSKP  PI
Sbjct: 27638 LDNAVCRIAVPITVIT-----------LGP--PSKPKGPI 27664



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 3/114 (2%)

Query: 1146 GTESDAT-VKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
            G E+  T   + PAP   P    PP ++   ++  V  GESV L   ++G    T TW +
Sbjct: 921  GREAKVTETARVPAPVEIP--VTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYR 978

Query: 1205 FRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
               QI+ S   ++      ++L I  A  E  G +T    N+ G+      L V
Sbjct: 979  EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query: 545   PVAPSKPTAP----IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF 600
             PV  ++P  P    + +     +++M G  + +   V+G P P  +W     E+ + +  
Sbjct: 15092 PVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRV 15150

Query: 601   HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAG 633
               +  GT+  L I++   +D G Y   A NS G
Sbjct: 15151 VIDNVGTKSELIIKDALRKDHGRYVITATNSCG 15183



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTW--HRNGQPITSGGRFLLDCGIRGT-FSLVIHAVHE 98
             L +K G T + E  VRG P P+V W   ++   +T   R  +D     + FSL       
Sbjct: 18211 LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLT--KAKR 18268

Query: 99    EDRGKYTCEATNGSGA 114
              D GKY   ATN +G+
Sbjct: 18269 SDGGKYVVTATNTAGS 18284



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 33/131 (25%), Positives = 47/131 (35%), Gaps = 11/131 (8%)

Query: 33    PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
             PAF L      +  G   K +    G P P VTWH++  P+    R   +        L 
Sbjct: 22148 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAE-STENNSLLT 22206

Query: 93    IHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETR 152
             I     ED G Y  + TN +G    T+ + V        G   + +   D  +       
Sbjct: 22207 IKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLS----- 22261

Query: 153   PSIWGECPPKF 163
                WG  PPK+
Sbjct: 22262 ---WG--PPKY 22267



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

Query: 1696  RDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
             RD  VV  G   R +  + G P P + W + D+ I ES   +I  + D    LI+ D   
Sbjct: 23632 RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDAIR 23690

Query: 1755  DDDAKYTCKAVNSLG 1769
              D  +Y  +A N  G
Sbjct: 23691 IDGGQYILRASNVAG 23705



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 22/83 (26%), Positives = 37/83 (44%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +  K G        I+GRP P+VTW    + L+ + RVS++       L +    + D G
Sbjct: 28657 ITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSG 28716

Query: 230   VYTCLVVNGSGKASMSAELSIQG 252
              Y   + N +G  + S  + + G
Sbjct: 28717 RYFLTLENTAGVKTFSVTVVVIG 28739



 Score = 38.1 bits (87), Expect = 0.078
 Identities = 58/270 (21%), Positives = 103/270 (38%), Gaps = 43/270 (15%)

Query: 472   PVPRITWL-LNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVT 530
             PV    W+ +N +PI+  +   E GV        +P+        A NA+G         
Sbjct: 14325 PVGTEKWMRVNSRPIKDLKFKVEEGV--------VPDKEYVLRVRAVNAIGV-------- 14368

Query: 531   VHEKKSSRKSEYLLPVAPS-KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLH 589
                 + S  SE ++   P  KPT  +      D+ V++G ++++ V     P P V W  
Sbjct: 14369 ---SEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSWHK 14422

Query: 590   NGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQA-VLTVQEPHD 648
             +G E++ S+    +       L + +    D G YT    N  G       V  +  P  
Sbjct: 14423 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP-- 14480

Query: 649   GTQPWFISKPRSVTASLGQSVLISCAIAGDP------FPTVHWLRDGKALCKDTGHFEVL 702
                P    K   +T S       SC +  +P       P +H++ + +   + T +  V+
Sbjct: 14481 --GPCKDIKASDITKS-------SCKLTWEPPEFDGGTPILHYVLERREAGRRT-YIPVM 14530

Query: 703   QNEDVFTLVLKKVQPWHAGQYEILLKNRVG 732
               E+  +  +K + P     + +   N+VG
Sbjct: 14531 SGENKLSWTVKDLIPNGEYFFRVKAVNKVG 14560



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 51/198 (25%), Positives = 74/198 (37%), Gaps = 45/198 (22%)

Query: 47    GATAKFEGRVRGYPEPQVT-WHRNGQPITSGG--RFLLDCGIRGTFSLVIHAVHEEDRGK 103
             G++A FE  V   P   +T W ++G  I      RF+ D   R    L I  V   D G+
Sbjct: 11133 GSSAIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKDR---KLHIIDVQLSDAGE 11187

Query: 104   YTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKF 163
             YTC    G+  +  T +L VE                                 E P +F
Sbjct: 11188 YTCVLRLGNKEKTSTAKLVVE---------------------------------ELPVRF 11214

Query: 164   ATKLGR-VVVKEGQMGRFSCKITGRPQPQVTWLK-GNVPLQPSARVSVSEKNGMQVLEIH 221
                L   V V +GQ    SC++    +  V W K G + ++   R+       M+ L I+
Sbjct: 11215 VKTLEEEVTVVKGQPLYLSCELN--KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTIN 11272

Query: 222   GVNQDDVGVYTCLVVNGS 239
               +  D G YT  V N +
Sbjct: 11273 DADDTDAGTYTVTVENAN 11290



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 7/92 (7%)

Query: 551   PTAPIFLQGLSD-LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF------HFE 603
             PT  + L    D +KV  G  V +   V+G P P++ W  N   I++  D          
Sbjct: 15395 PTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVS 15454

Query: 604   QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEV 635
             +   +  L I +   ED GTYT  A N  G V
Sbjct: 15455 RSEAKTELSIPKAVREDKGTYTVTASNRLGSV 15486



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V++K G+  R    ++GRP P + W K    L+ +A++ +   +    L      + D G
Sbjct: 21471 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSG 21530

Query: 230   VYTCLVVNGSGKA 242
              YT    N  G A
Sbjct: 21531 AYTLTATNPGGFA 21543



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 31    EAPAFILPPRN---LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPI-TSGGRFLLDCGIR 86
             +AP   L P+    + +  G T   E  +RG P P V W ++G+ +  +  R  +   I+
Sbjct: 24703 DAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQ 24762

Query: 87    GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
              T +LV+      D G+Y  + +N  G + + + + V
Sbjct: 24763 KT-TLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKV 24798



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 13/99 (13%)

Query: 548   PSKPTAPIFLQG-------LSDLKVMD------GSQVTMTVQVSGNPPPEVIWLHNGNEI 594
             PS+ T PI ++        + D+K  D      G  + +   ++G P P + W  +G EI
Sbjct: 25771 PSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEI 25830

Query: 595   QESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAG 633
             +E              L +++    DTG Y     N AG
Sbjct: 25831 EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG 25869



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 562   DLKVMDGSQVTMTV--------QVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCI 613
             DL  + G+QVT+ +           G P P + WL +G  ++ESE   F +   + +L I
Sbjct: 27564 DLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSI 27623

Query: 614   QEVFPEDTGTYT 625
             +    E  G YT
Sbjct: 27624 KNAKKEHGGKYT 27635



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             +  G+ L ++  V   P   + W  +G  ++    + ++      S+ +  A  + RG+Y
Sbjct: 27970 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 28029

Query: 1100  KCVAKNDAGQAECSCQVTVDDAP 1122
                AKN +G A+   +V V D P
Sbjct: 28030 TVEAKNASGSAKAEIKVKVQDTP 28052



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 43/188 (22%), Positives = 76/188 (40%), Gaps = 8/188 (4%)

Query: 595   QESEDFHFEQRGT-QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLT---VQEPH-DG 649
             Q+  DF  E   T Q +  ++ +  +    +  +A N AG    +   +   ++EP  + 
Sbjct: 28586 QKGSDFWVEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEP 28645

Query: 650   TQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFT 709
             T        + +T   G    I   I+G P P V W  +   L K+T    +   +D  T
Sbjct: 28646 TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRL-KETDRVSITTTKDRTT 28704

Query: 710   LVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARAL-PRGREPASCED-LCGGGV 767
             L +K      +G+Y + L+N  G  +  V++++         P      S E  +   G 
Sbjct: 28705 LTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGE 28764

Query: 768   GADGGGSD 775
               DGGG++
Sbjct: 28765 PKDGGGTE 28772



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             GS  T+ V +SG P P+V W      ++E++         + +L +++    D+G Y   
Sbjct: 28662 GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLT 28721

Query: 628   AWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLIS 672
               N+AG V+T +V  V     G     ++ P  V++   +S ++S
Sbjct: 28722 LENTAG-VKTFSVTVVVIGRPGP----VTGPIEVSSVSAESCVLS 28761



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 1698  LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS-LIISDVCGDD 1756
             ++++ G   R    + G P P  VW K++  + + R   +  D  G  S LII D    D
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDR---VVIDNVGTKSELIIKDALRKD 15170

Query: 1757  DAKYTCKAVNSLGEATCTAELIV 1779
               +Y   A NS G     A + V
Sbjct: 15171 HGRYVITATNSCGSKFAAARVEV 15193



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 32/123 (26%), Positives = 49/123 (39%), Gaps = 6/123 (4%)

Query: 624   YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
             +  +A N+AG  +  A +   +      P  I     +    G +V I   I G PFPT+
Sbjct: 16089 FRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTL 16148

Query: 684   HWLR------DGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQ 737
              W +      D K       H   L  +D  TLV+ + +    G Y I   N +G  S +
Sbjct: 16149 TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKE 16208

Query: 738   VSL 740
             + L
Sbjct: 16209 MRL 16211



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +T  +GQ++ I   + G P P + W ++GK L ++    +++Q+     L +K+      
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK-RVDLIQDLPRVELQIKEAVRADH 17976

Query: 721   GQYEILLKNRVG 732
             G+Y I  KN  G
Sbjct: 17977 GKYIISAKNSSG 17988



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNG---QPIQYARSTCEAGVAELHIQDALPEDHGTYTCL 515
             G +  L  +V G P+P ++W  +G   +P +  +   +  +  L +     +D G YT  
Sbjct: 19310 GTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTIT 19369

Query: 516   AENALGQVSCSAWVTVHEK 534
             AEN+ G  S +  + V +K
Sbjct: 19370 AENSSGSKSATIKLKVLDK 19388



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 9/125 (7%)

Query: 19    VDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGR 78
             VDP R+   P  +          + +  G + K +  + G P P + W +  Q +++  R
Sbjct: 22538 VDPPRISMDPKYKD--------TIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTAR 22589

Query: 79    FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK 138
               +      T SL +      D G Y  +A N +G R VTV + V        G  V+S 
Sbjct: 22590 LEIKSTDFAT-SLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISG 22648

Query: 139   TLGDR 143
                ++
Sbjct: 22649 VTAEK 22653



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

Query: 1671  DVSQAFLEAVAEEKPHVKPYF---SKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQ 1727
             D S +    +A+E+   +P F   S+  + L V  G++        G P P V+W K D 
Sbjct: 26167 DPSDSSDPQIAKEREE-EPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDT 26225

Query: 1728  SIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
              +R   +       D   SL I +   +D  KYT    N L  A+ T  L+V+ ++
Sbjct: 26226 DLRTRAYVD---TTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLT--LVVKVLD 26276



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 38    PPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVH 97
             P   + ++ G+  K +  + G P P+VT  R+G P+ +  RF  +       ++ +    
Sbjct: 26482 PSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE-NLTINLKESV 26540

Query: 98    EEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVS 137
               D G+Y   A N SG  +  + + V        G  V+S
Sbjct: 26541 TADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVIS 26580



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G+S+ I   + G P P V W +DG  + K   + E+       +L ++     H G Y +
Sbjct: 27973 GESLRIKALVQGRPVPRVTWFKDGVEIEKRM-NMEITDVLGSTSLFVRDATRDHRGVYTV 28031

Query: 726   LLKNRVGECSCQVSLMLQNSSARAL 750
               KN  G    ++ + +Q++  + +
Sbjct: 28032 EAKNASGSAKAEIKVKVQDTPGKVV 28056



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 87/433 (20%), Positives = 147/433 (33%), Gaps = 79/433 (18%)

Query: 1009 KRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKT 1068
            +  H G        + +   P      + V V EG+    +C+V+  P   + W LNG+ 
Sbjct: 1821 RMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQL 1880

Query: 1069 LKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAP--ASEN 1126
            ++ +K   +  +G +  + I      D G  K  A+N  G  E   ++ +       S  
Sbjct: 1881 IRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVL 1939

Query: 1127 TKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESV 1186
             +APE    RP+  +      + +     +P   T  K  +  +  +    +KV   ES 
Sbjct: 1940 RRAPE---PRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKV-PEESE 1995

Query: 1187 ELFGKVTGT------QPITCTWMKFRKQIQESEHM-------------------KVENSE 1221
            EL  K          + IT   +K RK+ +  E +                   K   +E
Sbjct: 1996 ELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAE 2055

Query: 1222 NGSKLTI---------LAARQEHCGCYTLLVENKLG-SRQAQVNLTVVDKPDPPAGTPCA 1271
             G K+TI         L+   E    +  +    +G    A   + VV KPDP       
Sbjct: 2056 EG-KITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPEC----- 2109

Query: 1272 SDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEY 1331
                       WY +            IE  D     W E   C      ++D+  +   
Sbjct: 2110 ----------EWYKN---------GVKIERSDRIYWYWPEDNVCELV---IRDVTAEDSA 2147

Query: 1332 KFRVRAINVYGTSEPS-----QESELTTVGEKPEE----PKDEVEVSDDDEKEPEVDYRT 1382
               V+AIN+ G +        Q  +L T  ++ ++     KD +   + +  EP V  + 
Sbjct: 2148 SIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKW 2207

Query: 1383 VTINTEQKVSDFY 1395
                 E    D Y
Sbjct: 2208 YKDGMEVHEGDKY 2220



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G  + +   VSG PPP V W  N NE    ++   E      S+ I+       G Y+  
Sbjct: 16539 GGVIRIIAYVSGKPPPTVTW--NMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLL 16596

Query: 628   AWNSAGEVRTQAVLTV 643
             A N AGE +   ++ V
Sbjct: 16597 AKNEAGERKKTIIVDV 16612



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 1694  TIRDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQ-SIRESRHFQIDYDED-GNCSLIIS 1750
             T RD+  V  G   R   +++G P+P++ W K+ +  +RE R   +D  +D     L I 
Sbjct: 17913 TCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKR---VDLIQDLPRVELQIK 17969

Query: 1751  DVCGDDDAKYTCKAVNSLGEATCTA 1775
             +    D  KY   A NS G A  +A
Sbjct: 17970 EAVRADHGKYIISAKNSSGHAQGSA 17994



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 7/107 (6%)

Query: 1680  VAEEKPHVKPYFSKTIRDLE------VVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESR 1733
             V  E+  VK    K + DL+      V  G   R +  + G P PEV W KD  +   +R
Sbjct: 18187 VKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTR 18246

Query: 1734  HFQIDYDEDGNCS-LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
               ++  D   + S   ++     D  KY   A N+ G     A + V
Sbjct: 18247 SPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 22/92 (23%), Positives = 40/92 (43%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             + +  G ++ +   V G P P   W    +E+  S      +  +   L I++V  +D+G
Sbjct: 18908 ITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSG 18967

Query: 623   TYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWF 654
              Y+  A NS+G    +  + V +     QP F
Sbjct: 18968 YYSLTAENSSGTDTQKIKVVVMDAPGPPQPPF 18999



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

Query: 1698  LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
             + +  G + R    I+G P PEV W K D  IR++    +        SL++ +V   D 
Sbjct: 22952 INIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDV---TSSFTSLVLDNVNRYDS 23008

Query: 1758  AKYTCKAVNSLG 1769
              KYT    NS G
Sbjct: 23009 GKYTLTLENSSG 23020



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 1689  PYFSKTIRDLEVVE---GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNC 1745
             P     +   EVV+   G++ +    I G P P + W+KDD+ ++ +    ++   D   
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTD-LA 26928

Query: 1746  SLIISDVCGDDDAKYTCKAVNSLGEATCT 1774
             S++I D    +   Y  K  N++G A+ T
Sbjct: 26929 SILIKDADRLNSGCYELKLRNAMGSASAT 26957



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V  + G   +    I+G+P P + W K +  LQ +A V V     +  + I   ++ + G
Sbjct: 26882 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 26941

Query: 230   VYTCLVVNGSGKASMSAELSIQGLD 254
              Y   + N  G A  SA + +Q LD
Sbjct: 26942 CYELKLRNAMGSA--SATIRVQILD 26964



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 17/77 (22%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 1687 VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
            ++P + + ++D+ + EG      C+    P+ +  WF++ + ++     + + +   +  
Sbjct: 8743 IEPAWERHLQDVTLKEGQTCTMTCQFS-VPNVKSEWFRNGRILKPQGRHKTEVEHKVH-K 8800

Query: 1747 LIISDVCGDDDAKYTCK 1763
            L I+DV  +D  +YTCK
Sbjct: 8801 LTIADVRAEDQGQYTCK 8817



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 3/108 (2%)

Query: 143   RFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQ 202
             RF A   E R  +     PK  T    +VV  G+           P+ +  W K N PL 
Sbjct: 12982 RFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLS 13041

Query: 203   PSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
                  + +E+   ++LE     + D G Y  ++ N  GKA     L +
Sbjct: 13042 TKTIDTTAEQTSFRILE---AKKGDKGRYKIVLQNKHGKAEGFINLKV 13086



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSV---SEKNGMQV-----LEIHGV 223
             V+EG       KI G P P +TW K   P +P  +  V   +  N + V     L I   
Sbjct: 16128 VEEGTNVNIVAKIKGVPFPTLTWFKAP-PKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQS 16186

Query: 224   NQDDVGVYTCLVVNGSGKASMSAELSIQG 252
              + D G+YT   VN  G AS    L++ G
Sbjct: 16187 RRSDTGLYTITAVNNLGTASKEMRLNVLG 16215



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V+V+ G   R    + GRP P+VTW K  +      +  V   + M  L I    +DD G
Sbjct: 18616 VIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRKGQVDLVDTMAFLVIPNSTRDDSG 18674

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              Y+  +VN +G+ ++   + +
Sbjct: 18675 KYSLTLVNPAGEKAVFVNVRV 18695



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 37/151 (24%), Positives = 56/151 (37%), Gaps = 10/151 (6%)

Query: 516   AENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMT- 574
             A+N  G +S  +  T   +    K EY  P     PT          L +  G  + +  
Sbjct: 20350 AKNTAGAISAPSEST---ETIICKDEYEAPTIVLDPTIK------DGLTIKAGDTIVLNA 20400

Query: 575   VQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE 634
             + + G P P+  W   G +I+ S+        T   L I+    +D G YT  A N  G 
Sbjct: 20401 ISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGT 20460

Query: 635   VRTQAVLTVQEPHDGTQPWFISKPRSVTASL 665
                   +TV +      P  IS   +  A+L
Sbjct: 20461 KVEHVKVTVLDVPGPPGPVEISNVSAEKATL 20491



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 18/66 (27%), Positives = 29/66 (43%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G    +   VSG PPP + W  +G E++ +     +      +L  ++    D+G YT  
Sbjct: 21476 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 21535

Query: 628   AWNSAG 633
             A N  G
Sbjct: 21536 ATNPGG 21541



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 565   VMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTY 624
             V  GS + + + +SG P P+V    +G  ++ +  F+ E      ++ ++E    D G Y
Sbjct: 26488 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRY 26547

Query: 625   TCEAWNSAGEVRTQA-VLTVQEPHDGTQPWFIS 656
                A NS+G  +    ++ +  P   T P  IS
Sbjct: 26548 EITAANSSGTTKAFINIVVLDRPGPPTGPVVIS 26580



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 5/109 (4%)

Query: 1674  QAFLEAVAEEKPHVKPYFSKTIRDLEVVE---GSAARFDCKIEGYPDPEVVWFKDDQSIR 1730
             +AF   + +E P ++P    T    +++    GS    D  I G P P+V W  ++  ++
Sbjct: 28631 EAFSSVIIKE-PQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK 28689

Query: 1731  ESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             E+    I   +D   +L + D    D  +Y     N+ G  T +  ++V
Sbjct: 28690 ETDRVSITTTKD-RTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 28737



 Score = 36.2 bits (82), Expect = 0.29
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 1/89 (1%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F K + D  + +G     +    G P   V W K+  ++  S+   I   E  +  L I 
Sbjct: 7870 FVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEK-SAILEIP 7928

Query: 1751 DVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
                +D  +Y C   N+ G+ +C+A++++
Sbjct: 7929 SSTVEDAGQYNCYIENASGKDSCSAQILI 7957



 Score = 36.2 bits (82), Expect = 0.29
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

Query: 1007  NCKRGHAGTTD----NEKRSESQGTAP---AFKQKLQDVHVAEGKKLLLQCQVSSDPPAT 1059
             NC+    G  D    N K S      P      + L+DV V  G+     C++S +    
Sbjct: 12167 NCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYED-IP 12225

Query: 1060  IIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKN 1105
             + W L GK L+ +  ++   EG + ++++     ED G  +  AK+
Sbjct: 12226 VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 12271



 Score = 36.2 bits (82), Expect = 0.29
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             ++  + G++  +   + G P PT+ WLR  K + +++   E+   +    L++K      
Sbjct: 23634 TIVVNAGETFRLEADVHGKPLPTIEWLRGDKEI-EESARCEIKNTDFKALLIVKDAIRID 23692

Query: 720   AGQYEILLKNRVGECSCQVSL 740
              GQY +   N  G  S  V++
Sbjct: 23693 GGQYILRASNVAGSKSFPVNV 23713



 Score = 36.2 bits (82), Expect = 0.29
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 659   RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPW 718
             ++VT   G S+ +  +++G P P + W + G  L        +   E    L++ KV  +
Sbjct: 29454 KTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDL---ASRAIIDTTESYSLLIVDKVNRY 29510

Query: 719   HAGQYEILLKNRVGECSCQV 738
              AG+Y I  +N+ G+ S  V
Sbjct: 29511 DAGKYTIEAENQSGKKSATV 29530



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 2/92 (2%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKD-DQSIRESRHFQIDYDEDGNCSL 1747
            P F   +  L VV G  A     IEG     V W K+ ++ IRES + +I + E+   +L
Sbjct: 5610 PRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVEN-VATL 5668

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              +     +  KY C+  N  G     A L+V
Sbjct: 5669 QFAKAEPANAGKYICQIKNDGGMRENMATLMV 5700



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 3/83 (3%)

Query: 1698 LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSI-RESRHFQIDYDEDGNCSLIISDVCGDD 1756
            + V  G+    +C + G P+    WFKD + +  +S+H     ++  +  +  +++   D
Sbjct: 6654 MTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEM--SD 6711

Query: 1757 DAKYTCKAVNSLGEATCTAELIV 1779
               Y+ +  NS+G++ CT  + V
Sbjct: 6712 KGLYSFEVKNSVGKSNCTVSVHV 6734



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 37/186 (19%), Positives = 66/186 (35%), Gaps = 32/186 (17%)

Query: 88    TFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAP 147
             T S ++  + E    ++  +A N  G  + ++ L V                + D    P
Sbjct: 15351 TTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNV---------------VIQDDEVPP 15395

Query: 148   AVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS--- 204
              ++ R S+ G+           + VK G+       +TG P P++ W K    ++     
Sbjct: 15396 TIKLRLSVRGDT----------IKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDA 15445

Query: 205   ---ARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSF- 260
                 +  VS       L I    ++D G YT    N  G    +  + +    S  R+  
Sbjct: 15446 LQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLA 15505

Query: 261   VRETKA 266
             V + KA
Sbjct: 15506 VTDIKA 15511



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 1/75 (1%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G +V     I G P PT  W  DG  + K   H+ V  +     L +K       G+Y+I
Sbjct: 17525 GTTVRFPAIIRGVPVPTAKWTTDGSEI-KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 17583

Query: 726   LLKNRVGECSCQVSL 740
              + N  G  +  V L
Sbjct: 17584 TVSNAAGSKTVAVHL 17598



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

Query: 31    EAPAFILPPR---NLCIKEGATAKFEG-RVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
             EAP  +L P     L IK G T       + G P P+ +W + G+ I       +     
Sbjct: 20374 EAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPT 20433

Query: 87    GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
              +   + +A  + D G+YT  ATN  G +   V++TV
Sbjct: 20434 SSMLTIKYATRK-DAGEYTITATNPFGTKVEHVKVTV 20469



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             I+ G + +    ++G P P+V W +    I      ++D     T SLV+  V+  D GK
Sbjct: 22954 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFT-SLVLDNVNRYDSGK 23010

Query: 104   YTCEATNGSGARQVTVELTV 123
             YT    N SG +   V + V
Sbjct: 23011 YTLTLENSSGTKSAFVTVRV 23030



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 25/91 (27%), Positives = 41/91 (45%), Gaps = 3/91 (3%)

Query: 33    PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
             P+  LP     +K     K +   +G P+  V W ++GQ +    R  +      T SL 
Sbjct: 25395 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVT-SLS 25453

Query: 93    IHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
             I    +ED G Y    +N +G+  +TV +T+
Sbjct: 25454 IKEASKEDVGTYELCVSNSAGS--ITVPITI 25482



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1713  EGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE 1770
             +G P P V W KD++++     + I+ + D +  L I  V  +D  KY     N +GE
Sbjct: 27296 KGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDTGKYILTIENGVGE 27352



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 20/106 (18%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

Query: 1015  TTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTK- 1073
             +T    ++  +G  P  +    D+ + EGK L + C  + +P   + W+  G+ + + + 
Sbjct: 33315 STSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQ 33374

Query: 1074  -FIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
                 +     L ++ I     +D GLY     N+ G    +  + +
Sbjct: 33375 GRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 47/231 (20%), Positives = 82/231 (35%), Gaps = 56/231 (24%)

Query: 1031  FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEK 1090
             F + L ++ V+E   + L C+VS  P A +IW    + +  T    +  EG    + I+ 
Sbjct: 12465 FTKNLANIEVSETDTIKLVCEVSK-PGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQN 12523

Query: 1091  ALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESD 1150
             A  ED G Y C                                 R P S         +D
Sbjct: 12524 AHLEDAGNYNC---------------------------------RLPSS--------RTD 12542

Query: 1151  ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQ 1210
               VK            +  + I  P++ ++  GE  E    ++  +     W +  K ++
Sbjct: 12543 GKVKVH---------ELAAEFISKPQNLEILEGEKAEFVCSIS-KESFPVQWKRDDKTLE 12592

Query: 1211  ESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
               +   V        L +  A  +  G Y ++V    G+ +A  +LTV++K
Sbjct: 12593 SGDKYDVIADGKKRVLVVKDATLQDMGTYVVMV----GAARAAAHLTVIEK 12639



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 16/82 (19%), Positives = 37/82 (45%)

Query: 169   RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDV 228
             ++ ++ G+    + + +G+P+P+V+W K    +    R  +        LE     + D 
Sbjct: 16827 KLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDS 16886

Query: 229   GVYTCLVVNGSGKASMSAELSI 250
             G Y  +V N +G      ++++
Sbjct: 16887 GKYCVVVENSTGSRKGFCQVNV 16908



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 25/96 (26%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

Query: 550   KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWL--HNGNEIQESEDFHFEQRGT 607
             KP   + L G+  L V  G  + +   V G P PEV W    +  ++  S     + R  
Sbjct: 18200 KPVLDLKLSGV--LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRAD 18257

Query: 608   QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTV 643
                  + +    D G Y   A N+AG     A + V
Sbjct: 18258 SSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 31/122 (25%), Positives = 47/122 (38%), Gaps = 9/122 (7%)

Query: 512   YTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQV 571
             +  +A+NA G +S  +  T      + K E  LP     P      +    + V  G   
Sbjct: 23593 FRVIAKNAAGAISKPSDST---GPITAKDEVELPRISMDP------KFRDTIVVNAGETF 23643

Query: 572   TMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNS 631
              +   V G P P + WL    EI+ES     +    +  L +++    D G Y   A N 
Sbjct: 23644 RLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNV 23703

Query: 632   AG 633
             AG
Sbjct: 23704 AG 23705



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 6/101 (5%)

Query: 437   GLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTC---E 493
             G  V+++   ++ V+K  A   G    L+  + G P P I W  + + +Q     C    
Sbjct: 26868 GGPVIDLPLEYTEVVKYRA---GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENT 26924

Query: 494   AGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEK 534
               +A + I+DA   + G Y     NA+G  S +  V + +K
Sbjct: 26925 TDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDK 26965



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             + V++G + R +  I G+P P   W K    +   A ++ SE +    L I   ++ D G
Sbjct: 30146 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETH--TELVIKEADRGDSG 30203

Query: 230   VYTCLVVNGSGKASMSAELSIQG 252
              Y  ++ N  GK ++  ++ + G
Sbjct: 30204 TYDLVLENKCGKKAVYIKVRVIG 30226



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDY-DEDGNCSL 1747
             P  +  +R   V  G   RF   ++  P  EV W+ +   ++ES   +I Y +  G  +L
Sbjct: 32374 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESS--KIHYTNTSGVLTL 32431

Query: 1748  IISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              I D   DD   Y     N  GEA+  A L V
Sbjct: 32432 EILDCHTDDSGTYRAVCTNYKGEASDYATLDV 32463



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 1691  FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
             F   + D++V E   A+F+C++   P     W K  Q I     F++  D   + S++I 
Sbjct: 11842 FITPLSDVKVFEKDEAKFECEVSREP-KTFRWLKGTQEITGDDRFELIKDGTKH-SMVIK 11899

Query: 1751  DVCGDDDAKYTCKA 1764
                 +D+AKY  +A
Sbjct: 11900 SAAFEDEAKYMFEA 11913



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 169   RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDV 228
             R+VV  G + R    ++G+P P VTW      L   A +  +  +   V  I    +   
Sbjct: 16533 RIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMV--IKNCQRSHQ 16590

Query: 229   GVYTCLVVNGSGK 241
             GVY+ L  N +G+
Sbjct: 16591 GVYSLLAKNEAGE 16603



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNG--QPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             ++ G   +    VRG P P+VTW + G    +  G   L+D        LVI     +D 
Sbjct: 18618 VRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDT----MAFLVIPNSTRDDS 18673

Query: 102   GKYTCEATNGSGARQVTVELTV 123
             GKY+    N +G + V V + V
Sbjct: 18674 GKYSLTLVNPAGEKAVFVNVRV 18695



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 1698  LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
             L V  G+    D  + G P P V W KD   ++ +   ++    +  C+L +  V   D 
Sbjct: 19305 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRN-LCTLELFSVNRKDS 19363

Query: 1758  AKYTCKAVNSLGEATCTAELIV 1779
               YT  A NS G  + T +L V
Sbjct: 19364 GDYTITAENSSGSKSATIKLKV 19385



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

Query: 546   VAPSKPTAP-IFLQGLSDLKVM--DGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHF 602
             VA     AP + L+GL DL  +  + S   + + + G P P V W    + +        
Sbjct: 19972 VARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSV 20031

Query: 603   EQRGTQHSLCIQEVFPEDTGTYTCEAWNSAG-EVRTQAVLTVQEPHDGTQP 652
             E      +L + +    D G YT    N AG +  T ++  V +P   T P
Sbjct: 20032 ESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGP 20082



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 24/99 (24%), Positives = 38/99 (38%), Gaps = 10/99 (10%)

Query: 142   DRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPL 201
             D + AP +   P+I          K G  +V        +  I G+P P+ +W K    +
Sbjct: 20371 DEYEAPTIVLDPTI----KDGLTIKAGDTIVLN------AISILGKPLPKSSWSKAGKDI 20420

Query: 202   QPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240
             +PS    ++      +L I    + D G YT    N  G
Sbjct: 20421 RPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 20459



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             +V    G ++ +   I+G P P V   RDG  L K T  F      +  T+ LK+     
Sbjct: 26485 TVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPL-KATMRFNTEITAENLTINLKESVTAD 26543

Query: 720   AGQYEILLKNRVGECSCQVSLML 742
             AG+YEI   N  G     +++++
Sbjct: 26544 AGRYEITAANSSGTTKAFINIVV 26566



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 18/82 (21%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 1698 LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
            ++V  G  A  +  + G P+ +  W+KD + +  S+ ++I + ++    L        D 
Sbjct: 4026 IQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISF-KNNVAQLKFYSAELHDS 4084

Query: 1758 AKYTCKAVNSLGEATCTAELIV 1779
             +YT +  N +G ++C     V
Sbjct: 4085 GQYTFEISNEVGSSSCETTFTV 4106



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 13/79 (16%)

Query: 623   TYTCEAWNSAGE----VRTQAVLTVQEPHDGTQPWFISKP---------RSVTASLGQSV 669
             TYT +      E    VR +    + EP   T P     P          S+    G  +
Sbjct: 14638 TYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEI 14697

Query: 670   LISCAIAGDPFPTVHWLRD 688
              +  +I+G P+PT+ W++D
Sbjct: 14698 ALDASISGSPYPTITWIKD 14716



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 16/67 (23%), Positives = 28/67 (41%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G    +   + G P P + W+    E+  +     +      SL +++    D+G Y  +
Sbjct: 22558 GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK 22617

Query: 628   AWNSAGE 634
             A N AGE
Sbjct: 22618 AKNVAGE 22624



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS-LVIHAVHEEDRG 102
             ++  AT +    ++G PEP+V W +    +T   +      +  +F+ LVI  V   D G
Sbjct: 25119 LRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQI----EVTSSFTMLVIDNVTRFDSG 25174

Query: 103   KYTCEATNGSGARQVTVELTV 123
             +Y     N SG++   V + V
Sbjct: 25175 RYNLTLENNSGSKTAFVNVRV 25195



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 23/93 (24%), Positives = 35/93 (37%), Gaps = 1/93 (1%)

Query: 1687  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
             +KP          V      + D   +G P   V W KD Q+++E+    +   +    S
Sbjct: 25393 IKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVT-S 25451

Query: 1747  LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             L I +   +D   Y     NS G  T    +IV
Sbjct: 25452 LSIKEASKEDVGTYELCVSNSAGSITVPITIIV 25484



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 47/193 (24%), Positives = 71/193 (36%), Gaps = 18/193 (9%)

Query: 1597 PWLMKDTKNMEAKKLSKDRMKKYMA-----RRKWQKTGNAVRAIGRLSSMAMISGLSG-- 1649
            P+  K  +N+++      R+   +A     R  W K G  + A  R   +A + G +   
Sbjct: 4113 PFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYR-IAFVEGTASLE 4171

Query: 1650 --RKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAAR 1707
              R     +      A      +D S A +  V E    V    SK     +V+ GSA  
Sbjct: 4172 IIRVDMNDAGNFTCRATNSVGSKDSSGALI--VQEPPSFVTKPGSK-----DVLPGSAVC 4224

Query: 1708 FDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNS 1767
                 +G     + WFK ++ +       I   E    SL +  V   D   YTCK  N 
Sbjct: 4225 LKSTFQGSTPLTIRWFKGNKELVSGGSCYIT-KEALESSLELYLVKTSDSGTYTCKVSNV 4283

Query: 1768 LGEATCTAELIVE 1780
             G   C+A L V+
Sbjct: 4284 AGGVECSANLFVK 4296



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 5/97 (5%)

Query: 1651 KSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKT-IRDLE---VVEGSAA 1706
            K S    T  L  E++E  E   + F E V+  +  +      T I+D+E   V++ + A
Sbjct: 8614 KQSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDA 8673

Query: 1707 RFDCKIE-GYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
             F+  I+  YP+ ++ W+K  + +  S  F+I  D D
Sbjct: 8674 VFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGD 8710



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 45/214 (21%), Positives = 87/214 (40%), Gaps = 40/214 (18%)

Query: 810  TRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLK-EIPA----------EQMDFRA 858
            +R+  EE ++  +V ++  + ++ +K S   + E+ ++ ++PA          E+M F +
Sbjct: 9193 SRRMEEEKVQVTKVPEVS-KKIVPQKPSRTPVQEEVIEVKVPAVHTKKMVISEEKMFFAS 9251

Query: 859  NLQRQVK---PKTVSE--EERKVH---------SPQQVDFRSVLAKKGTSKTPVPEKVPP 904
            + + +V    P+   E   E K+H          P+  +     A +  +  P+P+KV P
Sbjct: 9252 HTEEEVSVTVPEVQKEIVTEEKIHVAISKRVEPPPKVPELPEKPAPEEVAPVPIPKKVEP 9311

Query: 905  PKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQ-PSGPLKPVGNAKPA 963
            P P  P+       KK +P E             V   +P +  + P  P KPV   K  
Sbjct: 9312 PAPKVPEV-----PKKPVPEEK--------KPVPVPKKEPAAPPKVPEVPKKPVPEEKIP 9358

Query: 964  ETLKPMGNAKPAETLKPMGNAKPDENLKSASKEE 997
              +     A PA+  +       +E +   ++ E
Sbjct: 9359 VPVAKKKEAPPAKVPEVQKGVVTEEKITIVTQRE 9392



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 35/139 (25%), Positives = 57/139 (41%), Gaps = 25/139 (17%)

Query: 136   VSKTLGDRFSAPAVETRPSIWGECPP--------------KFATKLGRVVVKE----GQM 177
             V K       A   + RP   GE PP              KF  ++  +++ E    G  
Sbjct: 11076 VPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSS 11135

Query: 178   GRFSCKITGRPQPQVT-WLK--GNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCL 234
               F C ++  P   +T W+K   N+   P  R     K+  + L I  V   D G YTC+
Sbjct: 11136 AIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKD--RKLHIIDVQLSDAGEYTCV 11191

Query: 235   VVNGSGKASMSAELSIQGL 253
             +  G+ + + +A+L ++ L
Sbjct: 11192 LRLGNKEKTSTAKLVVEEL 11210



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 1695  IRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
             ++D  V E     F+C++      +  WF+++++I +S  + I   +D   +L I D   
Sbjct: 12646 LKDTRVKEQQEVVFNCEVNT-EGAKAKWFRNEEAIFDSSKYII-LQKDLVYTLRIRDAHL 12703

Query: 1755  DDDAKYTCKAVNSLGE-ATCTAELIVE 1780
             DD A Y     N  GE     A LIVE
Sbjct: 12704 DDQANYNVSLTNHRGENVKSAANLIVE 12730



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 10/116 (8%)

Query: 2     GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNL-CIKEGATAKFEGRVR--- 57
             G+  L   S  +K  +S DPS +   PLT   AF+ P  +L   K+G        +    
Sbjct: 13359 GNKYLYRVSAENKAGVS-DPSEILG-PLTADDAFVEPTMDLSAFKDGLEVIVPNPITILV 13416

Query: 58    ---GYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATN 110
                GYP P  TW    + + +G R  +   +     LVI      D+G YT +  N
Sbjct: 13417 PSTGYPRPTATWCFGDKVLETGDRVKMKT-LSAYAELVISPSERSDKGIYTLKLEN 13471



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 21/85 (24%), Positives = 33/85 (38%), Gaps = 2/85 (2%)

Query: 168   GRVVVKEGQMGRFSCKITGRPQPQVTWLKGN--VPLQPSARVSVSEKNGMQVLEIHGVNQ 225
             G + VK G   R    + G+P P+V W K      L  S RV +  +       +    +
Sbjct: 18209 GVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKR 18268

Query: 226   DDVGVYTCLVVNGSGKASMSAELSI 250
              D G Y     N +G     A +++
Sbjct: 18269 SDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 1692  SKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISD 1751
             S+  + + V  G +AR     +G P PE+ W +++    +    ++  ++  N + +  D
Sbjct: 24028 SELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD----KVQIEKGVNYTQLSID 24083

Query: 1752  VCGDDDA-KYTCKAVNSLG 1769
              C  +DA KY  K  NS G
Sbjct: 24084 NCDRNDAGKYILKLENSSG 24102



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 6/109 (5%)

Query: 21    PSRVDSMPLTEAPAFILPPR---NLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGG 77
             P  V    + E P + L  R    + +++G   +    ++G P P   W + GQ I+   
Sbjct: 30122 PGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISK-- 30179

Query: 78    RFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGS 126
             R ++      T  LVI      D G Y     N  G + V +++ V GS
Sbjct: 30180 RAMIATSETHT-ELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGS 30227



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 51/246 (20%), Positives = 95/246 (38%), Gaps = 41/246 (16%)

Query: 451  LKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALPE 507
            L+D    E Q+ V +  +  + +  + W    + I+ +   +      + +L + + + +
Sbjct: 2539 LRDLTCTETQNVVFEVELSHSGID-VLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKD 2597

Query: 508  DHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMD 567
            D G YT  A    G+   S  +TV               A SKP        L+D  V +
Sbjct: 2598 DEGKYTFYA----GENMTSGKLTVAGG------------AISKP--------LTDQTVAE 2633

Query: 568  GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
              +     +V+ NP  +  WL +G  +  + +   E  G +  L I     +D G YT +
Sbjct: 2634 SQEAVFECEVA-NPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYK 2692

Query: 628  AWNSAGEVRTQAVLTVQEPHDGTQPWFISKP-RSVTASLGQSVLISCAIAGDPFPTVHWL 686
               S    +T A L V+          I K  +++T +  Q  + +  +       V W+
Sbjct: 2693 VATS----KTSAKLKVEAVK-------IKKTLKNLTVTETQDAVFTVELTHPNVKGVQWI 2741

Query: 687  RDGKAL 692
            ++G  L
Sbjct: 2742 KNGVVL 2747



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +    G  + I   ++G P PTV W  + + L ++     +       ++V+K  Q  H 
Sbjct: 16534 IVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAISSSMVIKNCQRSHQ 16590

Query: 721   GQYEILLKNRVGE 733
             G Y +L KN  GE
Sbjct: 16591 GVYSLLAKNEAGE 16603



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTC 1762
             G A R +  + G P P + W KD + +  +   +I    D + +L+  D    D   YT 
Sbjct: 21476 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKI-ADFSTNLVNKDSTRRDSGAYTL 21534

Query: 1763  KAVNSLGEA 1771
              A N  G A
Sbjct: 21535 TATNPGGFA 21543



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 20/116 (17%)

Query: 20    DPSRVDSMPLTEAPAFILPP---------RNLCIKEGATAKFEGRVRGYPEPQVTWHRNG 70
             +P+ V   P  E    +LPP         + + I+   T +    ++G P P+V W R+ 
Sbjct: 21841 EPALVPGTPKAEDR--MLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDH 21898

Query: 71    QPITSGGRFLLDCGIRGTFS---LVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
                   G  L    I  T S   L++  V+  D GKY     N SG++   V + V
Sbjct: 21899 ------GESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRV 21948



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             + +  G  + + V + G P PEV W     EI+++         T  SL +  V   D+G
Sbjct: 22952 INIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFT--SLVLDNVNRYDSG 23009

Query: 623   TYTCEAWNSAG 633
              YT    NS+G
Sbjct: 23010 KYTLTLENSSG 23020



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G+ + I   + G P P + W++DG+ L K T    V +      L +K+      G+Y +
Sbjct: 24326 GEDLKIEIPVIGRPRPNISWVKDGEPL-KQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 24384

Query: 726   LLKNRVGECSCQVSLML 742
                N  G  +  +S+++
Sbjct: 24385 TATNSAGTATENLSVIV 24401



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 4/108 (3%)

Query: 17    LSVDPSRVDSMPLT-EAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITS 75
             +++ P  V  + +T E     +P   + ++ G     E   +G P+P ++W ++G P+  
Sbjct: 27547 VTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 27606

Query: 76    GGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
                F+         +L I    +E  GKYT    N     ++ V +TV
Sbjct: 27607 -SEFVRFSKTENKITLSIKNAKKEHGGKYTVILDN--AVCRIAVPITV 27651



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 3/76 (3%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQ---YARSTCEAGVAELHIQDALPEDHGTYTCL 515
             G  F +   + G P P++TW L    ++       T       L ++D++  D G Y   
Sbjct: 28662 GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLT 28721

Query: 516   AENALGQVSCSAWVTV 531
              EN  G  + S  V V
Sbjct: 28722 LENTAGVKTFSVTVVV 28737



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 17/109 (15%)

Query: 1676  FLEAVAEEKPHVKPYFSKTIRDLEVVE----------GSAARFDCKIEGYPDPEVVWFKD 1725
             + E++AE    ++P     I DLE+ +          G++ R    + G P P + W K 
Sbjct: 29428 YSESIAE----IEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSK- 29482

Query: 1726  DQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCT 1774
              Q I  +    ID  E  +  LI+  V   D  KYT +A N  G+ + T
Sbjct: 29483 -QGIDLASRAIIDTTESYSL-LIVDKVNRYDAGKYTIEAENQSGKKSAT 29529



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 34/132 (25%), Positives = 49/132 (37%), Gaps = 3/132 (2%)

Query: 847   KEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTP-VPEK-VPP 904
             KE+  E++ F   +   V+   V EEE  +H  ++      +      K P VP K VP 
Sbjct: 9901  KELEPEEVAFEEEVVTHVEEYLVEEEEEYIHEEEEFITEEEVVPVIPVKVPEVPRKPVPE 9960

Query: 905   PKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAE 964
              K   P  +       K+P E      E +     +  KP     P  P KPV   K   
Sbjct: 9961  EKKPVPVPKKKEAPPAKVP-EVPKKPEEKVPVLIPKKEKPPPAKVPEVPKKPVPEEKVPV 10019

Query: 965   TLKPMGNAKPAE 976
              +     A PA+
Sbjct: 10020 PVPKKVEAPPAK 10031



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 1691  FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
             F   + D  V EG  A F C++  +    VVWFK+D  +  SR   I   E     L + 
Sbjct: 11576 FMSPLEDQTVKEGETATFVCELS-HEKMHVVWFKNDAKLHTSRTVLIS-SEGKTHKLEMK 11633

Query: 1751  DVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             +V  DD ++   +    + E + TA+L V
Sbjct: 11634 EVTLDDISQIKAQ----VKELSSTAQLKV 11658



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 1691  FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
             F   ++D+   E  +A F  ++  + +  V WFK+DQ +  +R   +  DE    S+   
Sbjct: 11931 FLTPLKDVTAKEKESAVFTVELS-HDNIRVKWFKNDQRLHTTRSVSMQ-DEGKTHSITFK 11988

Query: 1751  DVCGDDDAKYTCKAVNSLGEATCT 1774
             D+  DD ++   +A+    EA  T
Sbjct: 11989 DLSIDDTSQIRVEAMGMSSEAKLT 12012



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 20/72 (27%), Positives = 32/72 (44%)

Query: 185   TGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASM 244
             TG P+P  TW  G+  L+   RV +   +    L I    + D G+YT  + N     S 
Sbjct: 13419 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 13478

Query: 245   SAELSIQGLDSA 256
               ++++    SA
Sbjct: 13479 EIDVNVIARPSA 13490



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 27/116 (23%), Positives = 45/116 (38%), Gaps = 9/116 (7%)

Query: 10    SHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRN 69
             S IS+  ++ DP           P   L   ++ + EG         R  P P V+WH++
Sbjct: 14372 SEISENVVAKDPDC--------KPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKD 14423

Query: 70    GQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEG 125
             G+ + +  R  +          V  +V   D G YT    N  G+   ++ + V G
Sbjct: 14424 GKEVKASDRLTMKNDHISAHLEVPKSV-RADAGIYTITLENKLGSATASINVKVIG 14478



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 24/99 (24%), Positives = 37/99 (37%), Gaps = 5/99 (5%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQYARS-----TCEAGVAELHIQDALPEDHGTYT 513
             G    L+  VRG P P + W  +       RS        A  ++  +  A   D G Y 
Sbjct: 18216 GDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYV 18275

Query: 514   CLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPT 552
               A N  G     A V V +K    ++  ++ V+  + T
Sbjct: 18276 VTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCT 18314



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 40    RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT-FSLVIHA--V 96
             + L ++ G T +    V+G P P++TW +    +    R  LD  I+ T F   +    V
Sbjct: 19701 KTLILRAGVTMRLYVPVKGRPPPKITWSKPN--VNLRDRIGLD--IKSTDFDTFLRCENV 19756

Query: 97    HEEDRGKYTCEATNGSGARQVTVELTV 123
             ++ D GKY     N  G ++ T+ + V
Sbjct: 19757 NKYDAGKYILTLENSCGKKEYTIVVKV 19783



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 1/70 (1%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             +K G   + E  V G P P + W ++G+ +    +  +      T +LV       D G 
Sbjct: 21473 LKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFST-NLVNKDSTRRDSGA 21531

Query: 104   YTCEATNGSG 113
             YT  ATN  G
Sbjct: 21532 YTLTATNPGG 21541



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 33/148 (22%), Positives = 53/148 (35%), Gaps = 5/148 (3%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             + +K G   K    + G P P ++W ++G  I    R  +      T  L +      D 
Sbjct: 25799 IVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTL-LTVKDCIRRDT 25857

Query: 102   GKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFS----APAVETRPSIWG 157
             G+Y     N +G R V V   V        G   ++    ++ S     P  +    I  
Sbjct: 25858 GQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDY 25917

Query: 158   ECPPKFATKLGRVVVKEGQMGRFSCKIT 185
                 K  T      + EG++   SCK+T
Sbjct: 25918 YIVEKRETSHLAWTICEGELQMTSCKVT 25945



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 36/123 (29%), Positives = 48/123 (39%), Gaps = 8/123 (6%)

Query: 4     VKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPP---RNLCIKEGATAKFEGRVRGYP 60
             VK V     S  S S DP         E P F +     + L +K GA+       RG P
Sbjct: 26157 VKSVNKVGASDPSDSSDPQIAKERE--EEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRP 26214

Query: 61    EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
              P V W +    + +  R  +D     T SL I   +  D GKYT    N   A  +T+ 
Sbjct: 26215 VPNVLWSKPDTDLRT--RAYVDTTDSRT-SLTIENANRNDSGKYTLTIQNVLSAASLTLV 26271

Query: 121   LTV 123
             + V
Sbjct: 26272 VKV 26274



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 25/88 (28%), Positives = 35/88 (39%), Gaps = 7/88 (7%)

Query: 448   SSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAE----LHIQD 503
             S + K   V  G  F +    RG PVP + W    +P    R+       +    L I++
Sbjct: 26190 SEMRKTLIVKAGASFTMTVPFRGRPVPNVLW---SKPDTDLRTRAYVDTTDSRTSLTIEN 26246

Query: 504   ALPEDHGTYTCLAENALGQVSCSAWVTV 531
             A   D G YT   +N L   S +  V V
Sbjct: 26247 ANRNDSGKYTLTIQNVLSAASLTLVVKV 26274



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             L V  G+  TMTV   G P P V+W     +++     + +   ++ SL I+     D+G
Sbjct: 26196 LIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRA--YVDTTDSRTSLTIENANRNDSG 26253

Query: 623   TYTCEAWN 630
              YT    N
Sbjct: 26254 KYTLTIQN 26261



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 50/246 (20%), Positives = 84/246 (34%), Gaps = 53/246 (21%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G  KL+     +  +LSV+  ++           I   R+L   E     FE  +  +  
Sbjct: 2513 GPYKLIVGRVETNCNLSVEKIKI-----------IRGLRDLTCTETQNVVFEVEL-SHSG 2560

Query: 62   PQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
              V W+   + I    ++ ++   +  + L +  + ++D GKYT  A    G    + +L
Sbjct: 2561 IDVLWNFKDKEIKPSSKYKIEAHGK-IYKLTVLNMMKDDEGKYTFYA----GENMTSGKL 2615

Query: 122  TVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFS 181
            TV G          +SK L D+                            V E Q   F 
Sbjct: 2616 TVAGG--------AISKPLTDQ---------------------------TVAESQEAVFE 2640

Query: 182  CKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGK 241
            C++   P  +  WL+    L  +  +        + L I     DD+G YT  V      
Sbjct: 2641 CEVAN-PDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTS 2699

Query: 242  ASMSAE 247
            A +  E
Sbjct: 2700 AKLKVE 2705



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 32/135 (23%), Positives = 51/135 (37%), Gaps = 17/135 (12%)

Query: 1656  SPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVK--------------PYFSKTIRDLEVV 1701
             S T  +++E    + ++ +  L+ +++ K  VK              PYF+  + D   V
Sbjct: 11616 SRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAV 11675

Query: 1702  EGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYT 1761
             E       C++    D  V WFKD + I  S  + I  D      L I      D  +Y 
Sbjct: 11676 EKDEITLKCEVS--KDVPVKWFKDGEEIVPSPKYSIKADGLRRI-LKIKKADLKDKGEYV 11732

Query: 1762  CKAVNSLGEATCTAE 1776
             C       +A  T E
Sbjct: 11733 CDCGTDKTKANVTVE 11747



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTL-KTTKFIILSQEG-----SLCSVSIEKA 1091
             + V  G+ + +   V+  P   I W+ N   + K T  + +++E      +   +SI KA
Sbjct: 15408 IKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKA 15467

Query: 1092  LPEDRGLYKCVAKNDAGQAECSCQVTVDDAPA 1123
             + ED+G Y   A N  G    +  V V D P+
Sbjct: 15468 VREDKGTYTVTASNRLGSVFRNVHVEVYDRPS 15499



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

Query: 1696  RDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGD 1755
             R+  +  G   R    I+G P P+V W K+D+        +ID    G+  L I +   +
Sbjct: 17226 REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKA--RIDVTPVGS-KLEIRNAAHE 17282

Query: 1756  DDAKYTCKAVNSLGEATCTAELIV 1779
             D   Y+    N  G  T + +++V
Sbjct: 17283 DGGIYSLTVENPAGSKTVSVKVLV 17306



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 19/115 (16%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELH----IQDALP 506
             +D  V++ G+   +   + G P+P I+W  +G  I+  R+  E    + H    ++D + 
Sbjct: 25796 RDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIE-ERARTEIISTDNHTLLTVKDCIR 25854

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
              D G Y    +N  G  S +    V +K             P  P  P+ + GL+
Sbjct: 25855 RDTGQYVLTLKNVAGTRSVAVNCKVLDK-------------PGPPAGPLEINGLT 25896



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 57    RGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSG 113
             +G P P VTW ++ + + S  R+ ++     +  L I  V   D GKY     NG G
Sbjct: 27296 KGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDTGKYILTIENGVG 27351



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS-LVIHAVHEEDRG 102
             ++ GA+ +     +G P P   W +    ++       D     +FS L +   +  D G
Sbjct: 28369 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLS----LRADIHTTDSFSTLTVENCNRNDAG 28424

Query: 103   KYTCEATNGSGARQVTVELTV 123
             KYT    N SG++ +T  + V
Sbjct: 28425 KYTLTVENNSGSKSITFTVKV 28445



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 1695 IRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
            + D +V EG   + + K+      E VW KD Q ++ S    I  D+  +  L+I D+  
Sbjct: 2362 LSDQKVCEGDIVQLEVKVS-LESVEGVWMKDGQEVQPSDRVHIVIDKQSH-MLLIEDMTK 2419

Query: 1755 DDDAKYTCKAVNSLGEAT 1772
            +D   Y+   + +LG +T
Sbjct: 2420 EDAGNYSF-TIPALGLST 2436



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 27/93 (29%), Positives = 37/93 (39%), Gaps = 3/93 (3%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F K + D  V  G +   +    G     V W KD  +I  S    I   E   C L I 
Sbjct: 5988 FLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEK-TCILEIL 6046

Query: 1751 DVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
            +    D  +Y+C+  N  G   C A  +V T+E
Sbjct: 6047 NSTKRDAGQYSCEIENEAGRDVCGA--LVSTLE 6077



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 50/218 (22%), Positives = 85/218 (38%), Gaps = 16/218 (7%)

Query: 791  WLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIP 850
            W   E+ E V   + R  E  +  E  + + EV +     ++ +K+   +      K + 
Sbjct: 9495 WSYSEEEEGVSISVYREEEREEEEEAEVTEYEVMEEPEEYVVEEKLHIIS------KRVE 9548

Query: 851  AEQMDFRANLQRQV--KPKTVSE-EERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKP 907
            AE  +     ++++  KPK  ++ EE       +   + V  KK  +  P  EKVPPPK 
Sbjct: 9549 AEPAEVTERQEKKIVLKPKIPAKIEEPPPAKVPEAPKKIVPEKKVPAPVPKKEKVPPPK- 9607

Query: 908  ATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKP-AETL 966
              P+       +KK+P +      E L AK  E    ++  +          A P A   
Sbjct: 9608 -VPEEPKKPVPEKKVPPK-VIKMEEPLPAKVTERHMQITQEEKVLVAVTKKEAPPKARVP 9665

Query: 967  KPMGNAKPAE---TLKPMGNAKPDENLKSASKEELKKD 1001
            +    A P E    LKP    +P   +    K  +K++
Sbjct: 9666 EEPKRAVPEEKVLKLKPKREEEPPAKVTEFRKRVVKEE 9703



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 76/338 (22%), Positives = 111/338 (32%), Gaps = 62/338 (18%)

Query: 863   QVKPKTVSEEERKVHSPQQVDFRSVLAKKGTSK--------TPVPEKVPPPKPATPDFRS 914
             +V  K V E++  V +P++V+       +   K        TPVP+KV  P P  P  R 
Sbjct: 10034 EVPKKPVPEKKVPVPAPKKVEAPPAKVPEVPKKLIPEEKKPTPVPKKVEAPPPKVPKKRE 10093

Query: 915   VLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKP 974
              +     LP E      E +    V   + L   +   P +     +  E L       P
Sbjct: 10094 PVPVPVALPQEEEVLFEEEI----VPEEEVLPEEEEVLPEEEEVLPEEEEVLPEEEEIPP 10149

Query: 975   AETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQK 1034
              E   P       E  +   +EE+  +VK  V                      P  K+K
Sbjct: 10150 EEEEVPPEEEYVPEEEEFVPEEEVLPEVKPKV----------------PVPAPVPEIKKK 10193

Query: 1035  LQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI------ 1088
             + +  V   KK          PPA +            K IIL +E  +  V +      
Sbjct: 10194 VTEKKVVIPKK-------EEAPPAKV---PEVPKKVEEKRIILPKEEEVLPVEVTEEPEE 10243

Query: 1089  ----EKALPEDRGLYK-----------CVAKNDAGQAECSCQVTVDDAPASENTKAPEMK 1133
                 E+ +PE+    +            V K    +A       V+  PA  + K PE K
Sbjct: 10244 EPISEEEIPEEPPSIEEVEEVAPPRVPEVIKKAVPEAPTPVPKKVEAPPAKVSKKIPEEK 10303

Query: 1134  SRRP--KSSLPPVLGTESDATVKKKPAPKTPPKAAMPP 1169
                P  K   PP    E    V +K     P K A+PP
Sbjct: 10304 VPVPVQKKEAPPAKVPEVPKKVPEKKV-LVPKKEAVPP 10340



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 22/88 (25%), Positives = 33/88 (37%), Gaps = 8/88 (9%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFII--------LSQEGSLCSVSIEKALPE 1094
             G ++ +   +   P     W  +GK  K  K  +        L    +   + I +    
Sbjct: 15825 GSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRS 15884

Query: 1095  DRGLYKCVAKNDAGQAECSCQVTVDDAP 1122
               G Y   AKN AGQ   +C+V V D P
Sbjct: 15885 HTGKYSITAKNKAGQKTANCRVKVMDVP 15912



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 3/68 (4%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG-DDDAKYT 1761
             GS    D  + G P+P+++W K D+ +       + Y   G  +  +   C   D  KYT
Sbjct: 29062 GSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQY--TGKRATAVIKFCDRSDSGKYT 29119

Query: 1762  CKAVNSLG 1769
                 N+ G
Sbjct: 29120 LTVKNASG 29127



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 1696  RDLEVVEGSAARFDCKI--EGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVC 1753
             ++LE++EG  A F C I  E +P   V W +DD+++     + +  D      L++ D  
Sbjct: 12559 QNLEILEGEKAEFVCSISKESFP---VQWKRDDKTLESGDKYDVIADGKKRV-LVVKDAT 12614

Query: 1754  GDDDAKYTCKAVNSLGEATCTAELIV 1779
               D   Y    V  +G A   A L V
Sbjct: 12615 LQDMGTY----VVMVGAARAAAHLTV 12636



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 545   PVAPSKPTAP--IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHF 602
             P+      AP  + L     L +  G    +T + SG P P+V W  +  ++ E +  H 
Sbjct: 16808 PITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHI 16867

Query: 603   EQRGTQHSLCIQEVFPE--DTGTYTCEAWNSAG 633
               + T  +L ++++  +  D+G Y     NS G
Sbjct: 16868 --KTTPATLALEKIKAKRSDSGKYCVVVENSTG 16898



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 675   IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
             I G P P+V W +    L  DT    V  +    TL++   Q   AG+Y I LKN  G  
Sbjct: 20006 IKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 20064

Query: 735   SCQVSL 740
                +S+
Sbjct: 20065 EGTISI 20070



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAE----LHIQDALP 506
             KD  +++ G+ F L+  V G P P + W  +G+ ++   +  E  +A+    L  +D+  
Sbjct: 21468 KDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELE-GTAKLEIKIADFSTNLVNKDSTR 21526

Query: 507   EDHGTYTCLAENALG 521
              D G YT  A N  G
Sbjct: 21527 RDSGAYTLTATNPGG 21541



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 26/126 (20%), Positives = 51/126 (40%), Gaps = 25/126 (19%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAE---LHIQDALPEDHGTYTCL 515
             G +  +   + G P+P++T   +G P++          AE   +++++++  D G Y   
Sbjct: 26491 GSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEIT 26550

Query: 516   AENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM--------- 566
             A N+ G       + V ++             P  PT P+ +  +++  V          
Sbjct: 26551 AANSSGTTKAFINIVVLDR-------------PGPPTGPVVISDITEESVTLKWEPPKYD 26597

Query: 567   DGSQVT 572
              GSQVT
Sbjct: 26598 GGSQVT 26603



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

Query: 551   PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHS 610
             P   + L+    +K   G+ V +   +SG P P + W  +  E+Q +     E      S
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 26929

Query: 611   LCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQ 644
             + I++    ++G Y  +  N+ G     A + VQ
Sbjct: 26930 ILIKDADRLNSGCYELKLRNAMGS--ASATIRVQ 26961



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 1/87 (1%)

Query: 37    LPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAV 96
             +P + + +  G   +    + G P P  +W   G  +    R  ++   +    L I   
Sbjct: 29743 MPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTK-VAKLTIRET 29801

Query: 97    HEEDRGKYTCEATNGSGARQVTVELTV 123
                D G+YT E  N +G    T+++ +
Sbjct: 29802 TIRDTGEYTLELKNVTGTTSETIKVII 29828



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 1691 FSKTIRDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLII 1749
            F++ ++D+   E  + A F+C+    P  +V W+KD   + E   +++  D   +  L I
Sbjct: 2176 FTQELQDVVAKEKDTMATFECETSE-PFVKVKWYKDGMEVHEGDKYRMHSDRKVH-FLSI 2233

Query: 1750 SDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
              +   D   Y+C  V      T TA+LIVE
Sbjct: 2234 LTIDTSDAEDYSCVLVEDENVKT-TAKLIVE 2263



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 21/119 (17%)

Query: 1625 WQKTGNAVR-------AIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFL 1677
            W K G  V+        I + S M +I  ++  K   G+ +  + A  L +   VS   +
Sbjct: 2388 WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMT--KEDAGNYSFTIPALGLSTSGRVSVYSV 2445

Query: 1678 EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQ 1736
            + +              ++D+ V+EG+ A  +CK+       V W+ +D+ I+     Q
Sbjct: 2446 DVITP------------LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQ 2492



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 1694  TIRDLEVVE-GSAARFDCKIEGYPDPEVVWFKD--DQSIRESRHFQIDYDEDGNCSLIIS 1750
             ++R L +V  G   R    + G P P+V W K   D  +R+    Q+D   D    L+I 
Sbjct: 18611 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG---QVDL-VDTMAFLVIP 18666

Query: 1751  DVCGDDDAKYTCKAVNSLGE 1770
             +   DD  KY+   VN  GE
Sbjct: 18667 NSTRDDSGKYSLTLVNPAGE 18686



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 659   RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFT-LVLKKVQP 717
             R++    G S+ I   I G P P V W +D   L K+  + E   N + FT L++ +   
Sbjct: 20784 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIE---NTESFTLLIIPECNR 20839

Query: 718   WHAGQYEILLKNRVGECSCQVSLMLQNSSARAL 750
             +  G++ + ++N  G+ S  V++ + ++    L
Sbjct: 20840 YDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVL 20872



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 1696  RDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
             +D+ VV  G     +  I G P P+VVW KD + + E+             +L++ D   
Sbjct: 24714 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIR 24773

Query: 1755  DDDAKYTCKAVN 1766
              D  +Y  K  N
Sbjct: 24774 TDGGQYILKLSN 24785



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 38/175 (21%), Positives = 68/175 (38%), Gaps = 15/175 (8%)

Query: 45    KEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKY 104
             K G+    +  + G P P+VTW      +    R  +    +   +L +      D G+Y
Sbjct: 28660 KAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITT-TKDRTTLTVKDSMRGDSGRY 28718

Query: 105   TCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFA 164
                  N +G +  +V + V G      G   VS          + E+    WGE      
Sbjct: 28719 FLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSV--------SAESCVLSWGEPKDGGG 28770

Query: 165   TKLGRVVVKEGQMGRFSCKITG----RPQPQVTWLKGNVPLQPSARVSVSEKNGM 215
             T++   +V++ + G  + ++      R Q +VT L     ++ S RVS   + G+
Sbjct: 28771 TEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHL--TKYMEYSFRVSSENRFGV 28823



 Score = 31.6 bits (70), Expect = 7.3
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 3/79 (3%)

Query: 1702  EGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYT 1761
             E S  R    I+G P P V W K +  +       ++     N +LI+ D    D  KYT
Sbjct: 19996 ENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE-SSAVNTTLIVYDCQKSDAGKYT 20054

Query: 1762  CKAVNSLG--EATCTAELI 1778
                 N  G  E T + +++
Sbjct: 20055 ITLKNVAGTKEGTISIKVV 20073



 Score = 31.6 bits (70), Expect = 7.3
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 3/67 (4%)

Query: 458   EGQDFVLQCSVRGTPVPRITWLLNGQPIQY-ARSTCEAGVAE--LHIQDALPEDHGTYTC 514
             E  +F L+  ++G P P ++W     P+    R + E+      L + D    D G YT 
Sbjct: 19996 ENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTI 20055

Query: 515   LAENALG 521
               +N  G
Sbjct: 20056 TLKNVAG 20062



 Score = 31.6 bits (70), Expect = 7.3
 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGT--QHSLCIQEVFPEDTGTYT 625
             G    +   + G P P+V+W  +G E++E+     E + T  + +L +++    D G Y 
Sbjct: 24722 GETFVLEADIRGKPIPDVVWSKDGKELEETA-ARMEIKSTIQKTTLVVKDCIRTDGGQYI 24780

Query: 626   CEAWNSAG 633
              +  N  G
Sbjct: 24781 LKLSNVGG 24788



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 8/91 (8%)

Query: 1089  EKALPEDRGLYKCVAKND--AGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLG 1146
             EK +P  +   K V + +  A   E   ++ V+     E  + PE + R P + +P VL 
Sbjct: 10447 EKIIPPKKPPTKVVPRKEPPAKVPEVPKKIVVE-----EKVRVPE-EPRVPPTKVPEVLP 10500

Query: 1147  TESDATVKKKPAPKTPPKAAMPPQIIQFPED 1177
              +     KK P P      A PP++ + P++
Sbjct: 10501 PKEVVPEKKVPVPPAKKPEAPPPKVPEAPKE 10531



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 8/112 (7%)

Query: 1007  NCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNG 1066
             NC+   + T    K  E    A  F  K Q++ + EG+K    C +S +    + W  + 
Sbjct: 12533 NCRLPSSRTDGKVKVHE---LAAEFISKPQNLEILEGEKAEFVCSISKE-SFPVQWKRDD 12588

Query: 1067  KTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
             KTL++     +  +G    + ++ A  +D G Y  +     G A  +  +TV
Sbjct: 12589 KTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVM----VGAARAAAHLTV 12636



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 3/88 (3%)

Query: 450   VLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCE--AGVAELHIQDALP 506
             +L    V  G    L  +V G P P+ITW      + Q  R T E     + + I D+  
Sbjct: 13696 LLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKR 13755

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEK 534
              D GTY   A N  G+ +    V V +K
Sbjct: 13756 SDTGTYIIEAVNVCGRATAVVEVNVLDK 13783



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 10/79 (12%)

Query: 456   VIEGQDFVLQCSVRGTPVPRITWLL-------NGQPIQYARSTCEAGVAE---LHIQDAL 505
             V EG +  +   ++G P P +TW         N +P+ Y     +  V +   L I  + 
Sbjct: 16128 VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 16187

Query: 506   PEDHGTYTCLAENALGQVS 524
               D G YT  A N LG  S
Sbjct: 16188 RSDTGLYTITAVNNLGTAS 16206



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 1696  RDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGD 1755
             R L V  G + R    I+G P PEV W KD+ +++   + +   + +    LII +    
Sbjct: 20784 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIE---NTESFTLLIIPECNRY 20840

Query: 1756  DDAKYTCKAVNSLGE 1770
             D  K+     N  G+
Sbjct: 20841 DTGKFVMTIENPAGK 20855



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 14/78 (17%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIW------LHNGNEIQESEDFHFEQRGTQHSLCIQEV 616
             L V  G  + + V + G P PEV W      L N   I+ +E F          L I E 
Sbjct: 20786 LVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTL--------LIIPEC 20837

Query: 617   FPEDTGTYTCEAWNSAGE 634
                DTG +     N AG+
Sbjct: 20838 NRYDTGKFVMTIENPAGK 20855



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 16/69 (23%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI-ISDVCGDDDAKYT 1761
             G   + +  + G P P V W K DQ +++++  +++++     +++ I++    D   Y 
Sbjct: 21080 GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQ--RVNFETTATSTILNINECVRSDSGPYP 21137

Query: 1762  CKAVNSLGE 1770
               A N +GE
Sbjct: 21138 LTARNIVGE 21146



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             +V    G++  +   ++G P PT+ W +DGK L + T   E+   +    LV K      
Sbjct: 21470 TVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL-EGTAKLEIKIADFSTNLVNKDSTRRD 21528

Query: 720   AGQYEILLKNRVG 732
             +G Y +   N  G
Sbjct: 21529 SGAYTLTATNPGG 21541



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 2/75 (2%)

Query: 1696  RDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
             RD+ VV+ G   + +  I G P P + W KD   I E    +I    D +  L + D   
Sbjct: 25796 RDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEI-ISTDNHTLLTVKDCIR 25854

Query: 1755  DDDAKYTCKAVNSLG 1769
              D  +Y     N  G
Sbjct: 25855 RDTGQYVLTLKNVAG 25869



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 19/71 (26%), Positives = 30/71 (42%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V V+ G   +    I+G+P P+VT  +  VPL+ + R +         + +      D G
Sbjct: 26486 VYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAG 26545

Query: 230   VYTCLVVNGSG 240
              Y     N SG
Sbjct: 26546 RYEITAANSSG 26556



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDA-KYT 1761
             G++ R     +G P P  VW K D ++      + D     + S +  + C  +DA KYT
Sbjct: 28372 GASIRLFIAYQGRPTPTAVWSKPDSNL----SLRADIHTTDSFSTLTVENCNRNDAGKYT 28427

Query: 1762  CKAVNSLGEATCT 1774
                 N+ G  + T
Sbjct: 28428 LTVENNSGSKSIT 28440



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 456   VIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCEAGVAELHIQDALPEDHGTYTC 514
             V +G    L   ++G P P   W   GQ I + A         EL I++A   D GTY  
Sbjct: 30148 VRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDL 30207

Query: 515   LAENALGQ 522
             + EN  G+
Sbjct: 30208 VLENKCGK 30215


>gi|110349717 titin isoform novex-2 [Homo sapiens]
          Length = 27118

 Score =  295 bits (755), Expect = 3e-79
 Identities = 217/812 (26%), Positives = 353/812 (43%), Gaps = 130/812 (16%)

Query: 1028  APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTT--KFIILSQEGSLCS 1085
             AP FK++L++++V       L C+V+  P   + W   GK +     K+ I   +G    
Sbjct: 24622 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQ 24681

Query: 1086  VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVL 1145
             + I     +D  +Y+  A N  G    +  + V+                          
Sbjct: 24682 LIIASVTDDDATVYQVRATNQGGSVSGTASLEVE-------------------------- 24715

Query: 1146  GTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF 1205
                             P K  +P  +        +R GE V +    +G      TW K 
Sbjct: 24716 ---------------VPAKIHLPKTLEGMGAVHALR-GEVVSIKIPFSGKPDPVITWQKG 24759

Query: 1206  RKQIQESEHMKVENSENGSKLTIL-AARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP 1264
             +  I  + H +V  + + + L       ++  G Y +  +N+ G  Q  V L V D PDP
Sbjct: 24760 QDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDP 24819

Query: 1265  PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQD 1324
             P G    SD+   S+ L+W   + DGGS + +Y +E   +  + W  +   R T + V +
Sbjct: 24820 PRGVK-VSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETRYTVIN 24878

Query: 1325  LLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVT 1384
             L     Y+FRV A N +G S+PS+ SE T   E      +  E  D+     EV     +
Sbjct: 24879 LFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETR---EVSMTKAS 24935

Query: 1385  INTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIM 1444
              ++ +++ + Y I E LG G+FG V R VE  ++K +  KF K     ++  +++EISI+
Sbjct: 24936 HSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKV-KGTDQVLVKKEISIL 24994

Query: 1445  NCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGV 1504
             N   H  ++   ++FE    +VM+ E +SG ++FERI    FEL ERE + Y+ Q+ E +
Sbjct: 24995 NIARHRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEAL 25054

Query: 1505  EYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVI 1564
             +++H   I H D++PENI+   +  + IK+I+FG AR+L+   + ++LF  PE+ APEV 
Sbjct: 25055 QFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVH 25114

Query: 1565  NYEPIGYATDMWSIGVICYIL--------------------------------------- 1585
              ++ +  ATDMWS+G + Y+L                                       
Sbjct: 25115 QHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKEISIEAM 25174

Query: 1586  ------------NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVR 1633
                         +R+  ++ LQHPWL +  + +  K +   + ++Y      +K  N V 
Sbjct: 25175 DFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYY-HTLIKKDLNMVV 25233

Query: 1634  AIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSK 1693
             +  R+S    I      +S  G   + +    +E    VS   + AV EE  HVK     
Sbjct: 25234 SAARISCGGAI------RSQKGVSVAKVKVASIEI-GPVSGQIMHAVGEEGGHVK----- 25281

Query: 1694  TIRDLEVVEGSAARFDCKIEGY-PDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDV 1752
                           + CKIE Y    +V W+   + +  S  ++I Y EDG   L + D+
Sbjct: 25282 --------------YVCKIENYDQSTQVTWYFGVRQLENSEKYEITY-EDGVAILYVKDI 25326

Query: 1753  CGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
                DD  Y CK VN  GE +  AEL V+ + E
Sbjct: 25327 TKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE 25358



 Score =  166 bits (420), Expect = 2e-40
 Identities = 161/707 (22%), Positives = 277/707 (39%), Gaps = 57/707 (8%)

Query: 63    QVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELT 122
             +VTW+++G+ +   G F       GT+ L I+ + E D+G+Y CE +   G  +  ++  
Sbjct: 26443 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 26502

Query: 123   VEG-----------SFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVV 171
              +            S  K+  Q     T+  +    A E   S      P   T L    
Sbjct: 26503 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISS-----KPVIVTGLQDTT 26557

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             V    + +F+ K TG P+P   W K    +    +  +SE  G   LEIH  +  D G+Y
Sbjct: 26558 VSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLY 26617

Query: 232   TCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAA 291
             TC V N +G  S S +L+I+ +       V   K   S++  +   V+ +E      + A
Sbjct: 26618 TCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQK--TSEITPQKKAVVQEEIS----QKA 26671

Query: 292   AKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQK--TSSSITLQA 349
              +S+     +       A   +      S  E  K S  T+ +  ++ +  T +S   + 
Sbjct: 26672 LRSEEIKMSEAKSQEKLALKEEASKVLIS--EEVKKSAATSLEKSIVHEEITKTSQASEE 26729

Query: 350   ARVQPEPRAPGLGVLSPSGEERKRPAPPRPAT---FPTRQPGLGSQD-----VVSKAANR 401
              R   E +A    +    G+     A    AT   +      L + +     V       
Sbjct: 26730 VRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTL 26789

Query: 402   RIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQD 461
              I     RD       SK +   VK    +    E    +  AP+F S  +   + EGQ+
Sbjct: 26790 TIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKE----LSDAPAFISQPRSQNINEGQN 26845

Query: 462   FVLQCSVRGTPVPRITWLLNGQPIQYARSTC---EAGVAELHIQDALPEDHGTYTCLAEN 518
              +  C + G P P I W  N  PI  + +        V  L I++A   D G YT  A+N
Sbjct: 26846 VLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKN 26905

Query: 519   ALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVS 578
               GQ S +A            S  +LP+   +P+  + L+   D   + GS  + +VQ+S
Sbjct: 26906 FRGQCSATA------------SLMVLPLV-EEPSREVVLRTSGDTS-LQGSFSSQSVQMS 26951

Query: 579   GNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQ 638
              +         + +      +  F     Q    +QE F E + +      N   ++ + 
Sbjct: 26952 ASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT-QLESS 27010

Query: 639   AVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL-CKDTG 697
                 ++    G  P   + P  ++   G+ + ++CA  G+P P V W   G+ +  ++ G
Sbjct: 27011 TSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQG 27070

Query: 698   HFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQN 744
              F +   +D+ TL++  VQ    G Y + L N  G  S  V++ +++
Sbjct: 27071 RFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS 27117



 Score =  122 bits (306), Expect = 3e-27
 Identities = 158/734 (21%), Positives = 285/734 (38%), Gaps = 96/734 (13%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G  + ++  I G PFP   W ++G+ + K      +  +E    LV+K+     +G Y++
Sbjct: 23846 GGVIRLTIPIKGKPFPICKWTKEGQDISK---RAMIATSETHTELVIKEADRGDSGTYDL 23902

Query: 726   LLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGV------GADGGGSDRYGS 779
             +L+N+ G+ +  + + +  S     P G  P   +D+    V       AD GG+D  G 
Sbjct: 23903 VLENKCGKKAVYIKVRVIGSPNS--PEG--PLEYDDIQVRSVRVSWRPPADDGGADILGY 23958

Query: 780   LRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKK--VS 837
             +          W   +    VRG        +++ E   R     Q      L  +  V+
Sbjct: 23959 ILERREVPKAAWYTID--SRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVT 24016

Query: 838   TKT-LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGT--S 894
              KT L+  +    P E +D   +       +   +   +V +   ++ +     K    +
Sbjct: 24017 PKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRV-TGYYIERKETSTDKWVRHN 24075

Query: 895   KTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNA-KAVESSKPLSNAQPSGP 953
             KT +   +       PD       + ++ A+N    +ET  A + V    P       G 
Sbjct: 24076 KTQITTTMYTVTGLVPDAEY----QFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGE 24131

Query: 954   LKPVGNAKPAETL---KP-MGNAKPAETLKPMGNAKPDENLKSASKEELKKD-------- 1001
             L+ +  +K + TL   KP     K             D   K ++KE +K          
Sbjct: 24132 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 24191

Query: 1002  ----------VKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQ 1051
                        +N+    R    T  + K   + G AP  +++++DV    G+   L CQ
Sbjct: 24192 EATEYEFRVFAENETGLSRPRR-TAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQ 24250

Query: 1052  VSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAE 1111
             +   P   I W   GK L  ++   +S +G   ++++     ED G+Y C+A N+ G+ E
Sbjct: 24251 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 24310

Query: 1112  CSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQI 1171
              S ++ +   P                                    P  P K       
Sbjct: 24311 TSSKLLLQATPQFH---------------------------------PGYPLK------- 24330

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTIL-A 1230
                 E      G ++ L     G      TW   +K +Q SE++ +EN+E+ + L +   
Sbjct: 24331 ----EKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNV 24386

Query: 1231  ARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDG 1290
              R+ H G Y + + N  G+  A +++ + DKPD P G      +  +S  +SW   + DG
Sbjct: 24387 QRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDG 24446

Query: 1291  GSAVQSYSIEIWDS-ANKTWKELATCRS-TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1348
             GS + +Y +E  ++     W+ +++  S T+  + +L  +  Y FRV A N +G S+P +
Sbjct: 24447 GSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLE 24506

Query: 1349  ESELTTVGEKPEEP 1362
              S +  +    E+P
Sbjct: 24507 VSSVVIIKSPFEKP 24520



 Score =  118 bits (295), Expect = 6e-26
 Identities = 175/807 (21%), Positives = 305/807 (37%), Gaps = 149/807 (18%)

Query: 552  TAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSL 611
            T P  + GL ++ V++G  VT+   +SG P P V W     +I+ S DF    +     L
Sbjct: 895  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 954

Query: 612  CIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQE-------------------------- 645
             I+E F ED+G +TC A N AG V T   L VQ                           
Sbjct: 955  MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1014

Query: 646  ---------------PHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGK 690
                           P +   P+FI+KP       G SV+  C + G+P P V+W + G 
Sbjct: 1015 DVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1074

Query: 691  ALCKDTGH-FEVLQNEDV--FTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSA 747
             L   TG+ ++V  N+      LV+       AG+Y I+++N+ GE S   SL L+ +  
Sbjct: 1075 PL--TTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL-LEEADY 1131

Query: 748  RALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWP-ARGQGWLEEEDGEDVRGVLKR 806
              L + ++    +      V        + G   PG+  +  +   E+E     + + K 
Sbjct: 1132 ELLMKSQQEMLYQTQVTAFV-----QEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKD 1186

Query: 807  RVETRQHTEEAIRQQEVEQLDFRDLLGKKVS---TKTLSEDDLKEIPAEQMDFRANLQRQ 863
             V  R + E+    QE     F + L K++     KT  E+ L+E   E+M    +    
Sbjct: 1187 TVVVRTYVED----QEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEA 1242

Query: 864  VKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVP--------EKVPPPKPATPDF--- 912
            V+    S  + ++ + + ++   V      S  P+P        +++   +    DF   
Sbjct: 1243 VE----SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQD 1298

Query: 913  -RSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSG-----PLKPVGNAKPAETL 966
             R+ L     LP + G  +A   N K         NA  SG     P  P+G      TL
Sbjct: 1299 GRASLRIPVVLPEDEGIYTAFASNIK--------GNAICSGKLYVEPAAPLGAPTYIPTL 1350

Query: 967  KPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQG 1026
            +P+   +   +L P   ++    +  A     +         +       +    S+ + 
Sbjct: 1351 EPVSRIR---SLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLER 1407

Query: 1027 T-APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT--TKFIILSQEGSL 1083
               P F  K       EG+      +V   P     W  +G+ +    T  +++ ++G+ 
Sbjct: 1408 LYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ 1467

Query: 1084 CSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPP 1143
             S+ I  A P D G +  VA+N AG++  S  +TV+                        
Sbjct: 1468 -SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---------------------- 1504

Query: 1144 VLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWM 1203
                                +  + P  ++  ++  ++ G  +E+  + TG       W+
Sbjct: 1505 --------------------EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWL 1544

Query: 1204 KFRKQIQESEH--MKVENSENGSKLTILAARQEHCGCYTLLVENKLG--SRQAQVNLTV- 1258
            K    I   ++  +++E ++  + L I +   +    YT    NK G  + + +VN+ V 
Sbjct: 1545 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1604

Query: 1259 VDKPDP------PAGTPCASDIRSSSL 1279
              +P+P      P GT  A +I +  L
Sbjct: 1605 FAEPEPERKLIIPRGTYRAKEIAAPEL 1631



 Score =  118 bits (295), Expect = 6e-26
 Identities = 146/697 (20%), Positives = 242/697 (34%), Gaps = 145/697 (20%)

Query: 160  PPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
            PP+   +L  V V+ G+  RF   I+GRPQP+++W K    L    +           L 
Sbjct: 3192 PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLL 3251

Query: 220  IHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVI 279
            +     +D  VYTC   N  G A+                       T++ +  EV  V+
Sbjct: 3252 LIEAFPEDAAVYTCEAKNDYGVAT-----------------------TSASLSVEVPEVV 3288

Query: 280  SKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQ 339
            S + ++     A  +    +    G P   A  Q +        S     +    +   +
Sbjct: 3289 SPDQEMPVYPPAIITPLQDTVTSEGQP---ARFQCRVSGTDLKVSWYSKDKKIKPSRFFR 3345

Query: 340  KTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAA 399
             T    T Q    +  P   G      S    +  +    A        L  Q    K  
Sbjct: 3346 MTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSST---ANLSLEVQALDRQSS-GKDV 3401

Query: 400  NRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFR------------------------- 434
                  +   DS+F K ESK   +E+K  Q   +                          
Sbjct: 3402 RESAKSQAVADSSFTKEESKISQKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQL 3461

Query: 435  CEGLAVMEVAPSFSSVLKDCA----------VIEGQDFVLQCS--------VRGTPVPRI 476
            C   ++ ++A S + + K+CA           +  QD  ++C         ++      +
Sbjct: 3462 CHTASLSQIAES-TELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDV 3520

Query: 477  TWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVH- 532
            TW   G  I+ +   + +    +  L I +    D G Y+C+  N  G+ + SA ++V  
Sbjct: 3521 TWTHEGAKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEG 3580

Query: 533  ----------------------------EKKSSRKSEYLL-------------PVAPSK- 550
                                        E++    +E  L             PV P+K 
Sbjct: 3581 APESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKF 3640

Query: 551  -----PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQR 605
                  T PIF++ +S+  +  G   T++V V G P P++ W  NG  +  S D+ F   
Sbjct: 3641 DSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFD 3700

Query: 606  GTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQ---EPHDGTQ----------- 651
            G  HSL I     ED G YTC A N  G+    A L +    E H  T+           
Sbjct: 3701 GDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEK 3760

Query: 652  ------PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNE 705
                  P F+ + + +  + G   +    + G+P PTV W ++ K LC    +  +    
Sbjct: 3761 LGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPN 3820

Query: 706  DVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLML 742
               T ++   Q   +G Y    +N +GE +C   L++
Sbjct: 3821 GSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score =  113 bits (282), Expect = 2e-24
 Identities = 211/1044 (20%), Positives = 358/1044 (34%), Gaps = 249/1044 (23%)

Query: 533   EKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGN 592
             +K S RK E L     +   AP     +   +V  G      + V   P  EV W HNG 
Sbjct: 26048 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 26107

Query: 593   EIQESE----------------DFHFEQRGTQHSLCI----------------------- 613
             E+QES                 D H +  GT  ++C                        
Sbjct: 26108 ELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYA 26167

Query: 614   ---------QEVFPEDTGTYT-----------CEAWNSAGEVRTQAVLTVQE----PHDG 649
                      + VFPE T T              EA +S  EV++Q   T +      H  
Sbjct: 26168 SQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSA 26227

Query: 650   TQPW--------------------------FISKPRSVTASLGQSVLISCAIAGDPFPTV 683
             +                              ++KPRS+T   G+S   SC   G+P PTV
Sbjct: 26228 SAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTV 26287

Query: 684   HWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
              WLR G+ L     H +V   +   T  +  VQ    G Y ++++N  G+   + +L +Q
Sbjct: 26288 TWLRKGQVLSTSARH-QVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 26346

Query: 744   NS------------------------SARALPRGREPASCEDLCGGGVGADGGGSDRYGS 779
              +                        + ++  R + P                 +++   
Sbjct: 26347 KARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQH 26406

Query: 780   LRPGWPARGQGWLEEEDGEDVR--------GVLKRRVETRQHTEEAIRQQEVEQLDFRDL 831
             L    P +   +L+ E  +++          VL+ +  T     + +++    Q  +   
Sbjct: 26407 LPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSAD 26466

Query: 832   LGKKVSTKTLSEDD----LKEIPAEQMDFRANLQRQVKP-KTVSEEERKVHSPQQVDFR- 885
                ++    L+E D    + EI  E    + NLQ   +  K++ E+  K+   ++ D + 
Sbjct: 26467 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 26526

Query: 886   --SVLAKKGTSKTPVPEKVPP--------------------------PKPA---TPDFRS 914
               S + +K   K P P    P                          P+P    T D ++
Sbjct: 26527 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 26586

Query: 915   VL-GGKKKLPAENGS---------------------------SSAETLNAKAVESSKPLS 946
             +  GGK KL  + G                            SS+  L  KA++ ++   
Sbjct: 26587 ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 26646

Query: 947   -NAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENL---KSASK----EEL 998
              + Q +  + P   A   E +     A  +E +K M  AK  E L   + ASK    EE+
Sbjct: 26647 VSTQKTSEITPQKKAVVQEEISQ--KALRSEEIK-MSEAKSQEKLALKEEASKVLISEEV 26703

Query: 999   KKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPA 1058
             KK     +     H   T   + SE   T    K     + + EG++L+L+  ++     
Sbjct: 26704 KKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG--AT 26761

Query: 1059  TIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
              + W LNG  L  ++       GS  +++I++A   D G+  C++K   G  +C   +T+
Sbjct: 26762 DVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL 26821

Query: 1119  DDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQ 1178
                       + E+                SDA                 P  I  P  Q
Sbjct: 26822 ----------SKEL----------------SDA-----------------PAFISQPRSQ 26838

Query: 1179  KVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
              +  G++V    +++G       W K    I  S ++ +  S N   L I  A     G 
Sbjct: 26839 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 26898

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYS 1298
             YT+  +N  G   A  +L V+   + P+          +SL  S+   S    ++ Q  S
Sbjct: 26899 YTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEAS 26958

Query: 1299  IEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ----ESELTT 1354
                + S++ +   +   +  S + Q +    E    + + +  G S  +Q     S++  
Sbjct: 26959 FSSFSSSSAS--SMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLK 27016

Query: 1355  VGEKPEEPKDEVEVSDDDEKEPEV 1378
              G +   PK E   SD    E +V
Sbjct: 27017 AGIRGIPPKIEALPSDISIDEGKV 27040



 Score =  111 bits (278), Expect = 6e-24
 Identities = 67/201 (33%), Positives = 103/201 (51%), Gaps = 4/201 (1%)

Query: 1167  MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKL 1226
             +PP+I+  PE   ++AG+ + +   V G    TC W K   ++  S H+ V  +++ S L
Sbjct: 12593 LPPKILM-PEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSIL 12651

Query: 1227  TILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGS 1286
              I    ++  G Y+L  EN  G+   ++ + V+D P PP      SDI + + +LSW+  
Sbjct: 12652 IIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIP 12711

Query: 1287  SYDGGSAVQSYSIEIWDSANKTW-KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSE 1345
               DGGS + +Y +E  D +   W   LA+   TS  V  L+P  EY FRVRA N +G SE
Sbjct: 12712 LEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISE 12771

Query: 1346  PSQESELTTVGE--KPEEPKD 1364
             P    ++        P EPK+
Sbjct: 12772 PLTSPKMVAQFPFGVPSEPKN 12792



 Score =  110 bits (276), Expect = 9e-24
 Identities = 154/692 (22%), Positives = 268/692 (38%), Gaps = 99/692 (14%)

Query: 63   QVTWHRNGQPITSGGRF--LLDCGIRGTFSLVIHAVHEED-RGKYTCEATNGSGARQVTV 119
            +V W+   + + S  +F  L D   + T++LVI  V+ ED +G+Y CEA N SG    + 
Sbjct: 4463 EVNWYFENKLVPSDEKFKCLQD---QNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSA 4519

Query: 120  ELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGR 179
            +LTV    A     PV+ +                           K+  + V  G + +
Sbjct: 4520 KLTVVKRAA-----PVIKR---------------------------KIEPLEVALGHLAK 4547

Query: 180  FSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGS 239
            F+C+I   P  +  W K    +  S + S+     +  LEI      D G YTC   N  
Sbjct: 4548 FTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEY 4607

Query: 240  GKASMSAEL--SIQGLDSANRSFVRETKATNSDVRKEVT--NVISKESKLDSLEAAAKS- 294
            G  S +A L  ++ G +   R  + E K    + ++EV   +V+ K  + +  +   K  
Sbjct: 4608 GSVSCTATLTVTVPGGEKKVRKLLPERK---PEPKEEVVLKSVLRKRPEEEEPKVEPKKL 4664

Query: 295  KNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQP 354
            +    P     PP      P+P  E ++ +     R  P+   + +   +I L A   +P
Sbjct: 4665 EKVKKPAVPEPPP------PKPVEEVEVPTVTKRERKIPEPTKVPEIKPAIPLPAPEPKP 4718

Query: 355  EPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFP 414
            +P A    +  P  E    P    P T P       ++    +AA  + P++G       
Sbjct: 4719 KPEAEVKTIKPPPVEPEPTPI-AAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPS 4777

Query: 415  KFES-----KPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIE----GQDFVLQ 465
              E+     +P S   K      F  +   +  V   F   +KD  + E    G   + +
Sbjct: 4778 PIEAERRKLRPGSGGEKPPDEAPFTYQ---LKAVPLKFVKEIKDIILTESEFVGSSAIFE 4834

Query: 466  CSVRGTPVPRI-TWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALG 521
            C V  +P   I TW+ +G  I+ +   R   +    +LHI D    D G YTC+      
Sbjct: 4835 CLV--SPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNK 4892

Query: 522  QVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGL-SDLKVMDGSQVTMTVQVSGN 580
            + + +A + V E          LPV         F++ L  ++ V+ G  + ++ ++  N
Sbjct: 4893 EKTSTAKLVVEE----------LPVR--------FVKTLEEEVTVVKGQPLYLSCEL--N 4932

Query: 581  PPPEVIWLHNGNEIQESEDFHFE-QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQA 639
               +V+W  +G  + E          G   +L I +    D GTYT    N+     +  
Sbjct: 4933 KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSC 4992

Query: 640  VLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL-CKDTGH 698
            V  V+   D    W +   R        + + +C IA D  P + W +    +  +    
Sbjct: 4993 VKVVEVIRD----WLVKPIRDQHVKPKGTAIFACDIAKDT-PNIKWFKGYDEIPAEPNDK 5047

Query: 699  FEVLQNEDVFTLVLKKVQPWHAGQYEILLKNR 730
             E+L++ +   L +K   P    +Y + ++ +
Sbjct: 5048 TEILRDGNHLYLKIKNAMPEDIAEYAVEIEGK 5079



 Score =  110 bits (275), Expect = 1e-23
 Identities = 73/206 (35%), Positives = 104/206 (50%), Gaps = 21/206 (10%)

Query: 444 APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-----RSTCEAGVAE 498
           AP+F+  L+   V+EG     +  + G PVP ++W  +GQ I  +     + +   G A+
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 499 LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQ 558
           L I      + G Y+  A N  GQ + +A + V       K+E     AP     P F+Q
Sbjct: 65  LTIPAVTKANSGRYSLKATNGSGQATSTAELLV-------KAE----TAP-----PNFVQ 108

Query: 559 GLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFP 618
            L  + V  GSQV + V+V+G P P V +  +G EIQ S DF   Q G  +SL I E +P
Sbjct: 109 RLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYP 168

Query: 619 EDTGTYTCEAWNSAGEVRTQAVLTVQ 644
           ED+GTY+  A NS G   + A L VQ
Sbjct: 169 EDSGTYSVNATNSVGRATSTAELLVQ 194



 Score =  109 bits (272), Expect = 3e-23
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 57/306 (18%)

Query: 30  TEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF 89
           T+AP F  P +++ + EG+TA FE  + G+P P+V+W R+GQ I++        G++ +F
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTL----PGVQISF 58

Query: 90  S-----LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRF 144
           S     L I AV + + G+Y+ +ATNGSG    T EL V+   A                
Sbjct: 59  SDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA---------------- 102

Query: 145 SAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS 204
                          PP F  +L  + V++G   R   ++TG P P V + +    +Q S
Sbjct: 103 ---------------PPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSS 147

Query: 205 ARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQG------------ 252
               +S++  +  L I     +D G Y+    N  G+A+ +AEL +QG            
Sbjct: 148 LDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTI 207

Query: 253 LDSANRSFVRETKATNS-DVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAAN 311
           + +A  S  R+T+     +   +  ++ + E  +D   AA +     +P R   PP   +
Sbjct: 208 VSTAQISESRQTRIEKKIEAHFDARSIATVEMVIDG--AAGQQLPHKTPPR--IPPKPKS 263

Query: 312 SQPQPP 317
             P PP
Sbjct: 264 RSPTPP 269



 Score =  109 bits (272), Expect = 3e-23
 Identities = 65/193 (33%), Positives = 101/193 (52%), Gaps = 3/193 (1%)

Query: 1180 VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
            V+AG  +EL   VTG      TW K    +++ + + +EN    S +TI+ +++   G Y
Sbjct: 7397 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 7456

Query: 1240 TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             +   N  G   A V + V+DKP PPA     +D+ + S  L+W     DGGS + +Y +
Sbjct: 7457 IIEAVNVCGRATAVVEVNVLDKPGPPAAFD-ITDVTNESCLLTWNPPRDDGGSKITNYVV 7515

Query: 1300 EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGE- 1357
            E   + ++ W +L +T + T+F    L+P+ EY FRV A N+YG  EP Q S +T   + 
Sbjct: 7516 ERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQF 7575

Query: 1358 KPEEPKDEVEVSD 1370
             P  P   +E SD
Sbjct: 7576 DPPGPPTRLEPSD 7588



 Score =  107 bits (266), Expect = 1e-22
 Identities = 159/700 (22%), Positives = 240/700 (34%), Gaps = 154/700 (22%)

Query: 40   RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEE 99
            +N  I EG    F  ++ GYP P++ W+++G+ I  G R+ +D    G  SL I  V  E
Sbjct: 1252 KNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPE 1311

Query: 100  DRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGD----RFSAPAVETRPSI 155
            D G YT  A+N  G    + +L VE   A  LG P    TL      R  +P   +R  I
Sbjct: 1312 DEGIYTAFASNIKGNAICSGKLYVEP--AAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPI 1369

Query: 156  WGE------------------------------------CPPKFATKLGRVVVKEGQMGR 179
                                                     P F  K       EGQ  R
Sbjct: 1370 RMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTAR 1429

Query: 180  FSCKITGRPQPQVTWL-KGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG 238
            F  K+ GRP P+  W   G   +       V +++G Q L I      D G +T +  N 
Sbjct: 1430 FDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNR 1489

Query: 239  SGKASMSAELSIQGLD-SANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNC 297
            +G++S+S  L+++ ++      FV + K  N          I + S+L+    A  + N 
Sbjct: 1490 AGRSSISVILTVEAVEHQVKPMFVEKLKNVN----------IKEGSRLEMKVRATGNPN- 1538

Query: 298  SSPQRGGSPPWAANSQ---PQPPRESKLESCKDSPRTAPQTPVLQ--------------- 339
                      W  NS    P    + ++E  K        + V Q               
Sbjct: 1539 ------PDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR 1592

Query: 340  -KTSSSITLQAARVQPEPRAPGLGVLSPSGEER-KRPAPP--RPATFPTRQPGLGSQDVV 395
              T   + ++    +PEP      ++ P G  R K  A P   P      Q      D+ 
Sbjct: 1593 DTTRCKVNVEVEFAEPEPERK---LIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLY 1649

Query: 396  SKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCA 455
             K   ++           P F+ K  S  +K      F C    +               
Sbjct: 1650 DKEKQQK-----------PFFKKKLTSLRLKRFGPAHFECRLTPI--------------- 1683

Query: 456  VIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTY 512
                          G P   + WL +G+P++ A   R   E G   L    A   D G  
Sbjct: 1684 --------------GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGII 1729

Query: 513  TCLAENALGQVSCSAWVTVHEKKSSRKSEYL------------------------LPVAP 548
            TC A N  G    SA + V ++KS  +   L                        +    
Sbjct: 1730 TCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQ 1789

Query: 549  SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQ 608
             +   P  +     ++V++G       +V+G P P+V W  NG  I++S+ F     G  
Sbjct: 1790 KEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI- 1848

Query: 609  HSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
            H L I +    DTG     A N  G +  +  L +Q+  D
Sbjct: 1849 HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1888



 Score =  102 bits (253), Expect = 4e-21
 Identities = 57/185 (30%), Positives = 97/185 (52%), Gaps = 7/185 (3%)

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAA 1231
             +++ E  K RAG SV+L   ++G    T  W K  K++Q +  + VEN+ + + + I  A
Sbjct: 20571 LEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDA 20630

Query: 1232  RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGG 1291
              + + GCY L + N +GS  A + + ++DKP PP G      + +  +TL W   + DGG
Sbjct: 20631 DRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGG 20690

Query: 1292  SAVQSYSIEIWDSANKTW----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             + +  Y +E  +++   W    + L  C  T+  +   +  +EY FRVRA+N YG  EP 
Sbjct: 20691 AKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI---IKGNEYIFRVRAVNKYGIGEPL 20747

Query: 1348  QESEL 1352
             +   +
Sbjct: 20748 ESDSV 20752



 Score =  101 bits (252), Expect = 6e-21
 Identities = 76/249 (30%), Positives = 112/249 (44%), Gaps = 8/249 (3%)

Query: 1167  MPPQI---IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENG 1223
             +PP +   ++  E   V+AG +V     + G    T  W     +I+  EH  VE     
Sbjct: 11201 VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 11260

Query: 1224  SKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSW 1283
             S LTI    +   G Y + V N  GS+   V+LTV+D P PP G     D+    +T+SW
Sbjct: 11261 SVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISW 11320

Query: 1284  YGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQDLLPDHEYKFRVRAINVYG 1342
                  DGGS V +Y +E  D+   TW  +++  S T   +  L    EY FRVRA N  G
Sbjct: 11321 QPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIG 11380

Query: 1343  TSEPSQESELTTVGEK--PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEER 1400
                P  +S  T    K  P  P  +  V+D  E    V +     +    ++ +Y +E R
Sbjct: 11381 VG-PPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYY-MERR 11438

Query: 1401  LGSGKFGQV 1409
               +GK+ +V
Sbjct: 11439 EVTGKWVRV 11447



 Score =  101 bits (252), Expect = 6e-21
 Identities = 58/205 (28%), Positives = 104/205 (50%), Gaps = 6/205 (2%)

Query: 1162  PPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE 1221
             PP+ +M P+   + +   V AGES ++   + G    T  W+K  +++  +  +++++++
Sbjct: 16235 PPRISMDPK---YKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTD 16291

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
               + L++  A +   G Y L  +N  G R   VN+ V+D+P PP G    S + +   TL
Sbjct: 16292 FATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTL 16351

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             +W     DGGS + +Y +E  +++   W  + A  ++ S  V  LL  +EY FR+ A+N 
Sbjct: 16352 AWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNK 16411

Query: 1341  YGTSEPSQESELTTVGE--KPEEPK 1363
             YG  EP +   +        P+ PK
Sbjct: 16412 YGVGEPLESEPVVAKNPFVVPDAPK 16436



 Score =  101 bits (251), Expect = 7e-21
 Identities = 78/253 (30%), Positives = 112/253 (44%), Gaps = 15/253 (5%)

Query: 1174  FPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQ 1233
             F +   VRAG S+ LF    G    T  W K    +  S    +  +++ S LT+    +
Sbjct: 22058 FKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNR 22115

Query: 1234  EHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSA 1293
                G YTL VEN  GS+     + V+D P PP G     D+   S TL W     DGG+ 
Sbjct: 22116 NDAGKYTLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATLMWDAPLLDGGAR 22174

Query: 1294  VQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESEL 1352
             +  Y +E  +++ ++W+ ++  C    F V DL     Y FRV A+N YG  EP +  E 
Sbjct: 22175 IHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 22234

Query: 1353  TTVGEKPEEPK--DEVEVSDDDE----KEPEVD----YRTVTINTEQKVSDFYDIEERLG 1402
                 E+P  P+  D V+ S         +P+ D         +   QK SDF+ +E    
Sbjct: 22235 IVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFW-VEAGHT 22293

Query: 1403  SGKFGQVFRLVEK 1415
                   V RLVEK
Sbjct: 22294 KQLTFTVERLVEK 22306



 Score =  100 bits (250), Expect = 1e-20
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 20/255 (7%)

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAA 1231
             ++F +   ++AGE+  L   V+G  P T  W K  K+++ +  ++++ ++  + L    +
Sbjct: 15160 VKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS 15219

Query: 1232  RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGG 1291
              +   G YTL   N  G  +   N+ V+D+P PP G    +++ S    LSW+    DGG
Sbjct: 15220 TRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGG 15279

Query: 1292  SAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
             + +  Y ++  +++   W  +A+  + T   V  LL  +EY FRV A+N YG  EP +  
Sbjct: 15280 AKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESE 15339

Query: 1351  ELTTVGE--KPEEPKD-EVEVSDDDEK-----EPEVDYRTVTINTEQKVSDFYDIEERLG 1402
              +  V     P+ PK+ EV     D        P+ D  +  IN        Y +E R  
Sbjct: 15340 PVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIIN--------YIVERR-- 15389

Query: 1403  SGKFGQVFRLVEKKT 1417
               K GQ +    KKT
Sbjct: 15390 -DKAGQRWIKCNKKT 15403



 Score =  100 bits (249), Expect = 1e-20
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V AGE +++     G      TW K    ++++  +  E++EN S LTI  A +E  G Y
Sbjct: 15854 VLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHY 15913

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + + N  G     +N+ V+DKP PP G     ++ + S+TLSW    YDGGS++ +Y +
Sbjct: 15914 VVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIV 15973

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTS 1344
             E  D++  TW+ + AT   T+     L    EY+FR+ A N YG S
Sbjct: 15974 EKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKS 16019



 Score =  100 bits (248), Expect = 2e-20
 Identities = 76/305 (24%), Positives = 116/305 (38%), Gaps = 60/305 (19%)

Query: 443  VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI----QYARSTCEAGVAE 498
            V   F S +K+  ++EG      C + G P+P+I W  +G+ I    +Y     + G A 
Sbjct: 1243 VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRAS 1302

Query: 499  LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEY---LLPVAPSKPTAP- 554
            L I   LPED G YT  A N  G   CS  + V          Y   L PV+  +  +P 
Sbjct: 1303 LRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPR 1362

Query: 555  -------------------------------------------------IFLQGLSDLKV 565
                                                             +F+      K 
Sbjct: 1363 SVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKC 1422

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEI--QESEDFHFEQRGTQHSLCIQEVFPEDTGT 623
            ++G      ++V G P PE  W H+G +I    +     ++ GTQ SL I    P D+G 
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ-SLIIVPATPSDSGE 1481

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
            +T  A N AG      +LTV+      +P F+ K ++V    G  + +     G+P P +
Sbjct: 1482 WTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDI 1541

Query: 684  HWLRD 688
             WL++
Sbjct: 1542 VWLKN 1546



 Score =  100 bits (248), Expect = 2e-20
 Identities = 66/237 (27%), Positives = 109/237 (45%), Gaps = 19/237 (8%)

Query: 1167  MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF-------RKQIQESEHMKVEN 1219
             MPP I    E  +V  G +V +  K+ G    T TW K        ++ +    H+    
Sbjct: 9811  MPPSI-DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLV 9869

Query: 1220  SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSL 1279
              ++   L I  +R+   G YT+   N LG+   ++ L V+ +P PP G      + +  +
Sbjct: 9870  VDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQM 9929

Query: 1280  TLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAI 1338
             TLSW+    DGGS + +Y IE  ++  KTW  +++  +  ++ +  LL  HEY FR+ A 
Sbjct: 9930  TLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQ 9989

Query: 1339  NVYGTSEPSQESELTTVGEKPEEPKD--EVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             N YG  EP        +  +PE  ++   V  + D      V   ++T+N E+   D
Sbjct: 9990  NKYGIGEP--------LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYD 10038



 Score = 99.4 bits (246), Expect = 3e-20
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 4/189 (2%)

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
             P+ +M P+   F +   V AGE+  L   V G    T  W++  K+I+ES   +++N++ 
Sbjct: 17318 PRISMDPK---FRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 17374

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLS 1282
              + L +  A +   G Y L   N  GS+   VN+ V+D+P PP G    + + S   +L+
Sbjct: 17375 KALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLT 17434

Query: 1283  WYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVY 1341
             W     DGGS +  Y +E  +++   W  +A+   + S  V  LL  +EY FR+ A+N Y
Sbjct: 17435 WSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKY 17494

Query: 1342  GTSEPSQES 1350
             G  EP + +
Sbjct: 17495 GVGEPLESA 17503



 Score = 99.0 bits (245), Expect = 4e-20
 Identities = 98/385 (25%), Positives = 150/385 (38%), Gaps = 54/385 (14%)

Query: 302  RGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGL 361
            R  SP +  +    P  E   E+       A     L  TSS     A ++    +AP  
Sbjct: 764  RTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSS-----AQKITKSVKAP-- 816

Query: 362  GVLSPSGEERKRPAPPRPATFP------TRQPGLGSQDVVSKAANRRIPMEGQRDSAFPK 415
              + PS E R R  P     FP      T +   G +  V K     I     R+  F  
Sbjct: 817  -TVKPS-ETRVRAEPTPLPQFPFADTPDTYKSEAGVE--VKKEVGVSITGTTVREERFEV 872

Query: 416  FESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPR 475
               +    E K  +T +     + +    P+  S LK+  VIEG+   L+C + G P P 
Sbjct: 873  LHGR----EAKVTETARVPAP-VEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPT 927

Query: 476  ITWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVH 532
            +TW      I+ +   + T ++G+A L I++A  ED G +TC A N  G VS S ++ V 
Sbjct: 928  VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ 987

Query: 533  -----EKKSSRKSEYLLP----------------------VAPSKPTAPIFLQGLSDLKV 565
                 EK+++  +E                            P +P AP F+      K+
Sbjct: 988  VSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKL 1047

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF--HFEQRGTQHSLCIQEVFPEDTGT 623
            ++G  V    QV GNP P V W  +G  +     +   + ++  +  L I   F +D G 
Sbjct: 1048 VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGE 1107

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHD 648
            YT    N  GE    A L  +  ++
Sbjct: 1108 YTIVVRNKHGETSASASLLEEADYE 1132



 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 55/168 (32%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VR G +V L     G    + +W+K    ++ESE ++   +EN   L+I  A++EH G Y
Sbjct: 21270 VRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKY 21329

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T++++N +      + +  +  P  P G     +I++ S+ LSW     +GG  +  YSI
Sbjct: 21330 TVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSI 21389

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             E  +++   WK + ++   T+F V +L+ D EY+FRVRA N YG S+P
Sbjct: 21390 EKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQP 21437



 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 56/168 (33%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+AG +V L   V G    T +W K    ++ +E +K+    N   L + +  ++  G Y
Sbjct: 13002 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 13061

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T+  EN  GS+ A + L V+DKP PPA     + + S    LSW     DGGS + +Y +
Sbjct: 13062 TITAENSSGSKSATIKLKVLDKPGPPASVK-INKMYSDRAMLSWEPPLEDGGSEITNYIV 13120

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             +  +++   W ++ AT   TS +V+ L+  HEY+FR+ A N YG  +P
Sbjct: 13121 DKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP 13168



 Score = 96.3 bits (238), Expect = 2e-19
 Identities = 57/211 (27%), Positives = 97/211 (45%), Gaps = 7/211 (3%)

Query: 1159  PKTPPKAAMPPQI-IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKV 1217
             P T      PP + + F +   +R GE+  L G+ +G      +W K    + E +   +
Sbjct: 10503 PITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHI 10562

Query: 1218  ENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSS 1277
             + +     L  + A++   G Y ++VEN  GSR+    + VVD+P PP G     ++   
Sbjct: 10563 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKD 10622

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQDLLPDHEYKFRVR 1336
              + +SW     DGGS + +Y IE  +     W  + +  + T+  V  LL   +Y FR+ 
Sbjct: 10623 YMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIH 10682

Query: 1337  AINVYGTSEPSQESELTT-----VGEKPEEP 1362
             A N+YG S+P     +       V + P++P
Sbjct: 10683 AENLYGISDPLVSDSMKAKDRFRVPDAPDQP 10713



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 158/697 (22%), Positives = 252/697 (36%), Gaps = 128/697 (18%)

Query: 21   PSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFL 80
            P +++  P  EAP      ++  + +G+ A F  RV G P+P+  W++NG  I    R  
Sbjct: 2020 PDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIY 2079

Query: 81   LDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTL 140
                      LVI  V  ED      +A N +G       L V+   AKQL         
Sbjct: 2080 WYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ---AKQL--------- 2127

Query: 141  GDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQ-MGRFSCKITGRPQPQVTWLKGNV 199
                                  F  +L  VV KE   M  F C+ T  P  +V W K  +
Sbjct: 2128 --------------------ITFTQELQDVVAKEKDTMATFECE-TSEPFVKVKWYKDGM 2166

Query: 200  PLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRS 259
             +    +  +     +  L I  ++  D   Y+C++V        +A+L ++G   A   
Sbjct: 2167 EVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN-VKTTAKLIVEG---AVVE 2222

Query: 260  FVRETKATN--SDVRKEVTNVISKES-----KLDSLEAAAKSKNCSSPQRGGSPPWAANS 312
            FV+E +          E+  ++S E+       + +E  +  K   + +RG       + 
Sbjct: 2223 FVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDV 2282

Query: 313  QPQPPRE------SKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAP---GLGV 363
              +   E       K  +CK   +  P   +LQ  S     +   VQ E +       GV
Sbjct: 2283 TKEDQGEYSFVIDGKKTTCKLKMKPRP-IAILQGLSDQKVCEGDIVQLEVKVSLESVEGV 2341

Query: 364  LSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQ 423
                G+E               QP      V+ K ++  +  +  ++ A           
Sbjct: 2342 WMKDGQEV--------------QPSDRVHIVIDKQSHMLLIEDMTKEDA----------- 2376

Query: 424  EVKENQTVKFRCEGLAVMEVAPSFS----SVLKDCAVIEGQDFVLQCSVRGTPVPRITWL 479
                N +      GL+       +S    + LKD  VIEG   VL+C V    V  + W 
Sbjct: 2377 ---GNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWY 2433

Query: 480  LNGQPIQ---YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKS 536
            LN + I+     ++  +     L I      D G Y  +    +G+V  +  ++V + K 
Sbjct: 2434 LNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLI----VGRVETNCNLSVEKIK- 2488

Query: 537  SRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQE 596
                                ++GL DL   +   V   V++S +   +V+W     EI+ 
Sbjct: 2489 -------------------IIRGLRDLTCTETQNVVFEVELS-HSGIDVLWNFKDKEIKP 2528

Query: 597  SEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS 656
            S  +  E  G  + L +  +  +D G YT      AGE  T   LTV           IS
Sbjct: 2529 SSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAGENMTSGKLTV-------AGGAIS 2577

Query: 657  KP-RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL 692
            KP    T +  Q  +  C +A +P     WLRDGK L
Sbjct: 2578 KPLTDQTVAESQEAVFECEVA-NPDSKGEWLRDGKHL 2613



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 69/265 (26%), Positives = 127/265 (47%), Gaps = 11/265 (4%)

Query: 1145 LGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
            +G    + + +    K P      P I     D  V  GE + +          T +W K
Sbjct: 8061 IGVSEPSEISENVVAKDPD---CKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHK 8117

Query: 1205 FRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP 1264
              K+++ S+ + ++N    + L +  + +   G YT+ +ENKLGS  A +N+ V+  P P
Sbjct: 8118 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGP 8177

Query: 1265 PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQ 1323
                  ASDI  SS  L+W    +DGG+ +  Y +E  ++  +T+  + +  +  S+ V+
Sbjct: 8178 CKDIK-ASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVK 8236

Query: 1324 DLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKD---EVEVSDDDEKEPEVDY 1380
            DL+P+ EY FRV+A+N  G  E   E +   + + P++P D   +VEV +   +   + +
Sbjct: 8237 DLIPNGEYFFRVKAVNKVGGGE-YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITW 8295

Query: 1381 RTVTINTEQKVSDFYDIEERLGSGK 1405
            +    +   K+  +  I E++  G+
Sbjct: 8296 KPPLYDGGSKIMGY--IIEKIAKGE 8318



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 64/229 (27%), Positives = 117/229 (51%), Gaps = 20/229 (8%)

Query: 531   VHEK--KSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWL 588
             VHE+  K+S+ SE +   A  K  +       + + + +G ++ +   ++G    +V W+
Sbjct: 26716 VHEEITKTSQASEEVRTHAEIKAFS-------TQMSINEGQRLVLKANIAG--ATDVKWV 26766

Query: 589   HNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
              NG E+  SE++ +   G+  +L I++    D G  TC +    G V+ Q  LT+ +   
Sbjct: 26767 LNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELS 26826

Query: 649   GTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVF 708
                P FIS+PRS   + GQ+VL +C I+G+P P + W ++   +   + +  + ++ +V+
Sbjct: 26827 DA-PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISSNVSISRSRNVY 26884

Query: 709   TLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPA 757
             +L ++      +G+Y I  KN  G+CS   SLM+       LP   EP+
Sbjct: 26885 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV-------LPLVEEPS 26926



 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 65/220 (29%), Positives = 111/220 (50%), Gaps = 17/220 (7%)

Query: 1180  VRAGESVELFG-KVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
             ++AG+++ L    + G      +W K  K I+ S+  ++ ++   S LTI  A ++  G 
Sbjct: 14085 IKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGE 14144

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYS 1298
             YT+   N  G++   V +TV+D P PP G    S++ +   TL+W     DGGS ++SY 
Sbjct: 14145 YTITATNPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKATLTWTPPLEDGGSPIKSYI 14203

Query: 1299  IEIWDSANKTW----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTT 1354
             +E  +++   W    +++ +CR  +     L+  +EY FRV A+N YG  EP Q   +  
Sbjct: 14204 LEKRETSRLLWTVVSEDIQSCRHVA---TKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKM 14260

Query: 1355  VGE-KPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             V    P  P ++ EVS+       V   T T++ ++ V D
Sbjct: 14261 VDRFGPPGPPEKPEVSN-------VTKNTATVSWKRPVDD 14293



 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 79/293 (26%), Positives = 125/293 (42%), Gaps = 29/293 (9%)

Query: 475   RITWLLNGQPIQYARS---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 531
             ++TW    + ++ +     T E GVA L+++D    D GTY C   N  G+ S  A + V
Sbjct: 25294 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25353

Query: 532   HE-------------KKSSRKSEYL-LPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQV 577
                            KK  R+++ + L   P + T P++     +     G  V   V +
Sbjct: 25354 KGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLY-----NKTAYVGENVRFGVTI 25408

Query: 578   SGNPPPEVIWLHNGNEIQESED---FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE 634
             + +P P V W  +G +I+  ++   + FE     + L I  V  +D   YT  A N  GE
Sbjct: 25409 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 25468

Query: 635   VRTQAVLTVQ---EPHDGT-QPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGK 690
                +A LTV     P D T +P F     +     GQSV     ++G P PT+ W +DG+
Sbjct: 25469 DSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQ 25528

Query: 691   ALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
              L        + +  D + L ++   P   G Y +   N  G  SCQ  L ++
Sbjct: 25529 PLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 25581



 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 64/231 (27%), Positives = 105/231 (45%), Gaps = 5/231 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VRAG S+ +F  + G      TW K    I       +EN+E+ + L I    +   G +
Sbjct: 14483 VRAGLSIRIFVPIKGRPAPEVTWTK--DNINLKNRANIENTESFTLLIIPECNRYDTGKF 14540

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + +EN  G +   VN+ V+D P P       +DI   S+TL W     DGGS + +Y +
Sbjct: 14541 VMTIENPAGKKSGFVNVRVLDTPGPVLNLR-PTDITKDSVTLHWDLPLIDGGSRITNYIV 14599

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++  K++    T C   ++ V  L    EY FRV A N YG  EP++ +E     E 
Sbjct: 14600 EKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEA 14659

Query: 1359  PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQV 1409
             P  P D + + D  +    + +     +   K++ +    +R GS ++  +
Sbjct: 14660 P-SPPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHI 14709



 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 4/186 (2%)

Query: 1162  PPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE 1221
             PP+  M    ++F +   V+AGE +++   + G      +W K   +I+E    ++ +++
Sbjct: 19481 PPRVMMD---VKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTD 19537

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
             N + LT+    +   G Y L ++N  G+R   VN  V+DKP PPAG    + + +   +L
Sbjct: 19538 NHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSL 19597

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             SW     DGG+ +  Y +E  ++++  W       + TS  V  LL  +EY FRV  +N 
Sbjct: 19598 SWGRPQEDGGADIDYYIVEKRETSHLAWTICEGELQMTSCKVTKLLKGNEYIFRVTGVNK 19657

Query: 1341  YGTSEP 1346
             YG  EP
Sbjct: 19658 YGVGEP 19663



 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 131/586 (22%), Positives = 204/586 (34%), Gaps = 111/586 (18%)

Query: 161   PKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEI 220
             P+   ++    V  GQ  RF   +  +P  +V W    V LQ S+++  +  +G+  LEI
Sbjct: 26069 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEI 26128

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSAN----------------------- 257
                + DD G Y  +  N  G+AS  A L + G D                          
Sbjct: 26129 LDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEA 26188

Query: 258   --------------RSFVRETKATNSDVRKEVTNVI-SKESKLDSLEAAAKSKNCSSPQR 302
                            S VRE K+  ++ R+ +++   S  +++ S     KS    S  R
Sbjct: 26189 YAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTR 26248

Query: 303   GGSPPWAANSQPQPPR------ESKLESCKDSPRTAPQTPVLQK--------------TS 342
                   AA    +P        ES   SC       P    L+K              T 
Sbjct: 26249 KIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTK 26308

Query: 343   SSITLQAARVQPEPRAPGLGVLSPS-GEE--------RKRPAPPRPATFPTR----QPGL 389
                T + + VQ         V+  S G++        +K     +  T P R    +P +
Sbjct: 26309 YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRV 26368

Query: 390   GSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSS 449
              S + V      + P E     A    E+KP   E  ++  V             P  + 
Sbjct: 26369 KSPEAVKSPKRVKSP-EPSHPKAVSPTETKPTPTEKVQHLPVS----------APPKITQ 26417

Query: 450   VLKDCAVIEGQDFVLQCSVRGTPV--PRITWLLNGQPIQ----YARSTCEAGVAELHIQD 503
              LK  A    +   L C V  + +    +TW  +G+ ++    +       G  EL I +
Sbjct: 26418 FLK--AEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINN 26475

Query: 504   ALPEDHGTYTCLAENALG------QVSCSAWVTVHEK--------KSSRKSEYLLPVAPS 549
                 D G Y C      G      Q    A+ ++HEK        KS +K+        +
Sbjct: 26476 LTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKT 26535

Query: 550   KPTAP-------IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHF 602
             +P AP       + + GL D  V   S     V+ +G P P  IW  +G  I +   +  
Sbjct: 26536 EPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKL 26595

Query: 603   EQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
              +      L I +    D+G YTC   NSAG V +   LT++   D
Sbjct: 26596 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKD 26641



 Score = 94.4 bits (233), Expect = 9e-19
 Identities = 65/215 (30%), Positives = 105/215 (48%), Gaps = 12/215 (5%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             +RAG S+ L   V+G  P   TW K  + I  +    ++ +E+ S L +    +   G Y
Sbjct: 23153 IRAGASLRLMVSVSGRPPPVITWSK--QGIDLASRAIIDTTESYSLLIVDKVNRYDAGKY 23210

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T+  EN+ G + A V + V D P P        ++   S+T++W   + DGG+ V +Y +
Sbjct: 23211 TIEAENQSGKKSATVLVKVYDTPGPCPSVK-VKEVSRDSVTITWEIPTIDGGAPVNNYIV 23269

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++A + +K + T C  T + +  L+    Y FRV   N+YG  EP + S+   V E 
Sbjct: 23270 EKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSEV 23329

Query: 1359  PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             P  P  ++EV D       V   TVT+  E+ + D
Sbjct: 23330 PLVPA-KLEVVD-------VTKSTVTLAWEKPLYD 23356



 Score = 94.0 bits (232), Expect = 1e-18
 Identities = 58/184 (31%), Positives = 91/184 (49%), Gaps = 4/184 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+A E +++     G    T  W K  + ++E+  + V +S+  + L+I  A +E  G Y
Sbjct: 19101 VKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTY 19160

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              L V N  GS    + + V+D+P PP G     ++   S+T+SW    YDGG  + +Y +
Sbjct: 19161 ELCVSNSAGSITVPITIIVLDRPGPP-GPIRIDEVSCDSITISWNPPEYDGGCQISNYIV 19219

Query: 1300  EIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++ + TW  ++     TS  +  L    EY+FRV A N YG S  S+ S    V E 
Sbjct: 19220 EKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESS--AVVAEY 19277

Query: 1359  PEEP 1362
             P  P
Sbjct: 19278 PFSP 19281



 Score = 93.2 bits (230), Expect = 2e-18
 Identities = 60/199 (30%), Positives = 97/199 (48%), Gaps = 12/199 (6%)

Query: 1181 RAGESVELFGKVTGTQPITCTWM---KFRKQIQESEH-----MKVENSENGSKLTILAAR 1232
            +AG  + +   + G      +W    K +K +++  H      ++E +EN S + I   +
Sbjct: 9518 KAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECK 9577

Query: 1233 QEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGS 1292
            + H G Y++  +NK G + A   + V+D P PP      SDI   S  LSW     DGG 
Sbjct: 9578 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLK-VSDITRGSCRLSWKMPDDDGGD 9636

Query: 1293 AVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESE 1351
             ++ Y IE      K W ++   C ST+F V DLL + +Y FRVRA N +G   P +  +
Sbjct: 9637 RIKGYVIEKRTIDGKAWTKVNPDCGSTTFVVPDLLSEQQYFFRVRAENRFGIGPPVETIQ 9696

Query: 1352 LTTVGEK--PEEPKDEVEV 1368
             TT  +   P +P  ++++
Sbjct: 9697 RTTARDPIYPPDPPIKLKI 9715



 Score = 92.4 bits (228), Expect = 3e-18
 Identities = 177/792 (22%), Positives = 297/792 (37%), Gaps = 139/792 (17%)

Query: 40   RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF-SLVIHAVHE 98
            +N+ + E  TA FE  V  +  P + W +NG  I    +F +   ++G    L+I     
Sbjct: 2843 KNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIV--VQGKLHQLIIMNTST 2899

Query: 99   EDRGKYTCEATNGSGARQVTV----------------------ELTV--EGSFAKQLGQP 134
            ED  +YT    N   +  +TV                      E+TV  EG   K L   
Sbjct: 2900 EDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNG 2959

Query: 135  VVSKT---------------------LGDR----FSAPAVETRPSIWGECPP-KFATKLG 168
            V  K+                      GD     F A    +  +++ E    +F   + 
Sbjct: 2960 VEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIK 3019

Query: 169  RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDV 228
             + V E +   F C+++  P   V W+K +  LQ + R+ + ++  +  L I      D 
Sbjct: 3020 DIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDA 3078

Query: 229  GVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSL 288
            G YT +    +G    +A+L ++G D   RS           ++KEV  VI K+  +   
Sbjct: 3079 GKYTVV----AGGNVSTAKLFVEGRDVRIRS-----------IKKEV-QVIEKQRAVVEF 3122

Query: 289  EAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPR----TAPQTPVLQKTSSS 344
            E      +    + G    +    + +   E ++     S          T V  +  SS
Sbjct: 3123 EVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSS 3182

Query: 345  ITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLG---SQDVVSKAANR 401
            +TL     +P P+   L  L P   +  +PA          QP +     + ++S     
Sbjct: 3183 VTLYVNAPEP-PQV--LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKC 3239

Query: 402  RIPMEGQRDS-----AFPKFESKPQSQEVKENQTVKFRCEGLAVM--EVA---------- 444
            +   +GQ  +     AFP+ ++   + E K +  V      L+V   EV           
Sbjct: 3240 KFLHDGQEYTLLLIEAFPE-DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3298

Query: 445  PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ---PIQYARSTCEAGVAELHI 501
            P+  + L+D    EGQ    QC V GT + +++W    +   P ++ R T      +L I
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3357

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTVHEK--------KSSRKSEYLLPVAPSKPTA 553
             +A PED GTYT +A NA+GQVS +A +++  +        K  R+S     VA S  T 
Sbjct: 3358 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSSFTK 3417

Query: 554  PIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCI 613
                    ++K   GS     VQV  +     I  H    +Q+++          H+  +
Sbjct: 3418 EESKISQKEIKSFQGSSYEYEVQVFESVSQSSI--HTAASVQDTQ--------LCHTASL 3467

Query: 614  QEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISC 673
             ++      +  C A  S GE                 P      + VT   G +    C
Sbjct: 3468 SQIAESTELSKEC-AKESTGEA----------------PKIFLHLQDVTVKCGDTAQFLC 3510

Query: 674  AIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGE 733
             +  D F  V W  +G A  +++   +  QN ++  L +  VQ    G Y  ++ N  GE
Sbjct: 3511 VLKDDSFIDVTWTHEG-AKIEESERLKQSQNGNIQFLTICNVQLVDQGLYSCIVHNDCGE 3569

Query: 734  CSCQVSLMLQNS 745
             +    L ++ +
Sbjct: 3570 RTTSAVLSVEGA 3581



 Score = 92.4 bits (228), Expect = 3e-18
 Identities = 58/210 (27%), Positives = 105/210 (50%), Gaps = 6/210 (2%)

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESE-HMKVENSE 1221
             P A++ P+   + +   V AGE+  L   + G       W K  K+++E+   M+++++ 
Sbjct: 18400 PNASLDPK---YKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTI 18456

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
               + L +    +   G Y L + N  G++   + + V+D+P PP G    + + +    L
Sbjct: 18457 QKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYL 18516

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINV 1340
             +W     DGG+ +  Y IE  +++  +W +++T  ++ ++ V  LLP +EY FRV A+N 
Sbjct: 18517 AWNPPLQDGGANISHYIIEKRETSRLSWTQVSTEVQALNYKVTKLLPGNEYIFRVMAVNK 18576

Query: 1341  YGTSEPSQESELTTVGE-KPEEPKDEVEVS 1369
             YG  EP +   +T     KP  P    EVS
Sbjct: 18577 YGIGEPLESGPVTACNPYKPPGPPSTPEVS 18606



 Score = 92.4 bits (228), Expect = 3e-18
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 7/197 (3%)

Query: 1147  TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
             T +  TV+      T   + MP + I  P      AG  VEL   + G  P   +W    
Sbjct: 23418 TVTAVTVQDLRVLPTIDLSTMPQKTIHVP------AGRPVELVIPIAGRPPPAASWFFAG 23471

Query: 1207  KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPA 1266
              +++ESE + VE     +KLTI        G YTL ++N  G+    + + ++DKP PP 
Sbjct: 23472 SKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPT 23531

Query: 1267  GTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA-TCRSTSFNVQDL 1325
             G     +I ++S+T+SW     DGG+ +  Y +E  D+    W  ++ +   ++F    L
Sbjct: 23532 GPIKIDEIDATSITISWEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRL 23591

Query: 1326  LPDHEYKFRVRAINVYG 1342
                +EY FRV A N +G
Sbjct: 23592 TEGNEYVFRVAATNRFG 23608



 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 76/236 (32%), Positives = 105/236 (44%), Gaps = 16/236 (6%)

Query: 27   MPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
            +P+T  P  +   +N+ + EG +   E  + GYP P VTW+R    I S   F +     
Sbjct: 892  IPVTP-PTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQ-S 949

Query: 87   GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK---TLGDR 143
            G   L+I     ED G++TC A N +G    +  L V+ S   +     V++   T   R
Sbjct: 950  GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKR 1009

Query: 144  F--SAPAVETRPSIWGE-------CPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTW 194
            F  S   V T  S+  E         P F TK     + EG    F C++ G P+P V W
Sbjct: 1010 FVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYW 1069

Query: 195  LKGNVPLQPSAR--VSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAEL 248
             K  VPL    R  VS +++ G   L I     DD G YT +V N  G+ S SA L
Sbjct: 1070 KKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 64/227 (28%), Positives = 106/227 (46%), Gaps = 6/227 (2%)

Query: 1181  RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYT 1240
             +AGE V++     G  P T TW K  K +       +EN+++ S LTI    +   G Y 
Sbjct: 20979 KAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYI 21038

Query: 1241  LLVENKLGS-RQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             L +EN +G  + + V++ V+D P           +   ++TL W     DGGS + +Y I
Sbjct: 21039 LTIENGVGEPKSSTVSVKVLDTP-AACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVI 21097

Query: 1300  EIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  D+  +TW  ++  C STSF + DL     + FRV A N  G  EP + +E     E 
Sbjct: 21098 EKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEV 21157

Query: 1359  PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGK 1405
             P  P  ++ + D  +    + +     +    ++++  + ER G G+
Sbjct: 21158 P-APIRDLSMKDSTKTSVILSWTKPDFDGGSVITEY--VVERKGKGE 21201



 Score = 91.7 bits (226), Expect = 6e-18
 Identities = 50/166 (30%), Positives = 86/166 (51%), Gaps = 1/166 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+ G+ +++   ++G    T TW K    ++++  + V +S + + L+I    ++  G Y
Sbjct: 16936 VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 16995

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + V N +G + A + +  +DKPDPP G     D+ + S+TLSW    Y GG  + +Y +
Sbjct: 16996 GITVANVVGQKTASIEIVTLDKPDPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIV 17055

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTS 1344
             +  D+    W  + AT   T+  V  L    EY+FR+ A N YG S
Sbjct: 17056 QKRDTTTTVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQS 17101



 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 59/183 (32%), Positives = 95/183 (51%), Gaps = 10/183 (5%)

Query: 1179 KVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM------KVENSENGSKLTILAAR 1232
            KV+AGE V +   VTG       W K    I++          +V  SE  ++L+I  A 
Sbjct: 9104 KVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAV 9163

Query: 1233 QEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGS 1292
            +E  G YT+   N+LGS    V++ V D+P PP      +DI++ S  L+W     +GGS
Sbjct: 9164 REDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNL-AVTDIKAESCYLTWDAPLDNGGS 9222

Query: 1293 AVQSYSIEIWDSANK--TWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQE 1349
             +  Y I+  D++ K   W+E+  T     + +  L+P+ +Y+FRVRA+N YG S+  + 
Sbjct: 9223 EITHYVIDKRDASRKKAEWEEVTNTAVEKRYGIWKLIPNGQYEFRVRAVNKYGISDECKS 9282

Query: 1350 SEL 1352
             ++
Sbjct: 9283 DKV 9285



 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 63/190 (33%), Positives = 89/190 (46%), Gaps = 7/190 (3%)

Query: 1157  PAPKTPPKAAMPPQII---QFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESE 1213
             P P        PP++I       +Q ++ G+++ L   + G      TW K  +      
Sbjct: 10899 PEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKA 10958

Query: 1214  HMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASD 1273
              + V  +  GSKL I  A  E  G Y+L VEN  GS+   V + V+DKP PP      S+
Sbjct: 10959 RIDV--TPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLE-VSE 11015

Query: 1274  IRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYK 1332
             IR  S  L+W     DGGS + +Y +E  D A+  W  L AT +  S   + L   ++Y 
Sbjct: 11016 IRKDSCYLTWKEPLDDGGSVITNYVVERRDVASAQWSPLSATSKKKSHFAKHLNEGNQYL 11075

Query: 1333  FRVRAINVYG 1342
             FRV A N YG
Sbjct: 11076 FRVAAENQYG 11085



 Score = 91.3 bits (225), Expect = 8e-18
 Identities = 65/207 (31%), Positives = 101/207 (48%), Gaps = 10/207 (4%)

Query: 1163  PKAA---MPPQIIQFPEDQKV---RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK 1216
             PKA    +PP+I    + +KV   RA  ++ LF  + G       W   R   +  +   
Sbjct: 15544 PKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWA--RDHGESLDKAS 15601

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS 1276
             +E++ + + L +    +   G Y L VEN  GS+ A VN+ V+D P PP       ++  
Sbjct: 15602 IESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDTPGPPQDLK-VKEVTK 15660

Query: 1277  SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRV 1335
             +S+TL+W     DGGS +++Y +E  +S  K +  +AT C  TS+ V  L     Y FRV
Sbjct: 15661 TSVTLTWDPPLLDGGSKIKNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRV 15720

Query: 1336  RAINVYGTSEPSQESELTTVGEKPEEP 1362
              A N YG   P++ +E     E+P  P
Sbjct: 15721 LAENEYGIGLPAETAESVKASERPLPP 15747



 Score = 90.5 bits (223), Expect = 1e-17
 Identities = 84/289 (29%), Positives = 126/289 (43%), Gaps = 32/289 (11%)

Query: 1180  VRAGESVELFGKVTGTQPITCTW-MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
             V AG  + +   V+G  P T TW M  R   QE+    +E +   S + I   ++ H G 
Sbjct: 10231 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEAT---IETTAISSSMVIKNCQRSHQGV 10287

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTP-CASDIRSSSLTLSWYGSSYDGGSAVQSY 1297
             Y+LL +N+ G R+  + + V+D P  P GTP  A ++ + S  L+W+    DGGS + +Y
Sbjct: 10288 YSLLAKNEAGERKKTIIVDVLDVPG-PVGTPFLAHNLTNESCKLTWFSPEDDGGSPITNY 10346

Query: 1298  SIEIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG 1356
              IE  +S  + W  +  T    +  VQ L+    Y FR+ A N  G     + SE   + 
Sbjct: 10347 VIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIR 10406

Query: 1357  EK---PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD------FYDIEERL-GSGKF 1406
             E    PE P+D +EV        EV   TVT+       D       Y +E RL G+ KF
Sbjct: 10407 EPITVPERPED-LEVK-------EVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKF 10458

Query: 1407  GQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPKLVQC 1455
                     K T      + +     KE +     +S +N +   K   C
Sbjct: 10459 -------HKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFC 10500



 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 55/184 (29%), Positives = 93/184 (50%), Gaps = 4/184 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             +RAG S+ LF  + G       W K   +I+++  + V +S   + L +    +   G Y
Sbjct: 16649 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSF--TSLVLDNVNRYDSGKY 16706

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             TL +EN  G++ A V + V+D P PP      ++I   S++++W     DGGS +++Y +
Sbjct: 16707 TLTLENSSGTKSAFVTVRVLDTPSPPVNLK-VTEITKDSVSITWEPPLLDGGSKIKNYIV 16765

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++  K++  + T C   S+ +  L     Y FRV A N YG   P+Q ++   V E 
Sbjct: 16766 EKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEV 16825

Query: 1359  PEEP 1362
             P+ P
Sbjct: 16826 PQPP 16829



 Score = 90.1 bits (222), Expect = 2e-17
 Identities = 67/250 (26%), Positives = 113/250 (45%), Gaps = 15/250 (6%)

Query: 1159  PKTPPKAAMPPQIIQFPE---DQKVRAGESVELFGKVTGTQPIT------CTWMKFRKQI 1209
             P   P      +++++P+   D++ + G  V   G +  T PI       C W K  + I
Sbjct: 23813 PAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI 23872

Query: 1210  QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTP 1269
               S+   +  SE  ++L I  A +   G Y L++ENK G +   + + V+  P+ P G  
Sbjct: 23873 --SKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGSPNSPEGPL 23930

Query: 1270  CASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPD 1328
                DI+  S+ +SW   + DGG+ +  Y +E  +     W  + +  R TS  V+ L  +
Sbjct: 23931 EYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGTSLVVKGLKEN 23990

Query: 1329  HEYKFRVRAINVYGTSEPSQESELTTVG---EKPEEPKDEVEVSDDDEKEPEVDYRTVTI 1385
              EY FRV A N +G S+P +  E  T       PE P +  EV D  +    + +     
Sbjct: 23991 VEYHFRVSAENQFGISKPLKSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKD 24050

Query: 1386  NTEQKVSDFY 1395
             +   +V+ +Y
Sbjct: 24051 DGGSRVTGYY 24060



 Score = 89.4 bits (220), Expect = 3e-17
 Identities = 55/193 (28%), Positives = 93/193 (48%), Gaps = 5/193 (2%)

Query: 553 APIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESE--DFHFEQRGTQHS 610
           AP F Q L  + V++GS  T    +SG P PEV W  +G  I  S            +  
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 611 LCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVL 670
           L I  V   ++G Y+ +A N +G+  + A L V+   +   P F+ + +S+T   G  V 
Sbjct: 65  LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKA--ETAPPNFVQRLQSMTVRQGSQVR 122

Query: 671 ISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNR 730
           +   + G P P V + RDG  + + +  F++ Q  D+++L++ +  P  +G Y +   N 
Sbjct: 123 LQVRVTGIPTPVVKFYRDGAEI-QSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181

Query: 731 VGECSCQVSLMLQ 743
           VG  +    L++Q
Sbjct: 182 VGRATSTAELLVQ 194



 Score = 89.4 bits (220), Expect = 3e-17
 Identities = 60/221 (27%), Positives = 100/221 (45%), Gaps = 17/221 (7%)

Query: 431   VKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS 490
             +K R + + ++E  P F+  L +     G++     ++   P P +TW  +GQ I+   +
Sbjct: 25371 IKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDN 25430

Query: 491   ------TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLL 544
                     + G+ +L I     +D   YT +A N  G+ SC A +TV           L 
Sbjct: 25431 DKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV----------TLH 25480

Query: 545   PVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQ 604
             P        P+F + L++ +  +G  V   ++VSG PPP + W  +G  +    +     
Sbjct: 25481 PPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIH 25540

Query: 605   RGTQ-HSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQ 644
              G   ++L I++  PEDTG Y   A N+AG    QA L V+
Sbjct: 25541 EGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 25581



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 144/684 (21%), Positives = 237/684 (34%), Gaps = 121/684 (17%)

Query: 163  FATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVS-EKNGMQVLEIH 221
            F +++    + EG    F CK++G P P++ W K    ++   R  +   ++G   L I 
Sbjct: 1247 FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIP 1306

Query: 222  GVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISK 281
             V  +D G+YT    N  G A  S +L ++            T    S +R      +S+
Sbjct: 1307 VVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSR 1366

Query: 282  ESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKT 341
                  +  A  S    SP R      +   + +   ES+LE      R      VL+  
Sbjct: 1367 SP--IRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLE------RLYKPVFVLKPV 1418

Query: 342  S-SSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAAN 400
            S   +  Q AR                  + K    P P TF         Q +V+   +
Sbjct: 1419 SFKCLEGQTARF-----------------DLKVVGRPMPETFWFHD----GQQIVNDYTH 1457

Query: 401  RRIPMEGQRDSAFPKFESKPQSQE---VKENQTVKFRCEGLAVME-----VAPSFSSVLK 452
            + +  E    S      +   S E   V +N+  +     +  +E     V P F   LK
Sbjct: 1458 KVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLK 1517

Query: 453  DCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ---PIQYARSTCEA--GVAELHIQDALPE 507
            +  + EG    ++    G P P I WL N     P +Y +   E   G A L I   + +
Sbjct: 1518 NVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQ 1577

Query: 508  DHGTYTCLAENALGQ--VSCSAWVTVHEKKSSRKSEYLLP---------VAP-------- 548
            D   YT  A N  G+    C   V V   +   + + ++P          AP        
Sbjct: 1578 DSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLR 1637

Query: 549  --------------SKPTAPIFLQGLSDLKVMDGSQVTMTVQVS--GNPPPEVIWLHNGN 592
                           K   P F + L+ L++          +++  G+P   V WLH+G 
Sbjct: 1638 YGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGK 1697

Query: 593  EIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQE------- 645
             ++ +            SL     +  D+G  TC A N  G   T A L V++       
Sbjct: 1698 PLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEE 1757

Query: 646  -------------------PHDGT------------QPWFISKPRSVTASLGQSVLISCA 674
                                H+G             +P  +  P  V    G++    C 
Sbjct: 1758 SQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCR 1817

Query: 675  IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
            + G P P V+W  +G+ L + +  F V + + +  L +   + +  G+ ++  +N  G  
Sbjct: 1818 VTGYPQPKVNWYLNGQ-LIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVI 1875

Query: 735  SCQVSLMLQNSS--ARALPRGREP 756
              +V L +Q        L R  EP
Sbjct: 1876 EHKVKLEIQQREDFRSVLRRAPEP 1899



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 74/292 (25%), Positives = 123/292 (42%), Gaps = 42/292 (14%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+   VA  + S  +L V+          E P  +   + + ++ G  A+F   + G P+
Sbjct: 3170 GEYTFVAGRNRSSVTLYVNAP--------EPPQVLQELQPVTVQSGKPARFCAVISGRPQ 3221

Query: 62   PQVTWHRNGQPITSGGR--FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTV 119
            P+++W++  Q +++G +  FL D      ++L++     ED   YTCEA N  G    + 
Sbjct: 3222 PKISWYKEEQLLSTGFKCKFLHD---GQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSA 3278

Query: 120  ELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGR 179
             L+VE                      P V +        PP   T L   V  EGQ  R
Sbjct: 3279 SLSVE---------------------VPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPAR 3317

Query: 180  FSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGS 239
            F C+++G    +V+W   +  ++PS    +++      LEI     +D G YT +  N  
Sbjct: 3318 FQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAV 3376

Query: 240  GKASMSAELS--IQGLDSAN-----RSFVRETKATNSDVRKEVTNVISKESK 284
            G+ S +A LS  +Q LD  +     R   +     +S   KE + +  KE K
Sbjct: 3377 GQVSSTANLSLEVQALDRQSSGKDVRESAKSQAVADSSFTKEESKISQKEIK 3428



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 62/207 (29%), Positives = 97/207 (46%), Gaps = 11/207 (5%)

Query: 1163  PKAAMPPQIIQFPEDQK----VRAGESVELFGKVTGTQPITCTWMK--FRKQIQESEHMK 1216
             PK  + P  I      +    VRAG  + LF  V G      TW K      +++ +   
Sbjct: 12292 PKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQ--- 12348

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS 1276
             V+  +  + L I  + ++  G Y+L + N  G +   VN+ V+D P P +     SD+  
Sbjct: 12349 VDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLK-VSDVTK 12407

Query: 1277  SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRV 1335
             +S  +SW     DGGS V  Y +E  ++  KTW  +    + TSF+V +L+P +EY FRV
Sbjct: 12408 TSCHVSWAPPENDGGSQVTHYIVEKREADRKTWSTVTPEVKKTSFHVTNLVPGNEYYFRV 12467

Query: 1336  RAINVYGTSEPSQESELTTVGEKPEEP 1362
              A+N YG   P+   +     +   EP
Sbjct: 12468 TAVNEYGPGVPTDVPKPVLASDPLSEP 12494



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 11/211 (5%)

Query: 1159  PKTPPKAAMPPQIIQFPEDQK---------VRAGESVELFGKVTGTQPITCTWMKFRKQI 1209
             P   P    P  I+  PE +          +RAG ++ L+  V G  P   TW K    +
Sbjct: 13370 PSDVPDKHYPKDILIPPEGELDADLRKTLILRAGVTMRLYVPVKGRPPPKITWSKPNVNL 13429

Query: 1210  QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTP 1269
             ++   + +++++  + L      +   G Y L +EN  G ++  + + V+D P PP    
Sbjct: 13430 RDRIGLDIKSTDFDTFLRCENVNKYDAGKYILTLENSCGKKEYTIVVKVLDTPGPPVNV- 13488

Query: 1270  CASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPD 1328
                +I   S  ++W     DGGS + +Y ++  D+  K+W  + T C  TSF V +L   
Sbjct: 13489 TVKEISKDSAYVTWEPPIIDGGSPIINYVVQKRDAERKSWSTVTTECSKTSFRVANLEEG 13548

Query: 1329  HEYKFRVRAINVYGTSEPSQESELTTVGEKP 1359
               Y FRV A N YG  +P +  +     + P
Sbjct: 13549 KSYFFRVFAENEYGIGDPGETRDAVKASQTP 13579



 Score = 87.8 bits (216), Expect = 9e-17
 Identities = 66/230 (28%), Positives = 106/230 (46%), Gaps = 15/230 (6%)

Query: 1168  PPQIIQFPEDQKV---RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS 1224
             PP+I    + +KV   RA  ++ LF  + G       W K    +  ++  ++E + + +
Sbjct: 18799 PPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL--TDRAQIEVTSSFT 18856

Query: 1225  KLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY 1284
              L I    +   G Y L +EN  GS+ A VN+ V+D P  P       +++  S+TLSW 
Sbjct: 18857 MLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIR-EVKKDSVTLSWE 18915

Query: 1285  GSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGT 1343
                 DGG+ + +Y +E  ++  K +  +   C  T+F +++L     Y FRV A N YG 
Sbjct: 18916 PPLIDGGAKITNYIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGI 18975

Query: 1344  SEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
               P++ +E   V E P  P     V        +V   T TI  E+  SD
Sbjct: 18976 GLPAETTEPVKVSEPPLPPGRVTLV--------DVTRNTATIKWEKPESD 19017



 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 56/184 (30%), Positives = 89/184 (48%), Gaps = 4/184 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VRAG S  +     G      TW   R++ + ++ +++E   N ++L+I    +   G Y
Sbjct: 17731 VRAGGSARIHIPFKGRPTPEITWS--REEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKY 17788

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              L +EN  GS+ A V + V+D P PP       ++R  S  L W     DGG+ V++Y I
Sbjct: 17789 ILKLENSSGSKSAFVTVKVLDTPGPPQNL-AVKEVRKDSAFLVWEPPIIDGGAKVKNYVI 17847

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             +  +S  K +  +++ C  TSF V++L     Y FRV A N +G   P +  +     E 
Sbjct: 17848 DKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEP 17907

Query: 1359  PEEP 1362
             P  P
Sbjct: 17908 PSPP 17911



 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 46/168 (27%), Positives = 85/168 (50%), Gaps = 1/168 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             ++AGE +++   V G      +W+K  + ++++  + VE +   + L I    ++  G Y
Sbjct: 18018 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 18077

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T+   N  G+    +++ V++KP PP G     ++ +  + +SW   +Y GG  + +Y +
Sbjct: 18078 TVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIV 18137

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             E  D+   TW  + AT   T+  +  L    EY+FR+ A N YG S P
Sbjct: 18138 EKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAP 18185



 Score = 85.9 bits (211), Expect = 3e-16
 Identities = 67/238 (28%), Positives = 104/238 (43%), Gaps = 21/238 (8%)

Query: 19   VDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGG- 77
            V P++ DS      P FI    N  I  G  A     V G P+P++ W  NG  +T    
Sbjct: 3635 VYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSAD 3694

Query: 78   -RFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVV 136
             +F+ D       SL+I     ED G+YTC A+N  G        T+  ++ K     + 
Sbjct: 3695 YKFVFD---GDDHSLIILFTKLEDEGEYTCMASNDYGK-------TICSAYLK-----IN 3739

Query: 137  SKTLGDRFS---APAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVT 193
            SK  G + +   +   ++   + G CPP F  +L  +   +G    F   + G P P VT
Sbjct: 3740 SKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVT 3799

Query: 194  WLKGNVPLQPSARVS-VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
            W K N  L  S   + +   NG     ++   ++D G+Y C   N  G+++ +AEL +
Sbjct: 3800 WFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score = 85.5 bits (210), Expect = 4e-16
 Identities = 60/221 (27%), Positives = 94/221 (42%), Gaps = 31/221 (14%)

Query: 33   PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
            P F+L P +    EG TA+F+ +V G P P+  W  +GQ I +     +     GT SL+
Sbjct: 1411 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1470

Query: 93   IHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETR 152
            I      D G++T  A N +G   ++V LTVE                       AVE  
Sbjct: 1471 IVPATPSDSGEWTVVAQNRAGRSSISVILTVE-----------------------AVE-- 1505

Query: 153  PSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS--ARVSVS 210
                 +  P F  KL  V +KEG       + TG P P + WLK +  + P    ++ + 
Sbjct: 1506 ----HQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIE 1561

Query: 211  EKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQ 251
               G   L+I      D   YT   +N +G+ +   +++++
Sbjct: 1562 GTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE 1602



 Score = 85.1 bits (209), Expect = 6e-16
 Identities = 178/820 (21%), Positives = 302/820 (36%), Gaps = 113/820 (13%)

Query: 367  SGEERKRPAPP--RPATFPTRQPGLGSQDVVSKAANRR-IPMEGQRDSAFPKFESKPQSQ 423
            SG+    PA P   P   PT +P    + +  ++ +R  I M   R S      ++    
Sbjct: 1330 SGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPA 1389

Query: 424  EVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ 483
             +   + ++   E        P F         +EGQ       V G P+P   W  +GQ
Sbjct: 1390 RMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQ 1449

Query: 484  PI--QYARSTC--EAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRK 539
             I   Y       E G   L I  A P D G +T +A+N  G+ S S  +TV   +   K
Sbjct: 1450 QIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVK 1509

Query: 540  SEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED 599
                          P+F++ L ++ + +GS++ M V+ +GNP P+++WL N + I   + 
Sbjct: 1510 --------------PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKY 1555

Query: 600  FHFEQRGT--QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISK 657
                  GT  + +L I     +D+  YT  A N AG   T+  + V+      +P     
Sbjct: 1556 PKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEP----- 1610

Query: 658  PRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVF------TLV 711
             R +    G     +  IA      +H LR G+   ++   ++  + +  F      +L 
Sbjct: 1611 ERKLIIPRG--TYRAKEIAAPELEPLH-LRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLR 1667

Query: 712  LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGR---EPASCEDLCGGGVG 768
            LK+  P H   +E  L   +G+ +  V  +       A  R R   E   C    G    
Sbjct: 1668 LKRFGPAH---FECRL-TPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYS 1723

Query: 769  ADGG-----GSDRYGSLRPGWP--ARGQGWLEEED--GEDVRGVLKRRVETRQHTEEAIR 819
             D G      +++YG+         + +  L EE    E  +G+ +     R   E A+ 
Sbjct: 1724 RDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALT 1783

Query: 820  QQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKT--------VSE 871
                +Q +      K+     L  + ++ +  E   FR  +    +PK         + +
Sbjct: 1784 GVTTDQKE------KQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRK 1837

Query: 872  EER------KVHSPQQVDFRS--VLAKKGTSKTP---VPEKVPPPKPATPDFRSVLGGKK 920
             +R       +H    VD +S      K T++ P   +  KV        DFRSVL    
Sbjct: 1838 SKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAP 1897

Query: 921  KLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKP 980
            +   E        L  +  +  +P+   +     K V   K AE +      + +E L+ 
Sbjct: 1898 EPRPEFHVHEPGKLQFEVQKVDRPVDTTE----TKEVVKLKRAERITHEKVPEESEELRS 1953

Query: 981  MGNAKPDE---------NLKSASKEELKKDVKNDVNCKRGH--AGTTDNEKRS---ESQG 1026
                + +E          LKS  K+E  +++      +  H     T+ EK++   E + 
Sbjct: 1954 KFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKI 2013

Query: 1027 TAPAFK----------------QKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNG-KTL 1069
            T P FK                +++Q   V +G     + +V   P     W  NG K  
Sbjct: 2014 TIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIE 2073

Query: 1070 KTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQ 1109
            ++ +      E ++C + I     ED       A N AG+
Sbjct: 2074 RSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGE 2113



 Score = 84.7 bits (208), Expect = 7e-16
 Identities = 150/724 (20%), Positives = 239/724 (33%), Gaps = 89/724 (12%)

Query: 31   EAPAFILPPRNLCIKEGATAKFEGRVR--GYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
            + P F     +L +K    A FE R+   G P   V W  +G+P+ +  R  +     G 
Sbjct: 1655 QKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRM-INEFGY 1713

Query: 89   FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV--EGSFAKQLGQPVVSKTLGDRFSA 146
             SL     +  D G  TC ATN  G    +  L V  E S  ++   P   K L      
Sbjct: 1714 CSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEEL 1773

Query: 147  PAVETRPSIWG-------ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNV 199
              +    ++ G       +  P        V V EG+  RF C++TG PQP+V W     
Sbjct: 1774 ERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQ 1833

Query: 200  PLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRS 259
             ++ S R  V   +G+  L+I      D G       N  G      +L IQ  +   RS
Sbjct: 1834 LIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDF-RS 1891

Query: 260  FVRETKATNSDVRKEVTNVISKE-SKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPR 318
             +R       +        +  E  K+D      ++K     +R          +     
Sbjct: 1892 VLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEEL 1951

Query: 319  ESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPR 378
             SK +   +       T V  K+          ++             + EE+K  A   
Sbjct: 1952 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEG 2011

Query: 379  PATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGL 438
              T PT +P              +I +    ++  PK   + QSQ V +     FR    
Sbjct: 2012 KITIPTFKPD-------------KIELSPSMEA--PKIFERIQSQTVGQGSDAHFRVR-- 2054

Query: 439  AVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTC----EA 494
                                         V G P P   W  NG  I+ +        E 
Sbjct: 2055 -----------------------------VVGKPDPECEWYKNGVKIERSDRIYWYWPED 2085

Query: 495  GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAP 554
             V EL I+D   ED  +    A N  G+ S  A++ V  K+                   
Sbjct: 2086 NVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ-----------------LI 2128

Query: 555  IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQ 614
             F Q L D+   +   +      +  P  +V W  +G E+ E + +        H L I 
Sbjct: 2129 TFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSIL 2188

Query: 615  EVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCA 674
             +   D   Y+C        V+T A L V    +G    F+ + + +      S  + C 
Sbjct: 2189 TIDTSDAEDYSCVLVEDE-NVKTTAKLIV----EGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 675  IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
            ++ +      W  +   L K  G + +        L +K V     G+Y  ++  +   C
Sbjct: 2244 VSPENIEG-KWYHNDVEL-KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTC 2301

Query: 735  SCQV 738
              ++
Sbjct: 2302 KLKM 2305



 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 46/155 (29%), Positives = 76/155 (49%), Gaps = 1/155 (0%)

Query: 1192  VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ 1251
             + G    + +W K    +     + VE+S   + L +   ++   G YT+ ++N  G+++
Sbjct: 13701 IKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKE 13760

Query: 1252  AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
               +++ VV KP  P G     ++ + ++TL W     DGGS + +Y +E  DS N  W  
Sbjct: 13761 GTISIKVVGKPGIPTGPIKFDEVTAEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVT 13820

Query: 1312  LATC-RSTSFNVQDLLPDHEYKFRVRAINVYGTSE 1345
              A+  + T+F V  L    EY FRV A N YG  E
Sbjct: 13821 CASAVQKTTFRVTRLHEGMEYTFRVSAENKYGVGE 13855



 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 53/182 (29%), Positives = 87/182 (47%), Gaps = 4/182 (2%)

Query: 1168  PPQIIQ--FPEDQK-VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS 1224
             PP+I    FP     VRAG ++++   ++G      T  +    ++ +     E +    
Sbjct: 20168 PPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENL 20227

Query: 1225  KLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY 1284
              + +  +     G Y +   N  G+ +A +N+ V+D+P PP G    SDI   S+TL W 
Sbjct: 20228 TINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDITEESVTLKWE 20287

Query: 1285  GSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGT 1343
                YDGGS V +Y +   +++   W E+ AT   T   V  L    EY+FR++A N +G 
Sbjct: 20288 PPKYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTGEEYQFRIKAENRFGI 20347

Query: 1344  SE 1345
             S+
Sbjct: 20348 SD 20349



 Score = 83.2 bits (204), Expect = 2e-15
 Identities = 49/183 (26%), Positives = 90/183 (49%), Gaps = 5/183 (2%)

Query: 1169  PQIIQFPEDQK----VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS 1224
             P I++F  +      +++GES+ +   V G      TW K   +I++  +M++ +    +
Sbjct: 21650 PPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGST 21709

Query: 1225  KLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWY 1284
              L +  A ++H G YT+  +N  GS +A++ + V D P    G    ++I    +TL W 
Sbjct: 21710 SLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMTLWWD 21769

Query: 1285  GSSYDGGSAVQSYSIEIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGT 1343
                 DG + +  Y IE  +++   W  +   C + S+    L+  +EY+FRV A+N +G 
Sbjct: 21770 APLNDGCAPITHYIIEKRETSRLAWALIEDKCEAQSYTAIKLINGNEYQFRVSAVNKFGV 21829

Query: 1344  SEP 1346
               P
Sbjct: 21830 GRP 21832



 Score = 82.8 bits (203), Expect = 3e-15
 Identities = 112/474 (23%), Positives = 180/474 (37%), Gaps = 54/474 (11%)

Query: 813  HTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTV--- 869
            H EE+  QQ   +  +++    ++S   ++E   +  PA +      + + VKP+ +   
Sbjct: 676  HLEESYAQQTTLEYGYKE----RISAAKVAEPPQR--PASEPHV---VPKAVKPRVIQAP 726

Query: 870  SEEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPP-PKPATPDFRSVLGGKKKLPAENGS 928
            SE   K    + +   S + K     T     V   P+ A+P F      K  +P     
Sbjct: 727  SETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTV---SKISVPKTEHG 783

Query: 929  SSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAET--LKPMGNAKP 986
              A    +      K LS    +   + +  +  A T+KP      AE   L     A  
Sbjct: 784  YEASIAGSAIATLQKELSATSSA---QKITKSVKAPTVKPSETRVRAEPTPLPQFPFADT 840

Query: 987  DENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQG-------------------- 1026
             +  KS +  E+KK+V   +       GTT  E+R E                       
Sbjct: 841  PDTYKSEAGVEVKKEVGVSIT------GTTVREERFEVLHGREAKVTETARVPAPVEIPV 894

Query: 1027 TAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSV 1086
            T P     L++V V EG+ + L+C +S  P  T+ W      ++++    ++ +  +  +
Sbjct: 895  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 954

Query: 1087 SIEKALPEDRGLYKCVAKNDAGQAECSC--QVTVDDAPASENTKAPEMKSRRPKSSLPPV 1144
             I +A  ED G + C A N+AG    SC   V V +    E T   E  +   K  +   
Sbjct: 955  MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1014

Query: 1145 LGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
                +D ++ ++ A    P A   P  I  P  QK+  G SV    +V G       W K
Sbjct: 1015 DVVMTDTSLTEEQAGPGEPAA---PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKK 1071

Query: 1205 FRKQIQESEHMKVE-NSENGS-KLTILAARQEHCGCYTLLVENKLGSRQAQVNL 1256
                +      KV  N + G  KL I     +  G YT++V NK G   A  +L
Sbjct: 1072 SGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1125



 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 101/443 (22%), Positives = 165/443 (37%), Gaps = 57/443 (12%)

Query: 1017 DNEKRSESQ-GTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFI 1075
            D E R++ +   AP  K   QD+ V  GK L +     + P A   W    + L T    
Sbjct: 6682 DKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTID 6741

Query: 1076 ILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSR 1135
              +++ S   +  +K    D+G YK V +N  G+AE    + V D P             
Sbjct: 6742 TTAEQTSFRILEAKKG---DKGRYKIVLQNKHGKAEGFINLKVIDVPG------------ 6786

Query: 1136 RPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGT 1195
                   PV   E   T   +               +    ++ +  G S ++ G V   
Sbjct: 6787 -------PVRNLEVTETFDGE---------------VSLAWEEPLTDGGS-KIIGYVVER 6823

Query: 1196 QPITC-TWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC-YTLLVENKLGSRQAQ 1253
            + I   TW+    + +  E       + G +     + +   G    +  +N + +R   
Sbjct: 6824 RDIKRKTWVLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDNPVEARSKY 6883

Query: 1254 VNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA 1313
                  D P PP      +D+    ++L+W    YDGG+ + +Y IE+ D  +  W    
Sbjct: 6884 ------DVPGPPLNVTI-TDVNRFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAM 6936

Query: 1314 TCRST--SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1371
            T R+   S  V D++   EY FRVRA N  G  +PS  +    V +  E P   V ++  
Sbjct: 6937 TVRAEDLSATVTDVVEGQEYSFRVRAQNRIGVGKPSAATPFVKVADPIERPSPPVNLTSS 6996

Query: 1372 DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQV---FRLVEKKTRKVW----AGK 1424
            D+ +  V  +      +        I ER   GK   +    +LV + T KV       K
Sbjct: 6997 DQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVPELTYKVTGLEKGNK 7056

Query: 1425 FFKAYSAKEKENIRQEISIMNCL 1447
            +    SA+ K  +     I+  L
Sbjct: 7057 YLYRVSAENKAGVSDPSEILGPL 7079



 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 53/185 (28%), Positives = 85/185 (45%), Gaps = 4/185 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+AG S  +     G       W K    ++   +  V+ +++ + LTI  A +   G Y
Sbjct: 19893 VKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAY--VDTTDSRTSLTIENANRNDSGKY 19950

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             TL ++N L +    + + V+D P PP       D+   S  LSW     DGG+ V++Y I
Sbjct: 19951 TLTIQNVLSAASLTLVVKVLDTPGPPTNI-TVQDVTKESAVLSWDVPENDGGAPVKNYHI 20009

Query: 1300  EIWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  +++ K W  +   C   S+ V +L     Y FRV   N +G   P++  E   + EK
Sbjct: 20010 EKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKEGVKITEK 20069

Query: 1359  PEEPK 1363
             P  P+
Sbjct: 20070 PSPPE 20074



 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 62/203 (30%), Positives = 92/203 (45%), Gaps = 4/203 (1%)

Query: 533   EKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGN 592
             E + S  SE + P +     AP F + L +L V   S  T+  +V+G+P P V W   G 
Sbjct: 24602 ESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGK 24661

Query: 593   EI-QESEDFHFEQ-RGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGT 650
             EI  +   +  ++ +G  H L I  V  +D   Y   A N  G V   A L V+ P    
Sbjct: 24662 EIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIH 24721

Query: 651   QPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTL 710
              P  +    +V A  G+ V I    +G P P + W + G+ L  + GH++V+      +L
Sbjct: 24722 LPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITW-QKGQDLIDNNGHYQVIVTRSFTSL 24780

Query: 711   VLKK-VQPWHAGQYEILLKNRVG 732
             V    V+   AG Y +  KNR G
Sbjct: 24781 VFPNGVERKDAGFYVVCAKNRFG 24803



 Score = 82.0 bits (201), Expect = 5e-15
 Identities = 70/273 (25%), Positives = 106/273 (38%), Gaps = 32/273 (11%)

Query: 23    RVDSMPLTEAPA-FILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGG---R 78
             R D+M L E P  F LP  N     G   +F   +  +PEP VTW+++GQ I  G    +
Sbjct: 25374 RTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKK 25433

Query: 79    FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK 138
             +  +   +G + L I++V  +D  +YT  A N  G      +LTV       L  P    
Sbjct: 25434 YTFESD-KGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV------TLHPPPTDS 25486

Query: 139   TLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGN 198
             TL                    P F   L     +EGQ   F  +++G P P + W K  
Sbjct: 25487 TL-------------------RPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDG 25527

Query: 199   VPLQPSARVS-VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSAN 257
              PL     +  + E      L I     +D G Y     N +G  S  A L ++ L    
Sbjct: 25528 QPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKK 25587

Query: 258   RSFVRETKATNSDVRKEVTNVISKESKLDSLEA 290
             + F +  +     V+K++   +     L   E+
Sbjct: 25588 QEF-KSKEEHERHVQKQIDKTLRMAEILSGTES 25619



 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 59/221 (26%), Positives = 100/221 (45%), Gaps = 7/221 (3%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRK--QIQESEHMKVENSENGSKLTILAARQEHCG 1237
             V+AG+++ L   V G       W K +    +  S  +K++   + SK ++  A++   G
Sbjct: 11908 VKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGG 11967

Query: 1238  CYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSY 1297
              Y +   N  GS  A   + V+DKP P        D+ S   T+ W     DGG  +Q+Y
Sbjct: 11968 KYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIV-DVSSDRCTVCWDPPEDDGGCEIQNY 12026

Query: 1298  SIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESEL--TT 1354
              +E  ++    W    AT  +    V  L+  +EY FRVRA N  GT  P++   +   T
Sbjct: 12027 ILEKCETKRMVWSTYSATVLTPGTTVTRLIEGNEYIFRVRAENKIGTGPPTESKPVIAKT 12086

Query: 1355  VGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFY 1395
               +KP  P D  EV+   ++E  V +     +  + ++ ++
Sbjct: 12087 KYDKPGRP-DPPEVTKVSKEEMTVVWNPPEYDGGKSITGYF 12126



 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 53/193 (27%), Positives = 89/193 (46%), Gaps = 4/193 (2%)

Query: 553   APIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLC 612
             AP   + + D+    G    ++ Q+ G P P++ W   G E+ +S  +     G  H+L 
Sbjct: 24227 APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLT 24286

Query: 613   IQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLIS 672
             +     ED G YTC A N  GEV T + L +Q       P +  K +   A +G ++ + 
Sbjct: 24287 VMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQ-FHPGYPLKEKYYGA-VGSTLRLH 24344

Query: 673   CAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQ-PWHAGQYEILLKNRV 731
                 G P P + W   G+ L +++ +  +   E    LV+K VQ   HAG+Y++ L N  
Sbjct: 24345 VMYIGRPVPAMTWFH-GQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVF 24403

Query: 732   GECSCQVSLMLQN 744
             G     + + +Q+
Sbjct: 24404 GTVDAILDVEIQD 24416



 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 75/315 (23%), Positives = 116/315 (36%), Gaps = 74/315 (23%)

Query: 12    ISKTSLSVDPSRVD---SMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHR 68
             ISKT   +   + D   S  L++APAFI  PR+  I EG    F   + G P P++ W +
Sbjct: 26805 ISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFK 26864

Query: 69    NGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL------- 121
             N  PI+      +    R  +SL I      D GKYT +A N  G    T  L       
Sbjct: 26865 NNLPISISSNVSISRS-RNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVE 26923

Query: 122   --------------TVEGSFAKQLGQPVVSKTLGD---------------RFSAPAVETR 152
                           +++GSF+ Q  Q   SK                   +F++ + ++ 
Sbjct: 26924 EPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSM 26983

Query: 153   PSIWGE--------------------------------CPPKFATKLGRVVVKEGQMGRF 180
              S+                                    PPK       + + EG++   
Sbjct: 26984 SSMQESFVEMSSSSFMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTV 27043

Query: 181   SCKITGRPQPQVTWLKG--NVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG 238
             +C  TG P P+VTW  G   +  Q   R  +   + +  L I  V + D G+YT  + N 
Sbjct: 27044 ACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNE 27103

Query: 239   SGKASMSAELSIQGL 253
              G  S +  + I+ +
Sbjct: 27104 FGSDSATVNIHIRSI 27118



 Score = 81.3 bits (199), Expect = 8e-15
 Identities = 123/536 (22%), Positives = 192/536 (35%), Gaps = 142/536 (26%)

Query: 5     KLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQV 64
             K +    I+KTS + +  R  +    E  AF      + I EG     +  + G  +  V
Sbjct: 26713 KSIVHEEITKTSQASEEVRTHA----EIKAF---STQMSINEGQRLVLKANIAGATD--V 26763

Query: 65    TWHRNGQPITSGGRFLLDCGIRGTF-SLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
              W  NG  +T+   +    G+ G+  +L I      D G  TC +    G  +   +LT+
Sbjct: 26764 KWVLNGVELTNSEEYRY--GVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL 26821

Query: 124   EGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCK 183
                          SK L D   APA  ++P                  + EGQ   F+C+
Sbjct: 26822 -------------SKELSD---APAFISQPRSQN--------------INEGQNVLFTCE 26851

Query: 184   ITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKAS 243
             I+G P P++ W K N+P+  S+ VS+S    +  LEI   +  D G YT    N  G+ S
Sbjct: 26852 ISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCS 26911

Query: 244   MSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEA--AAKSKNCSSPQ 301
              +A L +  L                 V +    V+ + S   SL+   +++S   S+ +
Sbjct: 26912 ATASLMVLPL-----------------VEEPSREVVLRTSGDTSLQGSFSSQSVQMSASK 26954

Query: 302   RGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGL 361
             +  S    ++S      E K  S      ++ Q   ++ +SSS                +
Sbjct: 26955 QEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSF---------------M 26999

Query: 362   GVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQ 421
             G+ + +  E                    S   + KA  R IP         PK E+ P 
Sbjct: 27000 GISNMTQLE-------------------SSTSKMLKAGIRGIP---------PKIEALPS 27031

Query: 422   SQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLN 481
                + E +          V+ VA                     C+  G P P +TW   
Sbjct: 27032 DISIDEGK----------VLTVA---------------------CAFTGEPTPEVTWSCG 27060

Query: 482   GQPI---QYARSTCE--AGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVH 532
             G+ I   +  R   E    +  L I D   +D G YT    N  G  S SA V +H
Sbjct: 27061 GRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFG--SDSATVNIH 27114



 Score = 80.9 bits (198), Expect = 1e-14
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 9/209 (4%)

Query: 1162  PPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE 1221
             PPKA +  ++    +   +RAG  + L   V G       W K  K++   E + ++ + 
Sbjct: 22738 PPKAELDARL--HGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTG 22795

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
               +   I    +   G YTL V+N  G++   V + V+D P  P G    S +     TL
Sbjct: 22796 KRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVLDSPG-PCGKLTVSRVTQEKCTL 22854

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             +W     DGG+ +  Y +E  +++   W  +   C + S+ V  L+ ++EY FRVRA+N 
Sbjct: 22855 AWSLPQEDGGAEITHYIVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNK 22914

Query: 1341  YG-----TSEPSQESELTTVGEKPEEPKD 1364
             YG      SEP       T+   P  P++
Sbjct: 22915 YGPGVPVESEPIVARNSFTIPSPPGIPEE 22943



 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 170/794 (21%), Positives = 285/794 (35%), Gaps = 143/794 (18%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+V   A++  S  +L     +V  +PL     FI P  ++ + E   AKFE  V   P+
Sbjct: 5513 GEVSFQAANAKSAANL-----KVKELPLI----FITPLSDVKVFEKDEAKFECEVSREPK 5563

Query: 62   PQVTWHRNGQPITSGGRF-LLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGA------ 114
                W +  Q IT   RF L+  G + +  +   A  +E +  +  E  + SG       
Sbjct: 5564 T-FRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGI 5622

Query: 115  --------RQVTVELTVEGSFAKQLGQPVV----------------------SKTLGDRF 144
                    + VT +      F  +L    +                       KT    F
Sbjct: 5623 RLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITF 5682

Query: 145  SAPAVETRPSIWGEC--------------PPKFATKLGRVVVKEGQMGRFSCKITGRPQP 190
               +++    I  E                P F  KL      E       C+I+    P
Sbjct: 5683 KDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP 5742

Query: 191  QVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
             V W K    ++PS    +      ++L +    + D+G YTC      G    S +L I
Sbjct: 5743 -VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDI 5797

Query: 251  QGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAA 310
            +     +R         + +V +  T     E   D + A  K K  +  Q         
Sbjct: 5798 E-----DREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQ--------- 5843

Query: 311  NSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEE 370
                +   E K+ S         QT  +   ++++   +A ++ +PR   +G+L P  + 
Sbjct: 5844 TPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVK-SSAHLRVKPRV--IGLLRPLKDV 5900

Query: 371  RKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQT 430
                     ATF      L  +D+  +   +   +E   D   P+ E K  +  +++   
Sbjct: 5901 TVTAG--ETATFDCE---LSYEDIPVEWYLKGKKLEPS-DKVVPRSEGKVHTLTLRD--- 5951

Query: 431  VKFRCEG--------------LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRI 476
            VK    G              L V E    F+  L+D  V EG   VL+C V      ++
Sbjct: 5952 VKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEV-SRENAKV 6010

Query: 477  TWLLNGQPIQYARS---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHE 533
             W  NG  I  ++      +  V +L I D  PED  TYTC A++   + SC+  V    
Sbjct: 6011 KWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDF--KTSCNLNVV--- 6065

Query: 534  KKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNE 593
                             P    FL+ L+DL+V +        ++S     +V W  +G E
Sbjct: 6066 -----------------PPHVEFLRPLTDLQVREKEMARFECELS-RENAKVKWFKDGAE 6107

Query: 594  IQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPW 653
            I++ + +    +G    L I +   +D   Y+CE   +    RT  +LTV E     +  
Sbjct: 6108 IKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTA----RTSGMLTVLE----EEAV 6159

Query: 654  FISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLK 713
            F     ++  S   ++ + C ++  P   V W +  + +  +TG +E+L       LV++
Sbjct: 6160 FTKNLANIEVSETDTIKLVCEVS-KPGAEVIWYKGDEEII-ETGRYEILTEGRKRILVIQ 6217

Query: 714  KVQPWHAGQYEILL 727
                  AG Y   L
Sbjct: 6218 NAHLEDAGNYNCRL 6231



 Score = 80.1 bits (196), Expect = 2e-14
 Identities = 181/813 (22%), Positives = 280/813 (34%), Gaps = 141/813 (17%)

Query: 29    LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
             L  AP   L  R+  +  G   +F   V+  P  +V W+ NG  +    +        G 
Sbjct: 26065 LDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYT-NTSGV 26123

Query: 89    FSLVIHAVHEEDRGKY---------------TCEATNGSGA------------RQVTVEL 121
              +L I   H +D G Y               T + T G               R V  EL
Sbjct: 26124 LTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPEL 26183

Query: 122   TVEGSFA----KQLGQPVVSKTLGDRFSAPAVETRPSIWG-------------------- 157
             T   ++A    K+  +   S ++ +   +   ETR S+                      
Sbjct: 26184 TRTEAYAVSSFKKTSEMEASSSVRE-VKSQMTETRESLSSYEHSASAEMKSAALEEKSLE 26242

Query: 158   ----------ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARV 207
                           +  TK   + V EG+  RFSC   G P P VTWL+    L  SAR 
Sbjct: 26243 EKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARH 26302

Query: 208   SVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKAT 267
              V+        EI  V   D G Y+ +V N  GK      L+IQ      ++ V E KA 
Sbjct: 26303 QVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ------KARVTE-KAV 26355

Query: 268   NSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKD 327
              S  R     V S E ++ S EA    K   SP+    P       P   + +  E  + 
Sbjct: 26356 TSPPR-----VKSPEPRVKSPEAVKSPKRVKSPE----PSHPKAVSPTETKPTPTEKVQH 26406

Query: 328   SPRTAPQ--TPVLQ-KTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAP-----PRP 379
              P +AP   T  L+ + S  I      V+              G++ K            
Sbjct: 26407 LPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSAD 26466

Query: 380   ATFPTRQPGLGSQDV---------VSKAANRRIPMEGQRDSAFPKFESK----PQSQEVK 426
              T+  +   L   D              +   +   GQ   +  +  SK     +S +  
Sbjct: 26467 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 26526

Query: 427   ENQTVKFRCEGLAVMEVA--PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRIT--WLLNG 482
                TV  + E  A   ++  P   + L+D  V    D V + +V+ T  PR T  W  +G
Sbjct: 26527 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTV--SSDSVAKFAVKATGEPRPTAIWTKDG 26584

Query: 483   QPI----QYARSTCEAG-VAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSS 537
             + I    +Y  S  + G   E+H  D    D G YTC  +N+ G VS S  +T+   K +
Sbjct: 26585 KAITQGGKYKLSEDKGGFFLEIHKTDT--SDSGLYTCTVKNSAGSVSSSCKLTIKAIKDT 26642

Query: 538   RKSEY-LLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQE 596
                +      +   P     +Q     K +   ++ M+         ++      +++  
Sbjct: 26643 EAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMS---EAKSQEKLALKEEASKVLI 26699

Query: 597   SEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS 656
             SE+    ++    SL    V  E T T       ++ EVRT A +              S
Sbjct: 26700 SEEV---KKSAATSLEKSIVHEEITKTS-----QASEEVRTHAEIKA-----------FS 26740

Query: 657   KPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQ 716
                S+    GQ +++   IAG     V W+ +G  L     +   +   D  TL +K+  
Sbjct: 26741 TQMSINE--GQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGSDQ-TLTIKQAS 26795

Query: 717   PWHAGQYEILLKNRVGECSCQVSLMLQNSSARA 749
                 G    + K + G   CQ  L L    + A
Sbjct: 26796 HRDEGILTCISKTKEGIVKCQYDLTLSKELSDA 26828



 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 48/163 (29%), Positives = 80/163 (49%), Gaps = 1/163 (0%)

Query: 1181  RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYT 1240
             +AG+++++   V G    T TW K  + +++++ +  E +   + L I    +   G Y 
Sbjct: 14773 KAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYP 14832

Query: 1241  LLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE 1300
             L   N +G     + + V D P PP G     ++ S  +T SW     DGG  + +Y +E
Sbjct: 14833 LTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVE 14892

Query: 1301  IWDSANKTWKELA-TCRSTSFNVQDLLPDHEYKFRVRAINVYG 1342
             +  + + TW ELA T   T++    L    EY+FRV+A N YG
Sbjct: 14893 MRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYG 14935



 Score = 79.3 bits (194), Expect = 3e-14
 Identities = 39/112 (34%), Positives = 62/112 (55%), Gaps = 1/112 (0%)

Query: 1669 EEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQS 1728
            EED  +     ++E +  V+  F   I++  ++EG    F CK+ GYP P++ W+KD + 
Sbjct: 1226 EEDGEEKMAVDISESEA-VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKR 1284

Query: 1729 IRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            I+    +Q+D+ +DG  SL I  V  +D+  YT  A N  G A C+ +L VE
Sbjct: 1285 IKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVE 1336



 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 148/719 (20%), Positives = 276/719 (38%), Gaps = 111/719 (15%)

Query: 35   FILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS-LVI 93
            F+ P  +L ++E   A+FE  +      +V W ++G  I  G ++  D   +G    LVI
Sbjct: 6071 FLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKY--DIISKGAVRILVI 6127

Query: 94   HAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRP 153
            +    +D  +Y+CE      +  +TV L  E  F K L    VS+T              
Sbjct: 6128 NKCLLDDEAEYSCEVRTARTSGMLTV-LEEEAVFTKNLANIEVSET-------------- 6172

Query: 154  SIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKN 213
                                     +  C+++ +P  +V W KG+  +  + R  +  + 
Sbjct: 6173 ----------------------DTIKLVCEVS-KPGAEVIWYKGDEEIIETGRYEILTEG 6209

Query: 214  GMQVLEIHGVNQDDVGVYTCLVVNG--SGKASMSAELSIQGLDSANRSFVRETKATNSDV 271
              ++L I   + +D G Y C + +    GK  +  EL+ + +       + E +      
Sbjct: 6210 RKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVH-ELAAEFISKPQNLEILEGE------ 6262

Query: 272  RKEVTNVISKES-----KLD--SLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLES 324
            + E    ISKES     K D  +LE+  K    +  ++       A  Q        + +
Sbjct: 6263 KAEFVCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGA 6322

Query: 325  CKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPT 384
                 R A    V++K    + L+  RV+ +        ++  G + K       A F +
Sbjct: 6323 A----RAAAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKW-FRNEEAIFDS 6377

Query: 385  RQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVA 444
             +  +  +D+V     R   ++ Q +  +    +  + + VK    +    E L ++E  
Sbjct: 6378 SKYIILQKDLVYTLRIRDAHLDDQAN--YNVSLTNHRGENVKSAANLIVEEEDLRIVEP- 6434

Query: 445  PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELH---I 501
                  LKD   +E +     C V    V  + W  NG+ + +            H   I
Sbjct: 6435 ------LKDIETMEKKSVTFWCKVNRLNVT-LKWTKNGEEVPFDNRVSYRVDKYKHMLTI 6487

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
            +D    D G Y                VT  + KS   +E L+  AP++     F++ L 
Sbjct: 6488 KDCGFPDEGEYI---------------VTAGQDKSV--AELLIIEAPTE-----FVEHLE 6525

Query: 562  DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
            D  V +      + Q+S      V W  NG EI+E + + FE+ G+ H L I++   +D 
Sbjct: 6526 DQTVTEFDDAVFSCQLS-REKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDE 6584

Query: 622  GTYTCEAWNSAGEVRTQAVLTVQE-PHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPF 680
              Y C       + +++A L V+E P +  +P     P+ +  + G  V+    +  D  
Sbjct: 6585 CEYAC----GVEDRKSRARLFVEEIPVEIIRP-----PQDILEAPGADVVFLAELNKDKV 6635

Query: 681  PTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS 739
              V WLR+   + +   H +++    +  L +  ++P   G+Y  + K++      +++
Sbjct: 6636 -EVQWLRNNMVVVQGDKH-QMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELA 6692



 Score = 78.6 bits (192), Expect = 5e-14
 Identities = 68/246 (27%), Positives = 109/246 (44%), Gaps = 42/246 (17%)

Query: 1156 KPAPKTPPKAAMPPQIIQFPE-----DQKVRAGESVELFGKVTGTQPITCTWMKFRK--- 1207
            +P+  TPP  A+ P  I  P+       +V+ G+ + L   ++G+   T TW+K      
Sbjct: 8359 EPSRATPPTKAVDP--IDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVIV 8416

Query: 1208 -----------------QIQESE--------HMKVENSENG-SKLTILAARQEHCGCYTL 1241
                             ++QE E         + ++NS+ G S+L +  + +   G Y +
Sbjct: 8417 PEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVRDSLRPDHGLYMI 8476

Query: 1242 LVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEI 1301
             VEN  G  +A   ++V+D P PP       DIR +S+   W     DGGS + +Y++E 
Sbjct: 8477 KVENDHGIAKAPCTVSVLDTPGPPINF-VFEDIRKTSVLCKWEPPLDDGGSEIINYTLEK 8535

Query: 1302 WDSA--NKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             D    +  W  + +T R   ++V  L+   EY FRVRA N +G   P     L  V + 
Sbjct: 8536 KDKTKPDSEWIVVTSTLRHCKYSVTKLIEGKEYLFRVRAENRFGPGPPCVSKPL--VAKD 8593

Query: 1359 PEEPKD 1364
            P  P D
Sbjct: 8594 PFGPPD 8599



 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 56/212 (26%), Positives = 97/212 (45%), Gaps = 7/212 (3%)

Query: 1159 PKTPPKAAMPP--QIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK 1216
            P T   A + P   +  F +  +V     + +    TG    T TW    K ++  + +K
Sbjct: 7078 PLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPRPTATWCFGDKVLETGDRVK 7137

Query: 1217 VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS 1276
            ++     ++L I  + +   G YTL +EN++ +   ++++ V+ +P  P       DI  
Sbjct: 7138 MKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEIDVNVIARPSAPKELK-FGDITK 7196

Query: 1277 SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTW-KELATCRSTSFNVQDLLPDHEYKFRV 1335
             S+ L+W     DGGS +  Y +E  + + KTW K +       F V DL+   EY F+V
Sbjct: 7197 DSVHLTWEPPDDDGGSPLTGYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKV 7256

Query: 1336 RAINVYGTSEPSQESE---LTTVGEKPEEPKD 1364
             A N  G  EP+   E   ++T    P+ P++
Sbjct: 7257 CARNKCGPGEPAYVDEPVNMSTPATVPDPPEN 7288



 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 69/335 (20%), Positives = 137/335 (40%), Gaps = 41/335 (12%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             PA  ++L  V  ++   +L   +   D  + I   L     K + F + +      + ++
Sbjct: 22241 PAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHTKQLTFTV 22300

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             E+ + +    ++  AKNDAG +E                         P+ +   V+   
Sbjct: 22301 ERLVEKTEYEFRVKAKNDAGYSE-------------------------PREAFSSVI--- 22332

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
                 +K+     T     +  Q+I        +AG    +   ++G      TW     +
Sbjct: 22333 ----IKEPQIEPTADLTGITNQLIT------CKAGSPFTIDVPISGRPAPKVTWKLEEMR 22382

Query: 1209  IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGT 1268
             ++E++ + +  +++ + LT+  + +   G Y L +EN  G +   V + V+ +P P  G 
Sbjct: 22383 LKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGP 22442

Query: 1269  PCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLP 1327
                S + + S  LSW      GG+ + +Y +E  +S    W+ + ++ + T   V  L  
Sbjct: 22443 IEVSSVSAESCVLSWGEPKDGGGTEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHLTK 22502

Query: 1328  DHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
               EY FRV + N +G S+P + + +  + E P  P
Sbjct: 22503 YMEYSFRVSSENRFGVSKPLESAPI--IAEHPFVP 22535



 Score = 77.0 bits (188), Expect = 2e-13
 Identities = 81/346 (23%), Positives = 127/346 (36%), Gaps = 63/346 (18%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P  K       V  G+ L ++  +S  P  TI WT +G  LK T  I ++    L ++SI
Sbjct: 16925 PDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSI 16984

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             ++   +D G Y     N  GQ   S ++   D P  +  K P                  
Sbjct: 16985 KETHKDDGGQYGITVANVVGQKTASIEIVTLDKP--DPPKGPV---------------KF 17027

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
              D + +       PP      QI  +   ++                   T  W      
Sbjct: 17028 DDVSAESITLSWNPPLYTGGCQITNYIVQKR----------------DTTTTVWDVVSAT 17071

Query: 1209  IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV-----DKPD 1263
             +  +  +KV   + G++             + +  EN+ G   A  +  +V      +P 
Sbjct: 17072 VARTT-LKVTKLKTGTEYQ-----------FRIFAENRYGQSFALESDPIVAQYPYKEPG 17119

Query: 1264  PPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCR 1316
             PP GTP A+ I   S+ + W+    +GGS V  Y +E       +W   NKT        
Sbjct: 17120 PP-GTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILWTKVNKT-----IIH 17173

Query: 1317  STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
              T F  Q+L    EY+FRV A N+ G  + S+ SE     +  + P
Sbjct: 17174 DTQFKAQNLEEGIEYEFRVYAENIVGVGKASKNSECYVARDPCDPP 17219



 Score = 76.6 bits (187), Expect = 2e-13
 Identities = 85/383 (22%), Positives = 150/383 (39%), Gaps = 47/383 (12%)

Query: 1031 FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEK 1090
            F + L+D  V E    +  CQ+S +  A + W  NG+ +K  K     ++GS+  + I+ 
Sbjct: 6520 FVEHLEDQTVTEFDDAVFSCQLSREK-ANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKD 6578

Query: 1091 ALPEDRGLYKCVAKNDAGQAECSCQ-VTVD---------DAPASENTKAPEMKSRRP--- 1137
               +D   Y C  ++   +A    + + V+         +AP ++     E+   +    
Sbjct: 6579 CRLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQ 6638

Query: 1138 --KSSLPPVLGTESDAT-----------------------VKKKPAPKTPPKAAMPPQII 1172
              ++++  V G +                           + K    +   + A  P+I 
Sbjct: 6639 WLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIK 6698

Query: 1173 QFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAAR 1232
               +D  V  G+ + +             W K  + +       ++ +   +   IL A+
Sbjct: 6699 TADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKT---IDTTAEQTSFRILEAK 6755

Query: 1233 QEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGS 1292
            +   G Y ++++NK G  +  +NL V+D P P       ++     ++L+W     DGGS
Sbjct: 6756 KGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLE-VTETFDGEVSLAWEEPLTDGGS 6814

Query: 1293 AVQSYSIEIWDSANKTWKELATCRSTS--FNVQDLLPDH-EYKFRVRAINVYGTSEPSQE 1349
             +  Y +E  D   KTW  LAT R+ S  F V  L     EY FRV A N  GT EP + 
Sbjct: 6815 KIIGYVVERRDIKRKTW-VLATDRAESCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVET 6873

Query: 1350 SELTTVGEKPEEPKDEVEVSDDD 1372
                    K + P   + V+  D
Sbjct: 6874 DNPVEARSKYDVPGPPLNVTITD 6896



 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 43/138 (31%), Positives = 66/138 (47%), Gaps = 2/138 (1%)

Query: 1652 SSTGSPTSPLNAEKLESEE-DVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDC 1710
            S TG+       E L   E  V++        E P   P     ++++ V+EG +   +C
Sbjct: 859  SITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLEC 918

Query: 1711 KIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE 1770
             I GYP P V W+++D  I  S  FQI + + G   L+I +   +D  ++TC AVN  G 
Sbjct: 919  HISGYPSPTVTWYREDYQIESSIDFQITF-QSGIARLMIREAFAEDSGRFTCSAVNEAGT 977

Query: 1771 ATCTAELIVETMEEGEGE 1788
             + +  L V+  EE E E
Sbjct: 978  VSTSCYLAVQVSEEFEKE 995



 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 129/604 (21%), Positives = 220/604 (36%), Gaps = 74/604 (12%)

Query: 550  KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQH 609
            K   P+    L D    +G  V +T  ++     EV W      +   E F   Q    +
Sbjct: 4431 KEDGPMIHTPLVDTVSEEGDIVHLTTSITN--AKEVNWYFENKLVPSDEKFKCLQDQNTY 4488

Query: 610  SLCIQEVFPED-TGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQS 668
            +L I +V  ED  G Y CEA N +G+  T A LTV +      P    K   +  +LG  
Sbjct: 4489 TLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLTVVKR---AAPVIKRKIEPLEVALGHL 4545

Query: 669  VLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLK 728
               +C I   P     W + G+ +  ++    +  ++ + +L + + Q    G+Y     
Sbjct: 4546 AKFTCEIQSAPNVRFQWFKAGREIY-ESDKCSIRSSKYISSLEILRTQVVDCGEYTCKAS 4604

Query: 729  NRVGECSCQVSLMLQ----NSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGW 784
            N  G  SC  +L +         R L   R+P   E++                S+    
Sbjct: 4605 NEYGSVSCTATLTVTVPGGEKKVRKLLPERKPEPKEEVV-------------LKSVLRKR 4651

Query: 785  PARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSED 844
            P   +  +E +  E V    K+         + + + EV  +  R+   +K+   T   +
Sbjct: 4652 PEEEEPKVEPKKLEKV----KKPAVPEPPPPKPVEEVEVPTVTKRE---RKIPEPTKVPE 4704

Query: 845  DLKEIPAEQMDFRANLQRQV---KPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVPEK 901
                IP    + +   + +V   KP  V  E   + +P  V    V+ KK  +K P  E 
Sbjct: 4705 IKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTV---PVVGKKAEAKAPKEEA 4761

Query: 902  VPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVE---SSKPLSNAQPSGPLKPVG 958
              P  P       + G  KK P+   +   +       E      P +    + PLK V 
Sbjct: 4762 AKPKGP-------IKGVPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVK 4814

Query: 959  NAKPAETLKP--MGNAKPAETLKPMGNA-----KPDENLKSASKEELKKDVKN------- 1004
              K     +   +G++   E L     A     K   N++ + K     D K+       
Sbjct: 4815 EIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIID 4874

Query: 1005 -------DVNC--KRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSD 1055
                   +  C  + G+   T   K    +      K   ++V V +G+ L L C+++ +
Sbjct: 4875 VQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKE 4934

Query: 1056 PPATIIWTLNGK-TLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSC 1114
                ++W  +GK  ++    I+    G + +++I  A   D G Y    +N A   ECS 
Sbjct: 4935 --RDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN-ANNLECSS 4991

Query: 1115 QVTV 1118
             V V
Sbjct: 4992 CVKV 4995



 Score = 75.9 bits (185), Expect = 3e-13
 Identities = 89/411 (21%), Positives = 156/411 (37%), Gaps = 69/411 (16%)

Query: 983  NAKPDENLKSASKEELKKDVKNDVNCKRGHA-GTTDNEKRSES-----QGTAPAFKQKLQ 1036
            N++P ++LK   +E +  D +  +  +  +A G ++  + SE+         P    +  
Sbjct: 8030 NSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETH 8089

Query: 1037 DVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDR 1096
            D+ V EG+KL +     + P  T+ W  +GK +K +  + +  +     + + K++  D 
Sbjct: 8090 DIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADA 8149

Query: 1097 GLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKK 1156
            G+Y    +N  G A  S  V V   P        ++K+              SD T    
Sbjct: 8150 GIYTITLENKLGSATASINVKVIGLPGP----CKDIKA--------------SDITKSSC 8191

Query: 1157 PAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK 1216
                 PP+                             G  PI   ++  R++     ++ 
Sbjct: 8192 KLTWEPPE---------------------------FDGGTPIL-HYVLERREAGRRTYIP 8223

Query: 1217 VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ--AQVNLTVVDKPDPPAGTPCASDI 1274
            V + EN    T+          + +   NK+G  +     N  +   P  P   P   ++
Sbjct: 8224 VMSGENKLSWTVKDLIPNGEYFFRVKAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEV 8283

Query: 1275 RS---SSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-----TSFNVQDLL 1326
             +    ++T++W    YDGGS +  Y IE      + WK    C        ++  + L 
Sbjct: 8284 HNPTAEAMTITWKPPLYDGGSKIMGYIIEKIAKGEERWKR---CNEHLVPILTYTAKGLE 8340

Query: 1327 PDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPK----DEVEVSDDDE 1373
               EY+FRVRA N  G SEPS+ +  T   +  + PK      +EV   DE
Sbjct: 8341 EGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDE 8391



 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 82/367 (22%), Positives = 148/367 (40%), Gaps = 49/367 (13%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V+V  G  L +   +S  P   +  + +G  LK T            ++++++++  D G
Sbjct: 20181 VYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAG 20240

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLG--TESDATVKK 1155
              Y+  A N +G  +    + V D P                   P V+   TE   T+K 
Sbjct: 20241 RYEITAANSSGTTKAFINIVVLDRPGPPTG--------------PVVISDITEESVTLKW 20286

Query: 1156  KPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM 1215
             +P PK    + +   I+       ++   S  ++ +V+ T  +  T MK  K     E+ 
Sbjct: 20287 EP-PKYDGGSQVTNYIL-------LKRETSTAVWTEVSAT--VARTMMKVMKLTTGEEYQ 20336

Query: 1216  KVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIR 1275
                 +EN                    + + + S    V L     P PP+ TP  +++ 
Sbjct: 20337 FRIKAEN-----------------RFGISDHIDSACVTVKLPYTT-PGPPS-TPWVTNVT 20377

Query: 1276  SSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYKF 1333
               S+T+ W+    +GGSAV  Y +E+ D  +  W++      R+T F V  +     Y+F
Sbjct: 20378 RESITVGWHEPVSNGGSAVVGYHLEMKDRNSILWQKANKLVIRTTHFKVTTISAGLIYEF 20437

Query: 1334  RVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             RV A N  G  +PS  SE     +  E P++ V ++D  +    + ++    +   K++ 
Sbjct: 20438 RVYAENAAGVGKPSHPSEPVLAIDACEPPRN-VRITDISKNSVSLSWQQPAFDGGSKITG 20496

Query: 1394  FYDIEER 1400
              Y +E R
Sbjct: 20497 -YIVERR 20502



 Score = 73.6 bits (179), Expect = 2e-12
 Identities = 33/91 (36%), Positives = 56/91 (61%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P+F K ++ +   +G  A F+  + G P P V WFK+++ +  S ++ I ++ +G+ + I
Sbjct: 3767 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3826

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
            ++D   +D   Y CKA N LGE+TC AEL+V
Sbjct: 3827 VNDPQREDSGLYICKAENMLGESTCAAELLV 3857



 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 49/174 (28%), Positives = 84/174 (48%), Gaps = 12/174 (6%)

Query: 1206  RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG------SRQAQVNLTVV 1259
             R+++ ++    +++   G+ L +   ++     + +  EN+ G      S +     T +
Sbjct: 23962 RREVPKAAWYTIDSRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVTPKTPL 24021

Query: 1260  DKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTW--KELATCRS 1317
             + P+PP+  P   D+  SS++LSW     DGGS V  Y IE  +++   W         +
Sbjct: 24022 NPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNKTQITT 24081

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG---EKPEEPKDEVEV 1368
             T + V  L+PD EY+FR+ A N  G SE S  SE        +KP +P  E+E+
Sbjct: 24082 TMYTVTGLVPDAEYQFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQP-GELEI 24134



 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 52/197 (26%), Positives = 86/197 (43%), Gaps = 5/197 (2%)

Query: 1159 PKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVE 1218
            P+ PP   +    +      ++ AG+++ +   VTG    T  W K   ++ + + + ++
Sbjct: 8793 PQEPPAVELD---VSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRVVID 8848

Query: 1219 NSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSS 1278
            N    S+L I  A ++  G Y +   N  GS+ A   + V D P P          R   
Sbjct: 8849 NVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMC 8908

Query: 1279 LTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAI 1338
            L L+W     DGGS +  + IE  D+   TW++      +  ++  LL   EYKFRV A 
Sbjct: 8909 L-LNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAK 8967

Query: 1339 NVYGTSEPSQESELTTV 1355
            N +G   P +   +  V
Sbjct: 8968 NKFGCGPPVEIGPILAV 8984



 Score = 71.6 bits (174), Expect = 6e-12
 Identities = 42/114 (36%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---C 1315
             +D P PPA    A D   SS+TL W    YDGGSAV  Y +EI     + W  ++T    
Sbjct: 20859 IDPPGPPAKIRIA-DSTKSSITLGWSKPVYDGGSAVTGYVVEIRQGEEEEWTTVSTKGEV 20917

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
             R+T + V +L P   Y FRV A+N  G  EP + +E     +  E P+ +++V+
Sbjct: 20918 RTTEYVVSNLKPGVNYYFRVSAVNCAGQGEPIEMNEPVQAKDILEAPEIDLDVA 20971



 Score = 71.2 bits (173), Expect = 8e-12
 Identities = 52/180 (28%), Positives = 81/180 (45%), Gaps = 19/180 (10%)

Query: 1197 PITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVN- 1255
            P T  W++  K   +    +V+   N  K             + +L EN  G  +   + 
Sbjct: 7619 PDTDKWVRCNKMPVKDTTYRVKGLTNKKKYR-----------FRVLAENLAGPGKPSKST 7667

Query: 1256 --LTVVDKPDPP--AGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
              + + D  DPP   G P   D+  +S+ L+W    +DGG+ ++SY IE+  +    W  
Sbjct: 7668 EPILIKDPIDPPWPPGKPTVKDVGKTSVRLNWTKPEHDGGAKIESYVIEMLKTGTDEWVR 7727

Query: 1312 LAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK--PEEPKDEVEV 1368
            +A    +T   +  L+   EY FRVRA+N  G SEPS+ S+     EK  P  P   +EV
Sbjct: 7728 VAEGVPTTQHLLPGLMEGQEYSFRVRAVNKAGESEPSEPSDPVLCREKLYPPSPPRWLEV 7787



 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 70/286 (24%), Positives = 121/286 (42%), Gaps = 28/286 (9%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+  +VA +   ++S+SV  + V+++     P F+   +N+ IKEG+  + + R  G P 
Sbjct: 1480 GEWTVVAQNRAGRSSISVILT-VEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPN 1538

Query: 62   PQVTWHRNGQPIT--SGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTV 119
            P + W +N   I      +  ++ G +G  +L I +   +D   YT  A N +G      
Sbjct: 1539 PDIVWLKNSDIIVPHKYPKIRIE-GTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRC 1597

Query: 120  ELTVEGSFAKQLGQPVVSKTLG----DRFSAPAVETRPSIWG--------------ECPP 161
            ++ VE  FA+   +  +    G       +AP +E     +G              +  P
Sbjct: 1598 KVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKP 1657

Query: 162  KFATKLGRVVVKEGQMGRFSCKIT--GRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
             F  KL  + +K      F C++T  G P   V WL    PL+ + R+ +  + G   L+
Sbjct: 1658 FFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLD 1717

Query: 220  IHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETK 265
                   D G+ TC   N  G    SA L ++      +S V E++
Sbjct: 1718 YGVAYSRDSGIITCRATNKYGTDHTSATLIVKD----EKSLVEESQ 1759



 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 65/250 (26%), Positives = 97/250 (38%), Gaps = 23/250 (9%)

Query: 1022 SESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEG 1081
            SE +GT P F +++ +  ++ G    L   V   P   I W  NG  L  +       +G
Sbjct: 3642 SEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDG 3701

Query: 1082 SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSL 1141
               S+ I     ED G Y C+A ND G+  CS  + +       N+K    K        
Sbjct: 3702 DDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKI-------NSKGEGHKD------- 3747

Query: 1142 PPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCT 1201
                 TE+++ V K       P    PP  ++  +  +   G        V G    T T
Sbjct: 3748 -----TETESAVAKSLEKLGGP---CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVT 3799

Query: 1202 WMKFRKQIQESEHMKVENSENGSKLTIL-AARQEHCGCYTLLVENKLGSRQAQVNLTVVD 1260
            W K  KQ+  S +  + ++ NGS   I+   ++E  G Y    EN LG       L V+ 
Sbjct: 3800 WFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLVLL 3859

Query: 1261 KPDPPAGTPC 1270
            +      TPC
Sbjct: 3860 EDTDMTDTPC 3869



 Score = 70.9 bits (172), Expect = 1e-11
 Identities = 92/386 (23%), Positives = 152/386 (39%), Gaps = 75/386 (19%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V V  G  + L+      P  +I W  +G  LK ++F+  S+  +  ++SI+ A  E  G
Sbjct: 21268 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGG 21327

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKP 1157
              Y  +  N        C++ V   P +  T  P  K + P                    
Sbjct: 21328 KYTVILDNAV------CRIAV---PITVITLGPPSKPKGP-------------------- 21358

Query: 1158  APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKV---TGTQPITCTWMKFRKQIQESEH 1214
                           I+F E +     +SV L   V    G   ITC  ++ R+  Q +  
Sbjct: 21359 --------------IRFDEIK----ADSVILSWDVPEDNGGGEITCYSIEKRETSQTNWK 21400

Query: 1215  MKVEN-SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGT 1268
             M   + +    K+  L    E+   + +  EN+ G  Q  V+  +V K     P PP G 
Sbjct: 21401 MVCSSVARTTFKVPNLVKDAEYQ--FRVRAENRYGVSQPLVSSIIVAKHQFRIPGPP-GK 21457

Query: 1269  PCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CRSTSFNVQDLL 1326
             P   ++ S  ++L+W    YDGGS V  + +E  +  +  W+++ T       +    L+
Sbjct: 21458 PVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPISGREYRATGLV 21517

Query: 1327  PDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTIN 1386
                +Y+FRV A N  G S PS  S+  T+   P +P    +  D       V   T+T+ 
Sbjct: 21518 EGLDYQFRVYAENSAGLSSPSDPSKF-TLAVSPVDPPGTPDYID-------VTRETITLK 21569

Query: 1387  TEQKVSD------FYDIEERLGSGKF 1406
                 + D       Y IE+R G+ ++
Sbjct: 21570 WNPPLRDGGSKIVGYSIEKRQGNERW 21595



 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 79/335 (23%), Positives = 125/335 (37%), Gaps = 54/335 (16%)

Query: 1035 LQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPE 1094
            L  + V  G K+ L   V+  P   I WT     LK  K I +       +V+I  +   
Sbjct: 7392 LAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRS 7451

Query: 1095 DRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVK 1154
            D G Y   A N  G+A    +V V D P                   PP     +D T +
Sbjct: 7452 DTGTYIIEAVNVCGRATAVVEVNVLDKPG------------------PPAAFDITDVTNE 7493

Query: 1155 KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEH 1214
                   PP+     +I  +  +++    E                 W K    ++++  
Sbjct: 7494 SCLLTWNPPRDDGGSKITNYVVERRATDSE----------------VWHKLSSTVKDTNF 7537

Query: 1215 MKVENSENGSKLTILAARQEHCGCYTLLVENKLG-SRQAQVN-LTVVDKPDPPAGTPC-- 1270
                      K T L   +E+   + +  EN  G     Q + +T   + DPP G P   
Sbjct: 7538 ----------KATKLIPNKEY--IFRVAAENMYGVGEPVQASPITAKYQFDPP-GPPTRL 7584

Query: 1271 -ASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLP 1327
              SDI   ++TL+W     DGGS +  Y +E  D     W        + T++ V+ L  
Sbjct: 7585 EPSDITKDAVTLTWCEPDDDGGSPITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTN 7644

Query: 1328 DHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
              +Y+FRV A N+ G  +PS+ +E   + +  + P
Sbjct: 7645 KKKYRFRVLAENLAGPGKPSKSTEPILIKDPIDPP 7679



 Score = 70.1 bits (170), Expect = 2e-11
 Identities = 39/94 (41%), Positives = 55/94 (58%), Gaps = 3/94 (3%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESR--HFQIDYDEDGNCS 1746
            P F++ ++ + V+EGS A F+  I G+P PEV WF+D Q I  S     QI +  DG   
Sbjct: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISF-SDGRAK 64

Query: 1747 LIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            L I  V   +  +Y+ KA N  G+AT TAEL+V+
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 153/729 (20%), Positives = 270/729 (37%), Gaps = 101/729 (13%)

Query: 438  LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVA 497
            L V E+   F+  LKD  V E +    +C +  T    + W      I+ +         
Sbjct: 5174 LTVKEIELDFAVPLKDVTVPERRQARFECVL--TREANVIWSKGPDIIKSSDKFDIIADG 5231

Query: 498  ELHI---QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAP 554
            + HI    D+  +D G YT   E    + S   +VT    K                   
Sbjct: 5232 KKHILVINDSQFDDEGVYTAEVEGK--KTSARLFVTGIRLK------------------- 5270

Query: 555  IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQ 614
             F+  L D  V +G   T   ++S +    V+W  N  ++  S        G  H L ++
Sbjct: 5271 -FMSPLEDQTVKEGETATFVCELS-HEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMK 5328

Query: 615  EVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCA 674
            EV  +D      +      E+ + A L V E      P+F  K    TA     + + C 
Sbjct: 5329 EVTLDDISQIKAQV----KELSSTAQLKVLE----ADPYFTVKLHDKTAVEKDEITLKCE 5380

Query: 675  IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
            ++ D    V W +DG+ +      + +  +     L +KK      G+Y          C
Sbjct: 5381 VSKDV--PVKWFKDGEEIVPSP-KYSIKADGLRRILKIKKADLKDKGEYV---------C 5428

Query: 735  SCQVSLMLQNSSARA-LPRGREPASCEDLCGGGVG---ADGGGSDRYGSLRPGWPARGQG 790
             C       N +  A L +  +P    ++  G       +    D +G     W  +GQ 
Sbjct: 5429 DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQ----WKLKGQP 5484

Query: 791  WLEEEDGEDVRGVLKRRV--------ETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLS 842
                 D E +    K  +         T + + +A   +    L  ++L    +    LS
Sbjct: 5485 LTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKEL--PLIFITPLS 5542

Query: 843  EDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQV--DFRSVLAKKGTSKTPVPE 900
              D+K    ++  F   + R+  PKT     R +   Q++  D R  L K GT  + V +
Sbjct: 5543 --DVKVFEKDEAKFECEVSRE--PKTF----RWLKGTQEITGDDRFELIKDGTKHSMVIK 5594

Query: 901  KVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNA 960
                   A   F +      +    +G    E +  K +   K ++  +    +  V  +
Sbjct: 5595 SAAFEDEAKYMFEA------EDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELS 5648

Query: 961  KPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEK 1020
                 +K   N +   T + + + + +    S + ++L  D  + +  +    G +   K
Sbjct: 5649 HDNIRVKWFKNDQRLHTTRSV-SMQDEGKTHSITFKDLSIDDTSQIRVEA--MGMSSEAK 5705

Query: 1021 RSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQE 1080
             +  +G  P F  KLQD    E  +++LQC++S    A + W  +GK +K +K  ++  +
Sbjct: 5706 LTVLEGD-PYFTGKLQDYTGVEKDEVILQCEISK-ADAPVKWFKDGKEIKPSKNAVIKAD 5763

Query: 1081 GSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSS 1140
            G    + ++KAL  D G Y C    D G  + S ++ ++D          E+K  RP  S
Sbjct: 5764 GKKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDR---------EIKLVRPLHS 5810

Query: 1141 LPPVLGTES 1149
            +  V+ TE+
Sbjct: 5811 V-EVMETET 5818



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 94/414 (22%), Positives = 156/414 (37%), Gaps = 55/414 (13%)

Query: 1148  ESDATVKKKP-----APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTW 1202
             ESD  V + P      P TP   A+    +     + V  G S  +   +   +  +  W
Sbjct: 17105 ESDPIVAQYPYKEPGPPGTPFATAISKDSMVIQWHEPVNNGGSPVIGYHLERKERNSILW 17164

Query: 1203  MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
              K  K I      K +N E G +             + +  EN +G  +A  N       
Sbjct: 17165 TKVNKTIIHDTQFKAQNLEEGIEYE-----------FRVYAENIVGVGKASKNSECYVAR 17213

Query: 1263  DP--PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCR--ST 1318
             DP  P GTP    ++ + +TL W    YDGGS +  Y +E  D  +  W + +      T
Sbjct: 17214 DPCDPPGTPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIET 17273

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEP--------KDEVEVS 1369
              F V  L  D  Y+FRV A N  G  S+PS  +   T  ++ E P        +D + V+
Sbjct: 17274 QFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVN 17333

Query: 1370  DDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFR--LVEKKTRKVWAGKF-F 1426
               +    E D     + T + +    +IEE          F+  L+ K   ++  G++  
Sbjct: 17334 AGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYIL 17393

Query: 1427  KAYSAKEKENIRQEISIMNCLHHPK-LVQCVDAFEEKANIVMVLEIVSGGELFERIIDED 1485
             +A +    ++    + +++    P+  VQ      EK ++     +  GG      + E 
Sbjct: 17394 RASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLTWSPPLQDGGSDISHYVVEK 17453

Query: 1486  FE-------LTERECIKYMRQIS---EGVEYIHKQGIVHLDLKPENIMCVNKTG 1529
              E       +   E +    +++   EG EY+ +            IM VNK G
Sbjct: 17454 RETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFR------------IMAVNKYG 17495



 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 9/140 (6%)

Query: 1237  GC---YTLLVENKLGSRQAQVNLTVVDKPDP-----PAGTPCASDIRSSSLTLSWYGSSY 1288
             GC   Y +  EN  G         ++   DP     P   P   D   +++T++W    +
Sbjct: 19745 GCEYEYRVYAENAAGLSLPSETSPLIRAEDPVFLPSPPSKPKIVDSGKTTITIAWVKPLF 19804

Query: 1289  DGGSAVQSYSIEIWDSANKTWK-ELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             DGG+ +  Y++E   S +  WK  + + R T + +  L    EY FRV+++N  G S+PS
Sbjct: 19805 DGGAPITGYTVEYKKSDDTDWKTSIQSLRGTEYTISGLTTGAEYVFRVKSVNKVGASDPS 19864

Query: 1348  QESELTTVGEKPEEPKDEVE 1367
               S+     E+ EEP  +++
Sbjct: 19865 DSSDPQIAKEREEEPLFDID 19884



 Score = 68.9 bits (167), Expect = 4e-11
 Identities = 84/348 (24%), Positives = 127/348 (36%), Gaps = 66/348 (18%)

Query: 1029  PAFKQKLQDV-HVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKF--IILSQEGSLCS 1085
             P    KL  V  V  G  + L+  V   P   + WT +      T+   + +        
Sbjct: 11896 PVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSK 11955

Query: 1086  VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPAS-ENTKAPEMKSRRPKSSLPPV 1144
              S+ KA   D G Y   A N AG       V V D P    N K  ++ S R        
Sbjct: 11956 FSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDR-------- 12007

Query: 1145  LGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
                    TV   P P+      +   I++  E +++                     W  
Sbjct: 12008 ------CTVCWDP-PEDDGGCEIQNYILEKCETKRM--------------------VWST 12040

Query: 1205  FRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK--- 1261
             +   +             G+ +T L    E+   + +  ENK+G+     +  V+ K   
Sbjct: 12041 YSATVLTP----------GTTVTRLIEGNEYI--FRVRAENKIGTGPPTESKPVIAKTKY 12088

Query: 1262  -----PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--AT 1314
                  PDPP  T  + +     +T+ W    YDGG ++  Y +E  +  +  W  +  + 
Sbjct: 12089 DKPGRPDPPEVTKVSKE----EMTVVWNPPEYDGGKSITGYFLEKKEKHSTRWVPVNKSA 12144

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                    VQ+LLPDHEY+FRV+A N  G  EPS  S    V + P EP
Sbjct: 12145 IPERRMKVQNLLPDHEYQFRVKAENEIGIGEPSLPSR-PVVAKDPIEP 12191



 Score = 68.6 bits (166), Expect = 5e-11
 Identities = 81/389 (20%), Positives = 141/389 (36%), Gaps = 63/389 (16%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P+ +      +V   ++L +       P AT+ W  +G+TLK T  + +S   ++ S+SI
Sbjct: 19090 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSI 19149

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             ++A  ED G Y+    N AG       + V D P                   PP     
Sbjct: 19150 KEASKEDVGTYELCVSNSAGSITVPITIIVLDRPG------------------PPGPIRI 19191

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQ 1208
              + +         PP+     QI  +  ++K                +  + TW    + 
Sbjct: 19192 DEVSCDSITISWNPPEYDGGCQISNYIVEKK----------------ETTSTTWHIVSQA 19235

Query: 1209  IQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK----PDP 1264
             +  +  +K+     GS+             + +  EN+ G      +  VV +    P  
Sbjct: 19236 VARTS-IKIVRLTTGSEYQ-----------FRVCAENRYGKSSYSESSAVVAEYPFSPPG 19283

Query: 1265  PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCRS 1317
             P GTP       S++ ++W     DGGS V  Y +E       +W  ANK          
Sbjct: 19284 PPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANK-----ILIAD 19338

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPE 1377
             T   V  L     Y++RV A N+ G  + S+  E       P +P  + EV++   K   
Sbjct: 19339 TQMKVSGLDEGLMYEYRVYAENIAGIGKCSKSCE-PVPARDPCDPPGQPEVTNITRKSVS 19397

Query: 1378  VDYRTVTINTEQKVSDFYDIEERLGSGKF 1406
             + +     +   K++ +      L  G++
Sbjct: 19398 LKWSKPHYDGGAKITGYIVERRELPDGRW 19426



 Score = 68.6 bits (166), Expect = 5e-11
 Identities = 60/294 (20%), Positives = 118/294 (40%), Gaps = 57/294 (19%)

Query: 1022  SESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEG 1081
             S+    APAF  + +  ++ EG+ +L  C++S +P   I W  N   +  +  + +S+  
Sbjct: 26822 SKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSR 26881

Query: 1082  SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV---DDAPASE------------- 1125
             ++ S+ I  A   D G Y   AKN  GQ   +  + V    + P+ E             
Sbjct: 26882 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQG 26941

Query: 1126  --NTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAA----------------- 1166
               ++++ +M + + ++S      + + +  + K A  +    +                 
Sbjct: 26942 SFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGI 27001

Query: 1167  --------------------MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
                                 +PP+I   P D  +  G+ + +    TG      TW    
Sbjct: 27002 SNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGG 27061

Query: 1207  KQI--QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
             ++I  QE     +EN+++ + L I+  +++  G YTL + N+ GS  A VN+ +
Sbjct: 27062 RKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 86/356 (24%), Positives = 138/356 (38%), Gaps = 82/356 (23%)

Query: 1029 PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT---TKFIILSQEGSLCS 1085
            P   Q+LQ V V  GK       +S  P   I W    + L T    KF+   QE +L  
Sbjct: 3193 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3252

Query: 1086 VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVL 1145
            +   +A PED  +Y C AKND G A  S  ++V+          PE+ S  P   +P   
Sbjct: 3253 I---EAFPEDAAVYTCEAKNDYGVATTSASLSVE---------VPEVVS--PDQEMP--- 3295

Query: 1146 GTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF 1205
                                  PP II   +D     G+      +V+GT  +  +W   
Sbjct: 3296 --------------------VYPPAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSK 3334

Query: 1206 RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV-VDKPDP 1264
             K+I+ S   ++   E+  +L I  A  E  G YT +  N +G   +  NL++ V   D 
Sbjct: 3335 DKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDR 3394

Query: 1265 PAGTPCASDIRSSSLT--------------------LSWYGSSYDGGSAVQSYSIEIWDS 1304
             +      D+R S+ +                     S+ GSSY+       Y +++++S
Sbjct: 3395 QSS---GKDVRESAKSQAVADSSFTKEESKISQKEIKSFQGSSYE-------YEVQVFES 3444

Query: 1305 ANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPE 1360
             ++      +   T+ +VQD    H          +  ++E S+E    + GE P+
Sbjct: 3445 VSQ------SSIHTAASVQDTQLCHTASLS----QIAESTELSKECAKESTGEAPK 3490



 Score = 67.8 bits (164), Expect = 9e-11
 Identities = 72/265 (27%), Positives = 99/265 (37%), Gaps = 26/265 (9%)

Query: 389  LGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQE--VKENQTVKFR-CEGLAVMEVAP 445
            L +  V    A+  +  E Q +S  P  E +  S E   +E  TVK +  EG  + E  P
Sbjct: 4376 LDATPVTKGVASAVVSDEKQDESLKPSEEKEESSSESGTEEVATVKIQEAEGGLIKEDGP 4435

Query: 446  SFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI---QYARSTCEAGVAELHIQ 502
               + L D    EG    L  S+  T    + W    + +   +  +   +     L I 
Sbjct: 4436 MIHTPLVDTVSEEGDIVHLTTSI--TNAKEVNWYFENKLVPSDEKFKCLQDQNTYTLVID 4493

Query: 503  DALPEDH-GTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
                EDH G Y C A N  G+ + SA +TV                  K  AP+  + + 
Sbjct: 4494 KVNTEDHQGEYVCEALNDSGKTATSAKLTV-----------------VKRAAPVIKRKIE 4536

Query: 562  DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
             L+V  G     T ++   P     W   G EI ES+           SL I      D 
Sbjct: 4537 PLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDC 4596

Query: 622  GTYTCEAWNSAGEVRTQAVLTVQEP 646
            G YTC+A N  G V   A LTV  P
Sbjct: 4597 GEYTCKASNEYGSVSCTATLTVTVP 4621



 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 42/117 (35%), Positives = 63/117 (53%), Gaps = 4/117 (3%)

Query: 1668 SEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQ 1727
            S +  S A L   AE  P   P F + ++ + V +GS  R   ++ G P P V +++D  
Sbjct: 86   SGQATSTAELLVKAETAP---PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGA 142

Query: 1728 SIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
             I+ S  FQI  + D   SL+I++   +D   Y+  A NS+G AT TAEL+V+  EE
Sbjct: 143  EIQSSLDFQISQEGD-LYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198



 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 78/330 (23%), Positives = 117/330 (35%), Gaps = 66/330 (20%)

Query: 1035  LQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPE 1094
             ++ + V  G  +     +   P  T  WT +G  +KT +   +  +     ++I+  L  
Sbjct: 11212 IEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRR 11271

Query: 1095  DRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVK 1154
             D G Y+    N AG    +  +TV D P              P   +  +  T    T+ 
Sbjct: 11272 DTGEYQITVSNAAGSKTVAVHLTVLDVPGP------------PTGPINILDVTPEHMTIS 11319

Query: 1155  KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEH 1214
              +P    P      P I    E Q  R     + +G V+                     
Sbjct: 11320 WQP----PKDDGGSPVINYIVEKQDTRK----DTWGVVS--------------------- 11350

Query: 1215  MKVENSENGSKLTILAARQEHCGC---YTLLVENKLGSRQAQVNLTVVDK----PDPPAG 1267
                    +GS  T L       GC   + +  ENK+G      +   V K    P  P G
Sbjct: 11351 -------SGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLDSTPTVAKHKFSPPSPPG 11403

Query: 1268  TPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEI------WDSANKTWKELATCRSTSFN 1321
              P  +DI  ++ T+SW     DGGS +  Y +E       W   NKT           F 
Sbjct: 11404 KPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVRVNKT-----PIADLKFR 11458

Query: 1322  VQDLLPDHEYKFRVRAINVYGTSEPSQESE 1351
             V  L   + Y+FRV A N+ G S+PS  S+
Sbjct: 11459 VTGLYEGNTYEFRVFAENLAGLSKPSPSSD 11488



 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 76/322 (23%), Positives = 120/322 (37%), Gaps = 60/322 (18%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             V  G  + L   V   P  T+ W  +G  LK  + I ++ + +LC++ +     +D G Y
Sbjct: 13002 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 13061

Query: 1100  KCVAKNDAGQAECSCQVTVDDAPASE-NTKAPEMKSRRPKSSLPPVL---GTESDATVKK 1155
                A+N +G    + ++ V D P    + K  +M S R   S  P L   G+E    +  
Sbjct: 13062 TITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITNYIVD 13121

Query: 1156  KPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM 1215
             K     P  A                         +V+ T PIT   ++  K I+  E+ 
Sbjct: 13122 KRETSRPNWA-------------------------QVSATVPITSCSVE--KLIEGHEYQ 13154

Query: 1216  KVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP--DPPA--GTPCA 1271
                                    + +  ENK G          + K   DPP     P  
Sbjct: 13155 -----------------------FRICAENKYGVGDPVFTEPAIAKNPYDPPGRCDPPVI 13191

Query: 1272  SDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDH 1329
             S+I    +T+SW   + DGGS +  Y +E  ++    W ++        +     L    
Sbjct: 13192 SNITKDHMTVSWKPPADDGGSPITGYLLEKRETQAVNWTKVNRKPIIERTLKATGLQEGT 13251

Query: 1330  EYKFRVRAINVYGTSEPSQESE 1351
             EY+FRV AIN  G  +PS  S+
Sbjct: 13252 EYEFRVTAINKAGPGKPSDASK 13273



 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 82/367 (22%), Positives = 139/367 (37%), Gaps = 64/367 (17%)

Query: 1014  GTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVS--------SDPPATIIWTLN 1065
             G +D    S+ Q      ++ L D+     K L+++   S          P   ++W+  
Sbjct: 19859 GASDPSDSSDPQIAKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKP 19918

Query: 1066  GKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASE 1125
                L+T  ++  +   S  S++IE A   D G Y    +N    A  +  V V D P   
Sbjct: 19919 DTDLRTRAYVDTTD--SRTSLTIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPG-- 19974

Query: 1126  NTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGES 1185
                             PP   T  D T +          A +   +   PE+        
Sbjct: 19975 ----------------PPTNITVQDVTKES---------AVLSWDV---PEND------- 19999

Query: 1186  VELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLV-- 1243
                     G  P+    ++ R   + S+   V  + N ++L+      +    Y   V  
Sbjct: 20000 --------GGAPVKNYHIEKR---EASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSG 20048

Query: 1244  ENKLG---SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE 1300
             EN+ G     + +  + + +KP PP      S I   S++L+W    +DGGS +  Y +E
Sbjct: 20049 ENEFGVGIPAETKEGVKITEKPSPPEKLGVTS-ISKDSVSLTWLKPEHDGGSRIVHYVVE 20107

Query: 1301  IWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPE 1360
               +   K W + A  +ST   V  L  + EY FRV A N  G S+P +      + E+ E
Sbjct: 20108 ALEKGQKNWVKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLE 20167

Query: 1361  EPKDEVE 1367
              P+ +++
Sbjct: 20168 PPEIDMK 20174



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 79/316 (25%), Positives = 128/316 (40%), Gaps = 54/316 (17%)

Query: 1038 VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
            + +  GK L +   V+  P  T +WT     L   + +++   G+   + I+ AL +D G
Sbjct: 8809 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDR-VVIDNVGTKSELIIKDALRKDHG 8867

Query: 1098 LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKP 1157
             Y   A N  G    + +V V D P              P   L PV+ T     +    
Sbjct: 8868 RYVITATNSCGSKFAAARVEVFDVPG-------------PVLDLKPVV-TNRKMCLLNWS 8913

Query: 1158 APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKV 1217
             P+    + +   II+  +D K+            T  QPI            E+E  K 
Sbjct: 8914 DPEDDGGSEITGFIIE-RKDAKMH-----------TWRQPI------------ETERSKC 8949

Query: 1218 ENSENGSKLTILAARQEHCGCYTLLVENKLG-SRQAQVN-LTVVDKPDPPAGTP--CASD 1273
            +       +T L   QE+   + ++ +NK G     ++  +  VD   PP        ++
Sbjct: 8950 D-------ITGLLEGQEYK--FRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTE 9000

Query: 1274 IRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEY 1331
               S++TL W     +GGS +Q Y IE        ++ +    C +TSF V++L     Y
Sbjct: 9001 RTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMY 9060

Query: 1332 KFRVRAINVYGTSEPS 1347
            +FRV+A+N  G SEPS
Sbjct: 9061 EFRVKAVNEIGESEPS 9076



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 74/315 (23%), Positives = 115/315 (36%), Gaps = 53/315 (16%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G+   L+  VS  PP T+ W+ +GK L+ T  + +       ++  + +   D G Y   
Sbjct: 15171 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 15230

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
             A N  G A+    V V D P              P      V    S+  V     P   
Sbjct: 15231 ATNPGGFAKHIFNVKVLDRPG-------------PPEGPLAVTEVTSEKCVLSWFPPLDD 15277

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
               A +   I+Q  E  ++                     W     ++Q ++         
Sbjct: 15278 GGAKIDHYIVQKRETSRL--------------------AWTNVASEVQVTK--------- 15308

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV-----DKPDPPAGTPCASDIRSS 1277
               K+T L    E+   + ++  NK G  +   +  V+       PDPP   P  + I   
Sbjct: 15309 -LKVTKLLKGNEYI--FRVMAVNKYGVGEPLESEPVLAVNPYGPPDPPKN-PEVTTITKD 15364

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYKFRV 1335
             S+ + W     DGGS + +Y +E  D A + W +    T     + V  L   HEY+FR+
Sbjct: 15365 SMVVCWGHPDSDGGSEIINYIVERRDKAGQRWIKCNKKTLTDLRYKVSGLTEGHEYEFRI 15424

Query: 1336  RAINVYGTSEPSQES 1350
              A N  G S PS  S
Sbjct: 15425 MAENAAGISAPSPTS 15439



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 40/122 (32%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 1233  QEHCGCY-TLLVENKLG---SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSY 1288
             QE C  Y  +L EN+ G     +   ++   ++P PP G     D+  +S++LSW    +
Sbjct: 15711 QEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPP-GKITLMDVTRNSVSLSWEKPEH 15769

Query: 1289  DGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1348
             DGGS +  Y +E+    +  W   AT + T   +  L+   EY FRV A N  G S+P Q
Sbjct: 15770 DGGSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQ 15829

Query: 1349  ES 1350
              S
Sbjct: 15830 LS 15831



 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 41/116 (35%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATCRST 1318
             P PP+  P   D    S++L+W    YDGG+ +  Y +E+ +     W  +   AT R+T
Sbjct: 23037 PGPPSA-PRVVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNT 23095

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEK 1374
              F V DL    +Y FRV A+NV G SE S+        E+ E P  ++E++DD +K
Sbjct: 23096 EFTVPDLKMGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIP--DLELADDLKK 23149



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 84/382 (21%), Positives = 154/382 (40%), Gaps = 28/382 (7%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VV+ G   R      GRP P++TW +       + +V + +      L I   +++D G
Sbjct: 17729 IVVRAGGSARIHIPFKGRPTPEITWSREEGEF--TDKVQIEKGVNYTQLSIDNCDRNDAG 17786

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLE 289
              Y   + N SG  S SA ++++ LD+         K    +VRK+   ++ +   +D   
Sbjct: 17787 KYILKLENSSG--SKSAFVTVKVLDTPGPPQNLAVK----EVRKDSAFLVWEPPIIDG-- 17838

Query: 290   AAAKSKNCSSPQRGGSPPWAANSQPQPPRES-KLESCKDSPRTAPQTPVLQKTSSSI--- 345
               AK KN    +R  +    AN   +  + S K+E+  +      +     +    +   
Sbjct: 17839 -GAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVE 17897

Query: 346   TLQAARVQPEPRAPGLGVLSPSG--------EERKRPAPPRPATFPTRQPGLGSQ--DVV 395
             T+ A +    P  PG   L+           E+ +     R   +       G++   +V
Sbjct: 17898 TVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIV 17957

Query: 396   SKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCA 455
             +++      + G       +F  K  +++ K +  V         + + PS        +
Sbjct: 17958 AESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYS 18017

Query: 456   VIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCE--AGVAELHIQDALPEDHGTY 512
             +  G+D  ++  V G P P I+W+ +G+P+ Q  R   E  A    LHI++   +D G Y
Sbjct: 18018 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 18077

Query: 513   TCLAENALGQVSCSAWVTVHEK 534
             T  A N+ G  + +  V V EK
Sbjct: 18078 TVTATNSAGTATENLSVIVLEK 18099



 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 62/258 (24%), Positives = 96/258 (37%), Gaps = 37/258 (14%)

Query: 31    EAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGG-RFLLDCGIRGTF 89
             +AP F    RNL ++  + A    +V G+P+P V W+R G+ I + G ++ +     G  
Sbjct: 24621 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYH 24680

Query: 90    SLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAV 149
              L+I +V ++D   Y   ATN  G+   T  L VE      L                  
Sbjct: 24681 QLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHL------------------ 24722

Query: 150   ETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSV 209
                        PK    +G V    G++       +G+P P +TW KG   +  +    V
Sbjct: 24723 -----------PKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQV 24771

Query: 210   SEKNGMQVLEI-HGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATN 268
                     L   +GV + D G Y     N  G    + EL +  +    R          
Sbjct: 24772 IVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRG------VKV 24825

Query: 269   SDVRKEVTNVISKESKLD 286
             SDV ++  N+   E   D
Sbjct: 24826 SDVSRDSVNLTWTEPASD 24843



 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 71/342 (20%), Positives = 124/342 (36%), Gaps = 55/342 (16%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P+ K       +  G+ L ++  V   P   I W  +G+ LK T  + + +  +   + I
Sbjct: 18007 PSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHI 18066

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             ++   +D G Y   A N AG A  +  V V + P                   PPV    
Sbjct: 18067 KEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPG------------------PPVGPVR 18108

Query: 1149  SD-ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
              D  +         PP      QI  +  +++                   T TW     
Sbjct: 18109 FDEVSADFVVISWEPPAYTGGCQISNYIVEKR----------------DTTTTTWHMVSA 18152

Query: 1208  QIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV-----DKP 1262
              +  +  +K+   + G++             + +  EN+ G      +  V+      +P
Sbjct: 18153 TVARTT-IKITKLKTGTEYQ-----------FRIFAENRYGKSAPLDSKAVIVQYPFKEP 18200

Query: 1263  DPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSF 1320
              PP GTP  + I    + + W+    DGG+ +  Y +E  +  +  W +L     + T F
Sbjct: 18201 GPP-GTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKLNKTPIQDTKF 18259

Query: 1321  NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                 L    EY+F+V A N+ G  +PS+ SE     +  + P
Sbjct: 18260 KTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPP 18301



 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 67/307 (21%), Positives = 118/307 (38%), Gaps = 39/307 (12%)

Query: 9     SSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHR 68
             S+ + + SL  + S    +  T A   +  PR++ + EG +A+F     G P P VTW R
Sbjct: 26233 SAALEEKSLE-EKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLR 26291

Query: 69    NGQPITSGGRF-LLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGS- 126
              GQ +++  R  +     + TF   I +V   D G Y+    N  G ++    LT++ + 
Sbjct: 26292 KGQVLSTSARHQVTTTKYKSTFE--ISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKAR 26349

Query: 127   -FAKQLGQPVVSKTLGDRFSAP---------------------AVETRPS-------IWG 157
                K +  P   K+   R  +P                       ET+P+       +  
Sbjct: 26350 VTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPV 26409

Query: 158   ECPPKFATKLGRVVVKEGQMGRFSCKITGR--PQPQVTWLKGNVPLQPSARVSVS-EKNG 214
               PPK    L     KE  + + +C +        +VTW K    L+ +         +G
Sbjct: 26410 SAPPKITQFLKAEASKE--IAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADG 26467

Query: 215   MQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKE 274
                L+I+ + + D G Y C +    G +  + +   Q   S +    + ++   SD +  
Sbjct: 26468 TYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTT 26527

Query: 275   VTNVISK 281
              + V  K
Sbjct: 26528 ESTVTRK 26534



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 6/189 (3%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VR G+++ +  +V G      TW K  K +   + + +       +L I  A +   G Y
Sbjct: 11615 VRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKY 11674

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              +  +N  G  Q    + V+D+P P       +++   + T+SW     +GGS + ++ +
Sbjct: 11675 IISAKNSSGHAQGSAIVNVLDRPGPCQNLK-VTNVTKENCTISWENPLDNGGSEITNFIV 11733

Query: 1300  EIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG--- 1356
             E      K W  +A+  +      +LL ++EY FRV A N  G   P+ E++   +    
Sbjct: 11734 EYRKPNQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVG-PTIETKTPILAINP 11792

Query: 1357  -EKPEEPKD 1364
              ++P EP++
Sbjct: 11793 IDRPGEPEN 11801



 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 66/229 (28%), Positives = 97/229 (42%), Gaps = 25/229 (10%)

Query: 1146  GTESDATVKKKP--APKTPPKAAMPPQIIQFPEDQKVRAGESVELFG---KVTGTQPITC 1200
             G +S+  V + P   P  PP    PP I+    D       SV L     K TG  PIT 
Sbjct: 13856 GLKSEPIVARHPFDVPDAPP----PPNIVDVRHD-------SVSLTWTDPKKTGGSPITG 13904

Query: 1201  TWMKF--RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
               ++F  R  +      K        K+T L    E+   + ++  N  G  +  +    
Sbjct: 13905 YHLEFKERNSLLWKRANKTPIRMRDFKVTGLTEGLEYE--FRVMAINLAGVGKPSLPSEP 13962

Query: 1259  VDKPDP--PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--AT 1314
             V   DP  P G P   +I  +S+TL W    YDGG  +  Y +E  D  +K+W +     
Sbjct: 13963 VVALDPIDPPGKPEVINITRNSVTLIWTEPKYDGGHKLTGYIVEKRDLPSKSWMKANHVN 14022

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEP 1362
                 +F V DL+   +Y+FR+RA N  G  S PS+ +E     ++ E P
Sbjct: 14023 VPECAFTVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAP 14071



 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 39/118 (33%), Positives = 58/118 (49%), Gaps = 5/118 (4%)

Query: 1233  QEHCGCY-TLLVENKLG---SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSY 1288
             QE C  Y  +  EN+ G     Q    + V + P PP G     D+  +S++LSW    +
Sbjct: 16793 QEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQPP-GKITVDDVTRNSVSLSWTKPEH 16851

Query: 1289  DGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             DGGS +  Y +E+    ++ W E A  +S    + +L    EY FRV A+N  G S+P
Sbjct: 16852 DGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDP 16909



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 95/427 (22%), Positives = 150/427 (35%), Gaps = 53/427 (12%)

Query: 1019 EKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILS 1078
            E   ES G AP     LQDV V  G      C +  D    + WT  G  ++ ++ +  S
Sbjct: 3479 ECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQS 3538

Query: 1079 QEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPAS------ENTKAPEM 1132
            Q G++  ++I      D+GLY C+  ND G+   S  ++V+ AP S      E     EM
Sbjct: 3539 QNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPESILHERIEQEIEMEM 3598

Query: 1133 K----------------SRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPE 1176
            K                +    S +   L   S++ V   P      K    P  I+   
Sbjct: 3599 KEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPV--YPTKFDSEKEGTGPIFIKEVS 3656

Query: 1177 DQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHC 1236
            +  +  G+   L   V G       W      +  S   K     +   L IL  + E  
Sbjct: 3657 NADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDE 3716

Query: 1237 GCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSY-------- 1288
            G YT +  N  G       L +  K +    T   S +  S   L      +        
Sbjct: 3717 GEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPI 3776

Query: 1289 ---DGGSAVQSYSIEIWDSANKTW----KELATC----------RSTSFNVQDLLPDHEY 1331
                G  A+  Y++    +   TW    K+L T            S +F V D   +   
Sbjct: 3777 RCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSG 3836

Query: 1332 KFRVRAINVYGTSEPSQE----SELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINT 1387
             +  +A N+ G S  + E     E T + + P + K   E  +D  + P        +++
Sbjct: 3837 LYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPEAPEDFPQTPLKGPAVEALDS 3896

Query: 1388 EQKVSDF 1394
            EQ+++ F
Sbjct: 3897 EQEIATF 3903



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 57/224 (25%), Positives = 89/224 (39%), Gaps = 19/224 (8%)

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFG-KVTG-----TQPITCTW 1202
             S+ TV + P  K P     P   +   +  +V+  E +   G +V G      +  +  W
Sbjct: 16024 SEPTVAQYPF-KVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILW 16082

Query: 1203  MKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKP 1262
             +K  K        K    E G +     + +   G         +G         V   P
Sbjct: 16083 VKLNKTPIPQTKFKTTGLEEGVEYEFRVSAENIVG---------IGKPSKVSECYVARDP 16133

Query: 1263  DPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCR--STSF 1320
               P G P A  +  +S+TL W   +YDGGS +  Y +E  +     W + +      T F
Sbjct: 16134 CDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNIIDTHF 16193

Query: 1321  NVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEPK 1363
              V  L+ DH Y+FRV A N  G  SEPS+ +   T  ++ + P+
Sbjct: 16194 EVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPR 16237



 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 78/337 (23%), Positives = 129/337 (38%), Gaps = 55/337 (16%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G  + L+  +S  P  TI W  + K L+T   + +     L S+ I+ A   + G Y+  
Sbjct: 20582 GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELK 20641

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
              +N  G A  + +V + D P              P   +     T    T+  +P P   
Sbjct: 20642 LRNAMGSASATIRVQILDKPGP------------PGGPIEFKTVTAEKITLLWRP-PADD 20688

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
               A +   I++  E  +V                     W         SEH++    E 
Sbjct: 20689 GGAKITHYIVEKRETSRV--------------------VWSMV------SEHLE----EC 20718

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGTPCASDIRSS 1277
                 T +    E+   + +   NK G  +   + +VV K     P PP G P  + I  +
Sbjct: 20719 IITTTKIIKGNEYI--FRVRAVNKYGIGEPLESDSVVAKNAFVTPGPP-GIPEVTKITKN 20775

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA--TCRSTSFNVQDLLPDHEYKFRV 1335
             S+T+ W     DGGS +  Y +E  D  +  W ++   T R T   V  L  + +Y++RV
Sbjct: 20776 SMTVVWSRPIADGGSDISGYFLEKRDKKSLGWFKVLKETIRDTRQKVTGLTENSDYQYRV 20835

Query: 1336  RAINVYGTSEPSQESELTTVGE--KPEEPKDEVEVSD 1370
              A+N  G    S+ SE     +   P  P  ++ ++D
Sbjct: 20836 CAVNAAGQGPFSEPSEFYKAADPIDPPGPPAKIRIAD 20872



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 33/95 (34%), Positives = 48/95 (50%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
            P   + I+   V +GS A F  ++ G PDPE  W+K+   I  S      + ED  C L+
Sbjct: 2032 PKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELV 2091

Query: 1749 ISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
            I DV  +D A    KA+N  GE +  A L+V+  +
Sbjct: 2092 IRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQ 2126



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 71/301 (23%), Positives = 112/301 (37%), Gaps = 35/301 (11%)

Query: 3    DVKLVASSHISKTSLSVDPSRVDSMPLT-EAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            D +L  ++ +S+ + S + S+  +   T EAP   L  +++ +K G TA+F   ++    
Sbjct: 3458 DTQLCHTASLSQIAESTELSKECAKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSF 3517

Query: 62   PQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
              VTW   G  I    R          F L I  V   D+G Y+C   N  G R  +  L
Sbjct: 3518 IDVTWTHEGAKIEESERLKQSQNGNIQF-LTICNVQLVDQGLYSCIVHNDCGERTTSAVL 3576

Query: 122  TVEGS--------------------------------FAKQLGQPVVSKTLGDRFSAPAV 149
            +VEG+                                 + +L    +++TL     +P  
Sbjct: 3577 SVEGAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVY 3636

Query: 150  ETRPSIWGE-CPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVS 208
             T+     E   P F  ++    +  G +   S  + G P+P++ W    V L PSA   
Sbjct: 3637 PTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYK 3696

Query: 209  VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATN 268
                     L I     +D G YTC+  N  GK   SA L I      ++    E+    
Sbjct: 3697 FVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAK 3756

Query: 269  S 269
            S
Sbjct: 3757 S 3757



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/118 (29%), Positives = 57/118 (48%), Gaps = 10/118 (8%)

Query: 1262 PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE-------LAT 1314
            P  P   P   D   SS++L W   + DGGS ++ Y +E+ +     WK        + T
Sbjct: 9399 PPGPPSCPEVKDKTKSSISLGWKPPAKDGGSPIKGYIVEMQEEGTTDWKRVNEPDKLITT 9458

Query: 1315 CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
            C     N+++L    +Y+FRV+A+N  G SEPS  +      +  EEP+  +++   D
Sbjct: 9459 CECVVPNLKEL---RKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQD 9513



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL----AT 1314
             + KP PP   P A D   +S+ L+W    +DGGS +  Y +E     ++ W+       +
Sbjct: 10805 IAKPSPPVN-PEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEWRRANHTPES 10863

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPK 1363
             C  T + V  L     YKFRV A+N  G S+P+   E   V ++ E P+
Sbjct: 10864 CPETKYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPE 10912



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 110/471 (23%), Positives = 168/471 (35%), Gaps = 95/471 (20%)

Query: 937   KAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPM--GNAKPDENLKSAS 994
             K V +S PLS   P   L+     K + TL           L P+  G AK D  + S  
Sbjct: 12483 KPVLASDPLSEPDPPRKLEVTEMTKNSATLA---------WLPPLRDGGAKIDGYITSYR 12533

Query: 995   KEELKKDVKNDVNCKRGHA----GTTDNEKRS---------------ESQGTAPAFKQKL 1035
             +EE   D   + +  +  +    G  + +K                 E++G   A +Q L
Sbjct: 12534 EEEQPADRWTEYSVVKDLSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLL 12593

Query: 1036  -------QDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
                    + + +  GKKL ++  V   P  T  W      + T+  + + +  S   + I
Sbjct: 12594 PPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILII 12653

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPP--VLG 1146
             +    +D G Y   A+N +G      +V V DAP                   PP  +  
Sbjct: 12654 KDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQ---------------PPFDISD 12698

Query: 1147  TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFR 1206
              ++DA       P     + +   I+   E   V  G+ V     VT T        +  
Sbjct: 12699 IDADACSLSWHIPLEDGGSNITNYIV---EKCDVSRGDWVTALASVTKTS------CRVG 12749

Query: 1207  KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPA 1266
             K I   E++    +EN              G    L   K+    AQ    V  +P    
Sbjct: 12750 KLIPGQEYIFRVRAEN------------RFGISEPLTSPKM---VAQFPFGVPSEPKNAR 12794

Query: 1267  GTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCRSTS 1319
              T    D     + ++W     DGGS +  Y IE       +W  AN T       RST 
Sbjct: 12795 VTKVNKDC----IFVAWDRPDSDGGSPIIGYLIERKERNSLLWVKANDT-----LVRSTE 12845

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSD 1370
             +    L+   EY FR+ A+N  G+S PS+ +E  T    P +P  + EV D
Sbjct: 12846 YPCAGLVEGLEYSFRIYALNKAGSSPPSKPTEYVT-ARMPVDPPGKPEVID 12895



 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 52/210 (24%), Positives = 91/210 (43%), Gaps = 11/210 (5%)

Query: 45    KEGATAKFEGRVRGYPEP-QVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             +EG   K+  ++  Y +  QVTW+   + + +  ++ +     G   L +  + + D G 
Sbjct: 25275 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYE-DGVAILYVKDITKLDDGT 25333

Query: 104   YTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKF 163
             Y C+  N  G      EL V+G   +++      +T+  +      +T   +  E PP+F
Sbjct: 25334 YRCKVVNDYGEDSSYAELFVKG--VREVYDYYCRRTM--KKIKRRTDTMRLL--ERPPEF 25387

Query: 164   ATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQP---SARVSVSEKNGMQVLEI 220
                L       G+  RF   IT  P+P VTW K    ++P     + +     G+  L I
Sbjct: 25388 TLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTI 25447

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
             + V  DD   YT +  N  G+ S  A+L++
Sbjct: 25448 NSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 58/249 (23%), Positives = 97/249 (38%), Gaps = 12/249 (4%)

Query: 1017 DNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVS--SDPPATIIWTLNGKTLKTTKF 1074
            D EK+ +     P FK+KL  + +        +C+++   DP   + W  +GK L+    
Sbjct: 1650 DKEKQQK-----PFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANR 1704

Query: 1075 IILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKS 1134
            + +  E   CS+    A   D G+  C A N  G    S  + V D    E +   E + 
Sbjct: 1705 LRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKD----EKSLVEESQL 1760

Query: 1135 RRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTG 1194
               +  L  +   E  A         T  K    P I+ +PE  +V  GE+     +VTG
Sbjct: 1761 PEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTG 1820

Query: 1195 TQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQV 1254
                   W    + I++S+  +V   +    L I+  +    G   +  EN  G  + +V
Sbjct: 1821 YPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKV 1879

Query: 1255 NLTVVDKPD 1263
             L +  + D
Sbjct: 1880 KLEIQQRED 1888



 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 40/111 (36%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 1261  KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---CRS 1317
             KP PP   P   DI  SS+ LSW    YDGG  +Q Y +E  D +   W           
Sbjct: 16532 KPGPP-NNPKVIDITRSSVFLSWSKPIYDGGCEIQGYIVEKCDVSVGEWTMCTPPTGINK 16590

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEV 1368
             T+  V+ LL  HEY FR+ AIN  G  E +       V EK E P  ++++
Sbjct: 16591 TNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDL 16641



 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 61/234 (26%), Positives = 93/234 (39%), Gaps = 27/234 (11%)

Query: 444   APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGVAELH 500
             AP     +KD     G+   L C + G P+P I W   G+ +  +R    + +     L 
Sbjct: 24227 APGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLT 24286

Query: 501   IQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPS-KPTAPIFLQG 559
             +     ED G YTC+A N +G+V  S             S+ LL   P   P  P+  + 
Sbjct: 24287 VMTEEQEDEGVYTCIATNEVGEVETS-------------SKLLLQATPQFHPGYPLKEKY 24333

Query: 560   LSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPE 619
                +    GS + + V   G P P + W H    +Q SE+   E       L ++ V  +
Sbjct: 24334 YGAV----GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRK 24389

Query: 620   -DTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLIS 672
                G Y  +  N  G V   A+L V+      +P   + P  + A L  S +IS
Sbjct: 24390 THAGKYKVQLSNVFGTV--DAILDVEIQDKPDKP---TGPIVIEALLKNSAVIS 24438



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 14/152 (9%)

Query: 160  PPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
            PP   + L  V V EG+     C I+G P P VTW + +  ++ S    ++ ++G+  L 
Sbjct: 896  PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM 955

Query: 220  IHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVI 279
            I     +D G +TC  VN +G  S S  L++Q     +  F +ET A        VT   
Sbjct: 956  IREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ----VSEEFEKETTA--------VTEKF 1003

Query: 280  SKESK--LDSLEAAAKSKNCSSPQRGGSPPWA 309
            + E K  ++S +      + +  Q G   P A
Sbjct: 1004 TTEEKRFVESRDVVMTDTSLTEEQAGPGEPAA 1035



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 12/168 (7%)

Query: 1206  RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG-----SRQAQVNLTVVD 1260
             +++      + V +       TI    + H   + ++ +NK G       + +    +  
Sbjct: 9951  KREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQNKYGIGEPLDSEPETARNLFS 10010

Query: 1261  KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL------AT 1314
              P  P   P  S +  +S+T++W    YDGGS V  Y +E+ D+ +K WK +      A 
Sbjct: 10011 VPGAP-DKPTVSSVTRNSMTVNWEEPEYDGGSPVTGYWLEMKDTTSKRWKRVNRDPIKAM 10069

Query: 1315  CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                 S+ V  L+   +Y+FRV AIN  G    S  S+  T  +    P
Sbjct: 10070 TLGVSYKVTGLIEGSDYQFRVYAINAAGVGPASLPSDPATARDPIAPP 10117



 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 77/340 (22%), Positives = 133/340 (39%), Gaps = 57/340 (16%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             + V  G+ + +  +V   P   I WT  GK L   K + L Q+     + I++A+  D G
Sbjct: 11613 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 11672

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKP 1157
              Y   AKN +G A+ S  V V D P              P  +L     T+ + T+    
Sbjct: 11673 KYIISAKNSSGHAQGSAIVNVLDRPG-------------PCQNLKVTNVTKENCTIS--- 11716

Query: 1158  APKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKV 1217
                            + P D                G   IT   +++RK  Q+   +  
Sbjct: 11717 --------------WENPLD---------------NGGSEITNFIVEYRKPNQKGWSIVA 11747

Query: 1218  ENSENGSKLTILAARQEHCGCYTLLVENKLG------SRQAQVNLTVVDKPDPPAGTPCA 1271
              +         L A  E+   + +  ENK+G      ++   + +  +D+P  P     A
Sbjct: 11748 SDVTKRLIKANLLANNEY--YFRVCAENKVGVGPTIETKTPILAINPIDRPGEPENLHIA 11805

Query: 1272  SDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDH 1329
              D   + + L W    YDGGS   SY +E     +  W+ +   + + T + V   + + 
Sbjct: 11806 -DKGKTFVYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHYMVDRCVENQ 11864

Query: 1330  EYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
              Y+FRV+  N  G S+  +  E+  V E  ++P  ++++S
Sbjct: 11865 IYEFRVQTKNEGGESDWVKTEEV-VVKEDLQKPVLDLKLS 11903



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 48/182 (26%), Positives = 83/182 (45%), Gaps = 25/182 (13%)

Query: 1015 TTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKF 1074
            T+  E   +++   P F Q+LQ + V +G ++ LQ +V+  P   + +  +G  ++++  
Sbjct: 90   TSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLD 149

Query: 1075 IILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV---DDAPASE------ 1125
              +SQEG L S+ I +A PED G Y   A N  G+A  + ++ V   ++ PA +      
Sbjct: 150  FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVS 209

Query: 1126 NTKAPEMKSRRPKSSLPPVLGTESDATVK------------KKPAPKTPPK----AAMPP 1169
              +  E +  R +  +       S ATV+             K  P+ PPK    +  PP
Sbjct: 210  TAQISESRQTRIEKKIEAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPP 269

Query: 1170 QI 1171
             I
Sbjct: 270  SI 271



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 35/96 (36%), Positives = 46/96 (47%)

Query: 1688 KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSL 1747
            KP F       + +EG  ARFD K+ G P PE  WF D Q I      ++   EDG  SL
Sbjct: 1410 KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSL 1469

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
            II      D  ++T  A N  G ++ +  L VE +E
Sbjct: 1470 IIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVE 1505



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 44/140 (31%), Positives = 62/140 (44%), Gaps = 7/140 (5%)

Query: 1239  YTLLVENKLGSRQAQVN---LTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQ 1295
             + ++ EN  G  +       +  +D  DPP G P   +I   ++TL W    Y GG  + 
Sbjct: 15026 FRVIAENMAGKSKPSKPSEPMLALDPIDPP-GKPVPLNITRHTVTLKWAKPEYTGGFKIT 15084

Query: 1296  SYSIEIWDSANKTW--KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQESEL 1352
             SY +E  D  N  W     +      F V  L  D  Y+FRV A N  G  S PS+ S+ 
Sbjct: 15085 SYIVEKRDLPNGRWLKANFSNILENEFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDA 15144

Query: 1353  TTVGEKPEEPKDEVEVSDDD 1372
              T  +  E PK +V+V   D
Sbjct: 15145 ITCRDDVEAPKIKVDVKFKD 15164



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 91/388 (23%), Positives = 134/388 (34%), Gaps = 60/388 (15%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             PAFK       V  G+ L +       P   + W  +   LK T  +      +   ++I
Sbjct: 15843 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTI 15902

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             + A  ED G Y     N AG+A  +  V V D P                   PP    +
Sbjct: 15903 KDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPG------------------PPTGPVK 15944

Query: 1149  SD-ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRK 1207
              D  T         PP               K   G S+  +  V      T TW     
Sbjct: 15945 MDEVTADSITLSWGPP---------------KYDGGSSINNY-IVEKRDTSTTTWQIV-- 15986

Query: 1208  QIQESEHMKVENSENGSKLTILAARQEHCGC---YTLLVENKLG-SRQAQVNLTVVDKP- 1262
                         S   ++ TI A R +  GC   + +  EN+ G S       TV   P 
Sbjct: 15987 ------------SATVARTTIKACRLK-TGCEYQFRIAAENRYGKSTYLNSEPTVAQYPF 16033

Query: 1263  --DPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRST 1318
                 P GTP  +     S+ + W     DGGS V  Y +E  +  +  W +L       T
Sbjct: 16034 KVPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQT 16093

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEV 1378
              F    L    EY+FRV A N+ G  +PS+ SE   V   P +P    E          +
Sbjct: 16094 KFKTTGLEEGVEYEFRVSAENIVGIGKPSKVSE-CYVARDPCDPPGRPEAIIVTRNSVTL 16152

Query: 1379  DYRTVTINTEQKVSDFYDIEERLGSGKF 1406
              ++  T +   K++ +   ++ L  G++
Sbjct: 16153 QWKKPTYDGGSKITGYIVEKKELPEGRW 16180



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 82/331 (24%), Positives = 122/331 (36%), Gaps = 60/331 (18%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSI 1088
             P +K  +  VH  E  K+     +   P  TI W    + L  T  + +       S+S+
Sbjct: 16242 PKYKDTIV-VHAGESFKV--DADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSV 16298

Query: 1089  EKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTE 1148
             + A+  D G Y   AKN AG+   +  V V D P       PE          P V+   
Sbjct: 16299 KDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGP-----PEG---------PVVI--- 16341

Query: 1149  SDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVT--GTQPITCTWMKFR 1206
             S  T +K      PP       II +  +++    E+  L   V     Q ++C      
Sbjct: 16342 SGVTAEKCTLAWKPPLQDGGSDIINYIVERR----ETSRLVWTVVDANVQTLSC------ 16391

Query: 1207  KQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK----- 1261
                      KV     G++ T           + ++  NK G  +   +  VV K     
Sbjct: 16392 ---------KVTKLLEGNEYT-----------FRIMAVNKYGVGEPLESEPVVAKNPFVV 16431

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTS 1319
             PD P   P  + +   S+ + W   + DGGS +  Y +E  D     W            
Sbjct: 16432 PDAPKA-PEVTTVTKDSMIVVWERPASDGGSEILGYVLEKRDKEGIRWTRCHKRLIGELR 16490

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
               V  L+ +H+Y+FRV A N  G SEPS  S
Sbjct: 16491 LRVTGLIENHDYEFRVSAENAAGLSEPSPPS 16521



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 45/169 (26%), Positives = 67/169 (39%), Gaps = 12/169 (7%)

Query: 1202  WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
             W+K  K   +    K    + G +     + +   G         +G         V   
Sbjct: 18246 WVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVG---------IGKPSKVSECFVARD 18296

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCRSTS 1319
             P  P G P A  I  +++TL W   +YDGGS +  Y +E  D  +  W +        T 
Sbjct: 18297 PCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETE 18356

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGT-SEPSQESELTTVGEKPEEPKDEVE 1367
             F V  L+ D  Y+FRV A N  G  SEPS  S   T  ++ + P   ++
Sbjct: 18357 FTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLD 18405



 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 43/134 (32%), Positives = 63/134 (47%), Gaps = 9/134 (6%)

Query: 1252  AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE 1311
             AQ+  TV D P    G P  S+I  +S+TL+W     DGGS +Q Y +E  +  +  W +
Sbjct: 21840 AQIQYTVPDAP----GIPEPSNITGNSITLTWARPESDGGSEIQQYILERREKKSTRWVK 21895

Query: 1312  LATCR---STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGE--KPEEPKDEV 1366
             + + R    T F V  L   +EY+F V A N  G    S  S L    E   P  P   V
Sbjct: 21896 VISKRPISETRFKVTGLTEGNEYEFHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVV 21955

Query: 1367  EVSDDDEKEPEVDY 1380
             +V+D  +    +++
Sbjct: 21956 KVTDTSKTTVSLEW 21969



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC------ 1315
             P  P   P  +D   SS++L+W    YDGG+ V+ Y +E+ ++A   W    TC      
Sbjct: 18697 PPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEW---TTCTPPTGL 18753

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVE 1367
             +   F V  L  + EY FR+ AIN  G  EP+         E+ E P+ E++
Sbjct: 18754 QGKQFTVTKLKENTEYNFRICAINSEGVGEPATLPGSVVAQERIEPPEIELD 18805



 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 72/342 (21%), Positives = 133/342 (38%), Gaps = 65/342 (19%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             +HV  G+ + L   ++  PP    W   G  L+ ++ + +     +  ++I +    D G
Sbjct: 23443 IHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTG 23502

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDAT---VK 1154
              Y    KN  G    + +V + D P                    P+   E DAT   + 
Sbjct: 23503 EYTLELKNVTGTTSETIKVIILDKPGPPTG---------------PIKIDEIDATSITIS 23547

Query: 1155  KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEH 1214
              +P P+    A +   +++  +  +          G +  ++ +T +  KF +  + +E+
Sbjct: 23548 WEP-PELDGGAPLSGYVVEQRDAHRP---------GWLPVSESVTRSTFKFTRLTEGNEY 23597

Query: 1215  MKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDI 1274
             +            + A  +   G Y   +++++   ++ + +     P PP  T    D+
Sbjct: 23598 V----------FRVAATNRFGIGSY---LQSEVIECRSSIRI-----PGPPE-TLQIFDV 23638

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIE-------IWDSANKTWKELATCRSTSFNVQDLLP 1327
                 +TL+WY    DGGS V  Y +E        W   NK    +   RST      L  
Sbjct: 23639 SRDGMTLTWYPPEDDGGSQVTGYIVERKEVRADRWVRVNKVPVTMTRYRSTG-----LTE 23693

Query: 1328  DHEYKFRVRAINVYGTSEPSQESELTTVGE------KPEEPK 1363
               EY+ RV AIN  G+ +PS+ S+     +      KP+ P+
Sbjct: 23694 GLEYEHRVTAINARGSGKPSRPSKPIVAMDPIAPPGKPQNPR 23735



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 34/89 (38%), Positives = 48/89 (53%), Gaps = 4/89 (4%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATCRST 1318
             P PPA  P   D   SS++LSW   +YDGGS +  Y +E+  + +  W         + T
Sbjct: 13284 PGPPA-FPKVYDTTRSSVSLSWGKPAYDGGSPIIGYLVEVKRADSDNWVRCNLPQNLQKT 13342

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
              F V  L+ D +Y+FRV A+N  G S+PS
Sbjct: 13343 RFEVTGLMEDTQYQFRVYAVNKIGYSDPS 13371



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 1/107 (0%)

Query: 1256  LTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC 1315
             +   ++P PP       D   SS  L+W    +DGGS +  Y +E+    +  W E    
Sbjct: 22235 IVATEQPAPPRRLDVV-DTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFWVEAGHT 22293

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
             +  +F V+ L+   EY+FRV+A N  G SEP +      + E   EP
Sbjct: 22294 KQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEP 22340



 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 28    PLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRG 87
             P++  P  +   ++  +   + AKF  +  G P P   W ++G+ IT GG++ L    +G
Sbjct: 26542 PISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLS-EDKG 26600

Query: 88    TFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVE 124
              F L IH     D G YTC   N +G+   + +LT++
Sbjct: 26601 GFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIK 26637



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 4/92 (4%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATC 1315
             V KP PP G P   D   SS++++W    YDGGS +  Y +EI       W+ +   A  
Sbjct: 15448 VFKPGPP-GNPRVLDTSRSSISIAWNKPIYDGGSEITGYMVEIALPEEDEWQIVTPPAGL 15506

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             ++TS+ +  L  + EYK R+ A+N  G  EP+
Sbjct: 15507 KATSYTITGLTENQEYKIRIYAMNSEGLGEPA 15538



 Score = 60.1 bits (144), Expect = 2e-08
 Identities = 48/176 (27%), Positives = 72/176 (40%), Gaps = 16/176 (9%)

Query: 1202  WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
             W K  K +     MKV   + G               Y +  EN  G  +   +   V  
Sbjct: 19328 WSKANKILIADTQMKVSGLDEGLMYE-----------YRVYAENIAGIGKCSKSCEPVPA 19376

Query: 1262  PDP--PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCRS 1317
              DP  P G P  ++I   S++L W    YDGG+ +  Y +E  +  +  W +      + 
Sbjct: 19377 RDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQE 19436

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVY-GTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
             T F V +L  D  Y+FRV A N     SEPS+ +    V +  E P+  ++V   D
Sbjct: 19437 TYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRD 19492



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 74/318 (23%), Positives = 124/318 (38%), Gaps = 51/318 (16%)

Query: 430  TVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYAR 489
            T K   EG  V      F   L+D  V E     L+C V    +    W  N   ++   
Sbjct: 2211 TAKLIVEGAVV-----EFVKELQDIEVPESYSGELECIVSPENIEG-KWYHNDVELKSNG 2264

Query: 490  S---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPV 546
                T   G   L ++D   ED G Y+ + +                KK++ K +     
Sbjct: 2265 KYTITSRRGRQNLTVKDVTKEDQGEYSFVIDG---------------KKTTCKLKM---- 2305

Query: 547  APSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRG 606
               KP     LQGLSD KV +G  V + V+VS     E +W+ +G E+Q S+  H     
Sbjct: 2306 ---KPRPIAILQGLSDQKVCEGDIVQLEVKVSLESV-EGVWMKDGQEVQPSDRVHIVIDK 2361

Query: 607  TQHSLCIQEVFPEDTGTYT----CEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVT 662
              H L I+++  ED G Y+        +++G V   +V              I+  + V 
Sbjct: 2362 QSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV------------ITPLKDVN 2409

Query: 663  ASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQ 722
               G   ++ C ++     +V W  + + + K     + +       LV+ +      G 
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQI-KPDDRVQAIVKGTKQRLVINRTHASDEGP 2468

Query: 723  YEILLKNRVGECSCQVSL 740
            Y++++  RV E +C +S+
Sbjct: 2469 YKLIV-GRV-ETNCNLSV 2484



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 1/110 (0%)

Query: 1683 EKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
            EK    P F K + + ++  G  A     + G P P++ WF +   +  S  ++  +D D
Sbjct: 3643 EKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGD 3702

Query: 1743 GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEE 1792
             + SLII     +D+ +YTC A N  G+  C+A L + +  EG  + E E
Sbjct: 3703 DH-SLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEGHKDTETE 3751



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 3/114 (2%)

Query: 1682 EEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDE 1741
            +E P   P     ++D    EG  ARF C++ G  D +V W+  D+ I+ SR F++   E
Sbjct: 3292 QEMPVYPPAIITPLQDTVTSEGQPARFQCRVSG-TDLKVSWYSKDKKIKPSRFFRMTQFE 3350

Query: 1742 DGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME-EGEGEGEEEEE 1794
            D    L I++   +D+  YT  A N++G+ + TA L +E    + +  G++  E
Sbjct: 3351 D-TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDVRE 3403



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 71/338 (21%), Positives = 128/338 (37%), Gaps = 62/338 (18%)

Query: 1062 WTLNGKTLKTTKFIILS-QEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDD 1120
            W     T+K TK  +    EGSL              +++  A+N  GQ++ +    ++D
Sbjct: 7825 WQTVDTTVKDTKCTVTPLTEGSLY-------------VFRVAAENAIGQSDYT---EIED 7868

Query: 1121 APASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKV 1180
            +  +++T           +  PP      D T +       PPK      I ++  ++K 
Sbjct: 7869 SVLAKDTFT---------TPGPPYALAVVDVTKRHVDLKWEPPKNDGGRPIQRYVIEKKE 7919

Query: 1181 RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYT 1240
            R G                  W+K  K      + +V +   G+++      +   G   
Sbjct: 7920 RLGTR----------------WVKAGKTAGPDCNFRVTDVIEGTEVQFQVRAENEAG--- 7960

Query: 1241 LLVENKLGSRQAQVNLTVVDKPDPPAGTPC---ASDIRSSSLTLSWYGSSYDGGSAVQSY 1297
                  +G       +  ++ P  P   P     +D     + ++W     +GGS +  Y
Sbjct: 7961 ------VGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAIAWKPPEKNGGSPIIGY 8014

Query: 1298 SIEIWDSANKTWKELAT--CRSTSFNVQD-LLPDHEYKFRVRAINVYGTSEPSQESELTT 1354
             +E+     + W  + +   +   F V++ ++PD EY  RVRA+N  G SEPS+ SE   
Sbjct: 8015 HVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVV 8074

Query: 1355 VGEKPEEPKDEVEVSDDDEKEPE-----VDYRTVTINT 1387
              +   +P  ++E  D    E E     V +R V + T
Sbjct: 8075 AKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPT 8112



 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 75/315 (23%), Positives = 112/315 (35%), Gaps = 53/315 (16%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             V  G+   L+  V   P  TI W    K ++ +    +        + ++ A+  D G Y
Sbjct: 17332 VNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQY 17391

Query: 1100  KCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAP 1159
                A N AG       V V D P              P      V G  S+    K    
Sbjct: 17392 ILRASNVAGSKSFPVNVKVLDRPG-------------PPEGPVQVTGVTSE----KCSLT 17434

Query: 1160  KTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVEN 1219
              +PP       I  +  +++    E+  L   V  ++ +T                    
Sbjct: 17435 WSPPLQDGGSDISHYVVEKR----ETSRLAWTVVASEVVT-------------------- 17470

Query: 1220  SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGTPCASDI 1274
               N  K+T L    E+   + ++  NK G  +   +  V+ K     P PP      ++I
Sbjct: 17471 --NSLKVTKLLEGNEYV--FRIMAVNKYGVGEPLESAPVLMKNPFVLPGPPKSLE-VTNI 17525

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFN--VQDLLPDHEYK 1332
                S+T+ W     DGGS +  Y +E  D +   W +    R T     V  L  DHEY+
Sbjct: 17526 AKDSMTVCWNRPDSDGGSEIIGYIVEKRDRSGIRWIKCNKRRITDLRLRVTGLTEDHEYE 17585

Query: 1333  FRVRAINVYGTSEPS 1347
             FRV A N  G  EPS
Sbjct: 17586 FRVSAENAAGVGEPS 17600



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 63/295 (21%), Positives = 120/295 (40%), Gaps = 37/295 (12%)

Query: 438  LAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARST---CEA 494
            L V+E  P F+  L+D   +E  + +LQC +     P + W  +G+ I+ +++     + 
Sbjct: 5706 LTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADG 5764

Query: 495  GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAP 554
                L ++ AL  D G YTC      G    S  + + +++                   
Sbjct: 5765 KKRMLILKKALKSDIGQYTC----DCGTDKTSGKLDIEDREIK----------------- 5803

Query: 555  IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQ 614
              ++ L  ++VM+        ++S +      W   G  + ++ D   ++ G  HSL + 
Sbjct: 5804 -LVRPLHSVEVMETETARFETEISEDDI-HANWKLKGEALLQTPDCEIKEEGKIHSLVLH 5861

Query: 615  EVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCA 674
                + TG    +A N    V++ A L V+    G     +   + VT + G++    C 
Sbjct: 5862 NCRLDQTGGVDFQAAN----VKSSAHLRVKPRVIG----LLRPLKDVTVTAGETATFDCE 5913

Query: 675  IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKN 729
            ++ +  P V W   GK L + +          V TL L+ V+   AG+ ++  K+
Sbjct: 5914 LSYEDIP-VEWYLKGKKL-EPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 5966



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 72/338 (21%), Positives = 118/338 (34%), Gaps = 53/338 (15%)

Query: 1021  RSESQGTAPAFKQKLQDVHVAE-GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFII-LS 1078
             R E      +   K +DV V   G+  +L+  +   P   ++W+ +GK L+ T   + + 
Sbjct: 18394 RDEIDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIK 18453

Query: 1079  QEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPK 1138
                   ++ ++  +  D G Y     N  G       V V D P              P 
Sbjct: 18454 STIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKVLDRPG-------------PP 18500

Query: 1139  SSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPI 1198
                  V G  ++        P     A +   II+  E  ++                  
Sbjct: 18501 EGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRL------------------ 18542

Query: 1199  TCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
               +W +   ++Q   +          K+T L    E+   + ++  NK G  +   +  V
Sbjct: 18543 --SWTQVSTEVQALNY----------KVTKLLPGNEYI--FRVMAVNKYGIGEPLESGPV 18588

Query: 1259  VD----KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-- 1312
                   KP  P  TP  S I   S+ ++W     DGG+ ++ Y +E  D     W +   
Sbjct: 18589 TACNPYKPPGPPSTPEVSAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNK 18648

Query: 1313  ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
              T       V  L   H Y+FRV A N  G  EPS+ S
Sbjct: 18649 KTLTDLRLRVTGLTEGHSYEFRVAAENAAGVGEPSEPS 18686



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 56/243 (23%), Positives = 88/243 (36%), Gaps = 34/243 (13%)

Query: 31    EAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS 90
             EAP      +++  K G  A+   ++ G P P + W+R G+ +    ++ +    R T +
Sbjct: 24226 EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGR-THT 24284

Query: 91    LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVE 150
             L +    +ED G YTC ATN  G  + + +L ++ +     G P+  K  G         
Sbjct: 24285 LTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYG--------- 24335

Query: 151   TRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVS 210
                                     G   R      GRP P +TW  G   LQ S  +++ 
Sbjct: 24336 ----------------------AVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIE 24373

Query: 211   EKNGMQVLEIHGV-NQDDVGVYTCLVVNGSGKASMSAELSIQGL-DSANRSFVRETKATN 268
                    L +  V  +   G Y   + N  G      ++ IQ   D      V E    N
Sbjct: 24374 NTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKN 24433

Query: 269   SDV 271
             S V
Sbjct: 24434 SAV 24436



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 37/118 (31%), Positives = 60/118 (50%), Gaps = 10/118 (8%)

Query: 1260  DKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CRS 1317
             +KP  P G P  + +   S  ++W   + DGG+ +++Y +E  +     W  + T   R 
Sbjct: 24518 EKPGAP-GKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRE 24576

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKE 1375
             T F+V++L+   EY+FRV+  N+ G SE S+ SE       P  PK +V +     KE
Sbjct: 24577 TVFSVKNLIEGLEYEFRVKCENLGGESEWSEISE-------PITPKSDVPIQAPHFKE 24627



 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 49/175 (28%), Positives = 74/175 (42%), Gaps = 22/175 (12%)

Query: 1029  PAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEG-SLCSVS 1087
             P FK+ L +    EG+ +  + +VS  PP T+ W  +G+ L     I +  EG    ++ 
Sbjct: 25490 PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 25549

Query: 1088  IEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAP-ASENTKAPEMKSRRPKSSLPPVL- 1145
             I   LPED G Y+  A N AG   C   + V+      +  K+ E   R  +  +   L 
Sbjct: 25550 IRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQIDKTLR 25609

Query: 1146  ------GTES------------DATVKKKPAPKTPP-KAAMPPQIIQFPEDQKVR 1181
                   GTES            +A V  KPA  T   K     +I +  E++K+R
Sbjct: 25610 MAEILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKGEFRLEIEEKKEERKLR 25664



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 1/93 (1%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD-EDGNCSL 1747
            PYF       ++VEG +  F C++ G P P V W K    +     +++ Y+ + G C L
Sbjct: 1036 PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKL 1095

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            +IS    DD  +YT    N  GE + +A L+ E
Sbjct: 1096 VISMTFADDAGEYTIVVRNKHGETSASASLLEE 1128



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 2/110 (1%)

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPA--GTPCASDIRSSSLTLSWYGSSYDGGSAVQS 1296
             + ++ EN+ G       +  V   +PP+  G    +D+  +S +L W    +DGGS V  
Sbjct: 17882 FRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLG 17941

Query: 1297  YSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             Y +E+     + W  +A  +  +  V  L    EY+FRV+A N  G S+P
Sbjct: 17942 YVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDP 17991



 Score = 57.8 bits (138), Expect = 9e-08
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 1670  EDVSQAFLEAVAEEKPH---VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1726
             ED  +A L       P    ++P F + + + E  EG +  F+ ++ G P P + W KD 
Sbjct: 25468 EDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDG 25527

Query: 1727  QSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGE 1786
             Q +    + +I ++     +L I D   +D   Y   A N+ G  +C A L VE +   +
Sbjct: 25528 QPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKK 25587

Query: 1787  GEGEEEEE 1794
              E + +EE
Sbjct: 25588 QEFKSKEE 25595



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 65/290 (22%), Positives = 112/290 (38%), Gaps = 42/290 (14%)

Query: 444  APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ----YARSTCEAGVAEL 499
            A      LK+  V E QD V    +    V  + W+ NG  ++    YA S  +  +  L
Sbjct: 2660 AVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISV-KGTIYSL 2718

Query: 500  HIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQG 559
             I++    D   Y       LG++  SA + V   K  +K +                  
Sbjct: 2719 RIKNCAIVDESVYGF----RLGRLGASARLHVETVKIIKKPK------------------ 2756

Query: 560  LSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPE 619
              D+  ++ + V   V VS +  P V W H   EI+ S+          H L +Q + P 
Sbjct: 2757 --DVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPS 2813

Query: 620  DTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDP 679
            D G YT       G++  +A L V+  H       I  P + TAS        C ++   
Sbjct: 2814 DAGEYTA----VVGQLECKAKLFVETLHITKTMKNIEVPETKTAS------FECEVSHFN 2863

Query: 680  FPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKN 729
             P++ WL++G  + + +  F+++    +  L++       + +Y  +  N
Sbjct: 2864 VPSM-WLKNGVEI-EMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGN 2911



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 33/96 (34%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 1689 PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG-NCSL 1747
            P   + ++ + V  G  ARF   I G P P++ W+K++Q +  S  F+  +  DG   +L
Sbjct: 3193 PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL--STGFKCKFLHDGQEYTL 3250

Query: 1748 IISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
            ++ +   +D A YTC+A N  G AT +A L VE  E
Sbjct: 3251 LLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE 3286



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 41/118 (34%), Positives = 56/118 (47%), Gaps = 8/118 (6%)

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---C 1315
             V KP PP       D   +S+TL+W    YDGGS +  Y +EI  +  + W+ +      
Sbjct: 17612 VFKPGPPTNAHIV-DTTKNSITLAWGKPIYDGGSEILGYVVEICKADEEEWQIVTPQTGL 17670

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDE 1373
             R T F +  L    EYK RV A+N  G  E +  S   TV  KPE+  +  E+  D E
Sbjct: 17671 RVTRFEISKLTEHQEYKIRVCALNKVGLGEAT--SVPGTV--KPEDKLEAPELDLDSE 17724



 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 3/119 (2%)

Query: 1233  QEHCGCY-TLLVENKLG-SRQAQVNLTV-VDKPDPPAGTPCASDIRSSSLTLSWYGSSYD 1289
             QE C  Y  +L  N+ G    A+    V V +P  P G     D+  ++ T+ W     D
Sbjct: 18958 QEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRNTATIKWEKPESD 19017

Query: 1290  GGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1348
             GGS +  Y +E+    ++ W      ++    +  L    EY FRV A+N  G S+P Q
Sbjct: 19018 GGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGEEYVFRVAAVNEKGRSDPRQ 19076



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 83/362 (22%), Positives = 140/362 (38%), Gaps = 34/362 (9%)

Query: 852  EQMDFRANLQRQVKPKTVSEEERK-VHSPQQVDFRSVLAK-KGTSKTPVPEKVPPPKPAT 909
            E+MD  +  Q+ V+P T  E E K + S ++V + +V ++ K    TPV + V     + 
Sbjct: 4334 EEMDSFSGSQK-VEPITEPEVESKYLISTEEVSYFNVQSRVKYLDATPVTKGVASAVVSD 4392

Query: 910  P-DFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPL--KPVGNAKPAE-- 964
                 S+   ++K  + + S + E    K  E+   L   +  GP+   P+ +    E  
Sbjct: 4393 EKQDESLKPSEEKEESSSESGTEEVATVKIQEAEGGL--IKEDGPMIHTPLVDTVSEEGD 4450

Query: 965  ---TLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAG------- 1014
                   + NAK             DE  K    +     V + VN +  H G       
Sbjct: 4451 IVHLTTSITNAKEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTE-DHQGEYVCEAL 4509

Query: 1015 -----TTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTL 1069
                 T  + K +  +  AP  K+K++ + VA G      C++ S P     W   G+ +
Sbjct: 4510 NDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREI 4569

Query: 1070 KTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKA 1129
              +    +     + S+ I +    D G Y C A N+ G   C+  +TV   P  E    
Sbjct: 4570 YESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-TVPGGEKKVR 4628

Query: 1130 PEMKSRRPKSSLPPVLGTESDATVKKKP---APKTPPKAAMPPQIIQFPEDQKVRAGESV 1186
              +  R+P+     VL     + ++K+P    PK  PK     +    PE    +  E V
Sbjct: 4629 KLLPERKPEPKEEVVL----KSVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEV 4684

Query: 1187 EL 1188
            E+
Sbjct: 4685 EV 4686



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 68/317 (21%), Positives = 120/317 (37%), Gaps = 58/317 (18%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             V  G  + +   VS  PP T+ W +N +TL     I  +   S  S+ I+      +G+Y
Sbjct: 10231 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISS--SMVIKNCQRSHQGVY 10288

Query: 1100  KCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAP 1159
               +AKN+AG+ + +  V V D P    T  P +       S                   
Sbjct: 10289 SLLAKNEAGERKKTIIVDVLDVPGPVGT--PFLAHNLTNESC------------------ 10328

Query: 1160  KTPPKAAMPPQIIQF-PEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVE 1218
                       ++  F PED                G  PIT  ++  +++        V 
Sbjct: 10329 ----------KLTWFSPEDD---------------GGSPIT-NYVIEKRESDRRAWTPVT 10362

Query: 1219  NSENGSKLTILAARQEHCGCYTLLVENKLG------SRQAQVNLTVVDKPDPPAGTPCAS 1272
              +      T+    Q     + +  EN +G      + +A V    +  P+ P       
Sbjct: 10363 YTVTRQNATVQGLIQGKAYFFRIAAENSIGMGPFVETSEALVIREPITVPERPEDLE-VK 10421

Query: 1273  DIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA--TCRSTSFNVQDLLPDHE 1330
             ++  +++TL+W    YDGGS + +Y +E      + + ++      S  + V+ L     
Sbjct: 10422 EVTKNTVTLTWNPPKYDGGSEIINYVLESRLIGTEKFHKVTNDNLLSRKYTVKGLKEGDT 10481

Query: 1331  YKFRVRAINVYGTSEPS 1347
             Y++RV A+N+ G  +PS
Sbjct: 10482 YEYRVSAVNIVGQGKPS 10498



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 66/316 (20%), Positives = 112/316 (35%), Gaps = 53/316 (16%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G  + ++  V   P  T+ W    + LK T+ +      +   ++I + +  D G Y   
Sbjct: 14775 GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLT 14834

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
             A+N  G+      + V D P                   PP    + D            
Sbjct: 14835 ARNIVGEVGDVITIQVHDIPG------------------PPTGPIKFDE----------- 14865

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
                 +    + F  D     G        V   Q  + TW++    +       +  +  
Sbjct: 14866 ----VSSDFVTFSWDPPENDGGVPISNYVVEMRQTDSTTWVELATTV-------IRTTYK 14914

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK-----PDPPAGTPCASDIRSS 1277
              ++LT     Q     + +  +N+ G      +  +V       P PP GTP  + +   
Sbjct: 14915 ATRLTTGLEYQ-----FRVKAQNRYGVGPGITSACIVANYPFKVPGPP-GTPQVTAVTKD 14968

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYKFRV 1335
             S+T+SW+    DGGS +  Y +E  +     W+ +  A      F    L     Y+FRV
Sbjct: 14969 SMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSKALVPGNIFKSSGLTDGIAYEFRV 15028

Query: 1336  RAINVYGTSEPSQESE 1351
              A N+ G S+PS+ SE
Sbjct: 15029 IAENMAGKSKPSKPSE 15044



 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 74/390 (18%), Positives = 140/390 (35%), Gaps = 53/390 (13%)

Query: 988   ENLKSASKEELKKDVKNDVNCKRGH-AGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKL 1046
             E L   ++ E +   KND        A ++   K  + + TA       Q +    G   
Sbjct: 22301 ERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPF 22360

Query: 1047  LLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKND 1106
              +   +S  P   + W L    LK T  + ++      +++++ ++  D G Y    +N 
Sbjct: 22361 TIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENT 22420

Query: 1107  AGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAA 1166
             AG    S  V V   P              P +    V    +++ V     PK      
Sbjct: 22421 AGVKTFSVTVVVIGRPG-------------PVTGPIEVSSVSAESCVLSWGEPKDGGGTE 22467

Query: 1167  MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKL 1226
             +   I++  E                      T  W      ++ ++           K+
Sbjct: 22468 ITNYIVEKRESG--------------------TTAWQLVNSSVKRTQ----------IKV 22497

Query: 1227  TILAARQEHCGCYTLLVENKLG-SRQAQVNLTVVDKPDPPAGTPCASD---IRSSSLTLS 1282
             T L    E+   + +  EN+ G S+  +    + + P  P   P   +   + ++++++ 
Sbjct: 22498 THLTKYMEY--SFRVSSENRFGVSKPLESAPIIAEHPFVPPSAPTRPEVYHVSANAMSIR 22555

Query: 1283  WYGSSYDGGSAVQSYSIEIWDSANKTW--KELATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             W    +DGGS +  Y +E  +     W  +    C   ++ V  L+   EY+FR  A+N 
Sbjct: 22556 WEEPYHDGGSKIIGYWVEKKERNTILWVKENKVPCLECNYKVTGLVEGLEYQFRTYALNA 22615

Query: 1341  YGTSEPSQESELTTVGEKPEEPKDEVEVSD 1370
              G S+ S+ S    + + P +     EV+D
Sbjct: 22616 AGVSKASEASR-PIMAQNPVDAPGRPEVTD 22644



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 41/142 (28%), Positives = 62/142 (43%), Gaps = 13/142 (9%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT---CRST 1318
             P  P   P  +D    S +L+W    YDGG  +  Y +E     ++ W +  T    R T
Sbjct: 14367 PPGPPSNPHVTDTTKKSASLAWGKPHYDGGLEITGYVVEHQKVGDEAWIKDTTGTALRIT 14426

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEV 1378
              F V DL    +Y FR+ AIN  G  EP+   ++  V         E E++ D E + E+
Sbjct: 14427 QFVVPDLQTKEKYNFRISAINDAGVGEPAVIPDVEIV---------EREMAPDFELDAEL 14477

Query: 1379  DYRTVTINTEQKVSDFYDIEER 1400
               RT+ +     +  F  I+ R
Sbjct: 14478 -RRTLVVRAGLSIRIFVPIKGR 14498



 Score = 56.2 bits (134), Expect = 3e-07
 Identities = 35/102 (34%), Positives = 48/102 (47%), Gaps = 5/102 (4%)

Query: 445   PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARST--CEAGVA--ELH 500
             P F  +L +    EGQ    +  V G P P + W  +GQP+    +      G+    LH
Sbjct: 25490 PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 25549

Query: 501   IQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEY 542
             I+D LPED G Y   A N  G  SC A + V E+   +K E+
Sbjct: 25550 IRDTLPEDTGYYRVTATNTAGSTSCQAHLQV-ERLRYKKQEF 25590



 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 4/130 (3%)

Query: 1657 PTSPLNAEKLESEEDVSQ--AFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEG 1714
            P      +++E  E ++   A      ++K   KP        + V+EG  ARF C++ G
Sbjct: 1761 PEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTG 1820

Query: 1715 YPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCT 1774
            YP P+V W+ + Q IR+S+ F++ Y  DG   L I D    D  +    A N  G     
Sbjct: 1821 YPQPKVNWYLNGQLIRKSKRFRVRY--DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHK 1878

Query: 1775 AELIVETMEE 1784
             +L ++  E+
Sbjct: 1879 VKLEIQQRED 1888



 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

Query: 1237  GC---YTLLVENKLGSRQAQVNLTVV---DKPDPPAGTPCASDIRSSSLTLSWYGSSYDG 1290
             GC   + ++ EN+ G  +       V   + P PP       DI  S+++L+W    +DG
Sbjct: 14629 GCEYFFRVMAENEYGIGEPTETTEPVKASEAPSPPDSLNIM-DITKSTVSLAWPKPKHDG 14687

Query: 1291  GSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
             GS +  Y IE     +  W  + T +     V++L    EY F+V A+N  G S P +ES
Sbjct: 14688 GSKITGYVIEAQRKGSDQWTHITTVKGLECVVRNLTEGEEYTFQVMAVNSAGRSAP-RES 14746

Query: 1351  ELTTVGEKPEEPK 1363
                 V E+   P+
Sbjct: 14747 RPVIVKEQTMLPE 14759



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 52/241 (21%), Positives = 83/241 (34%), Gaps = 46/241 (19%)

Query: 1028 APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKF--IILSQEGSLCS 1085
            AP F Q LQ V V EG     +  +S  P   + W  +G+ + T+    + +S       
Sbjct: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 1086 VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVL 1145
            ++I      + G Y   A N +GQA  + ++ V    A                      
Sbjct: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA---------------------- 102

Query: 1146 GTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF 1205
                                  PP  +Q  +   VR G  V L  +VTG       + + 
Sbjct: 103  ----------------------PPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRD 140

Query: 1206 RKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP 1265
              +IQ S   ++    +   L I  A  E  G Y++   N +G   +   L V  + + P
Sbjct: 141  GAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVP 200

Query: 1266 A 1266
            A
Sbjct: 201  A 201



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 1/97 (1%)

Query: 1685  PHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQS-IRESRHFQIDYDEDG 1743
             P   P+F + +R+L V   S A   CK+ G+P P V W++  +  I +   ++I   + G
Sbjct: 24619 PIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGG 24678

Query: 1744  NCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
                LII+ V  DD   Y  +A N  G  + TA L VE
Sbjct: 24679 YHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVE 24715



 Score = 55.5 bits (132), Expect = 5e-07
 Identities = 34/96 (35%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
             P F    R   + EG    F C+I G P PE+ WFK++  I  S +  I    +   SL 
Sbjct: 26829 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRN-VYSLE 26887

Query: 1749  ISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
             I +    D  KYT KA N  G+ + TA L+V  + E
Sbjct: 26888 IRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVE 26923



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 35/113 (30%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CRSTS 1319
             P PP   P  +D   SS  L W     DGGS V  Y +E  +   + W++      R T 
Sbjct: 10117 PGPPF--PKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGKEEWEKGKDKEVRGTK 10174

Query: 1320  FNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
               V  L     YKFRVRA+N+ G  EP + +++  + ++   P  +++ S  D
Sbjct: 10175 LVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDLQLDASVRD 10227



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

Query: 1261  KPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL---ATCRS 1317
             KP  P   P   D    +  L W     DGGS +  Y +E        W  +      R 
Sbjct: 11497 KPPGPPINPKLKDKSRETADLVWTKPLSDGGSPILGYVVECQKPGTAQWNRINKDELIRQ 11556

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDD 1372
              +F V  L+  +EY+FR++A N+ G  EP + +E     +    P+ E++V+  D
Sbjct: 11557 CAFRVPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRD 11611



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 60/243 (24%), Positives = 94/243 (38%), Gaps = 33/243 (13%)

Query: 1147  TESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFG--KVTG-----TQPIT 1199
             TES   + K    K  P    PP++ +  +++        E  G   +TG      +  +
Sbjct: 12077 TESKPVIAKTKYDK--PGRPDPPEVTKVSKEEMTVVWNPPEYDGGKSITGYFLEKKEKHS 12134

Query: 1200  CTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVV 1259
               W+   K       MKV+N              +H   + +  EN++G  +  +    V
Sbjct: 12135 TRWVPVNKSAIPERRMKVQN-----------LLPDHEYQFRVKAENEIGIGEPSLPSRPV 12183

Query: 1260  DKPDP--PAGTPC---ASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWD-----SANKTW 1309
                DP  P G P      D    S+TL W    YDGG+ +  Y +E+       S ++ W
Sbjct: 12184 VAKDPIEPPGPPTNFRVVDTTKHSITLGWGKPVYDGGAPIIGYVVEMRPKIADASPDEGW 12243

Query: 1310  KEL---ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEV 1366
             K     A      F V  L  + EY+FRV A N  G   P++  E     E  E P+ ++
Sbjct: 12244 KRCNAAAQLVRKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDL 12303

Query: 1367  EVS 1369
             + S
Sbjct: 12304 DAS 12306



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 29/85 (34%), Positives = 43/85 (50%), Gaps = 2/85 (2%)

Query: 1273  DIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRST--SFNVQDLLPDHE 1330
             D+  S++TL+W    YDGGS +  Y +E   +  + W ++ T + T     V  L    +
Sbjct: 23340 DVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQ 23399

Query: 1331  YKFRVRAINVYGTSEPSQESELTTV 1355
             Y FR+RA N  G SEP +     TV
Sbjct: 23400 YLFRIRAQNEKGVSEPRETVTAVTV 23424



 Score = 55.1 bits (131), Expect = 6e-07
 Identities = 65/266 (24%), Positives = 104/266 (39%), Gaps = 36/266 (13%)

Query: 444   APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI-----QYARSTCEAGVAE 498
             AP F   L++  V    +  L C V G P P + W   G+ I     +Y     + G  +
Sbjct: 24622 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQ 24681

Query: 499   LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQ 558
             L I     +D   Y   A N  G VS +A + V                P+K   P  L+
Sbjct: 24682 LIIASVTDDDATVYQVRATNQGGSVSGTASLEVE--------------VPAKIHLPKTLE 24727

Query: 559   GLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFP 618
             G+  +  + G  V++ +  SG P P + W   G ++ ++   H++   T+    +  VFP
Sbjct: 24728 GMGAVHALRGEVVSIKIPFSGKPDPVITW-QKGQDLIDNNG-HYQVIVTRSFTSL--VFP 24783

Query: 619   -----EDTGTYTCEAWNSAG---EVRTQAVLTVQEPHDGTQPWFISKPR-----SVTASL 665
                  +D G Y   A N  G   +     V  V +P  G +   +S+       +  AS 
Sbjct: 24784 NGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDPPRGVKVSDVSRDSVNLTWTEPASD 24843

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKA 691
             G S + +  +         WLR G+A
Sbjct: 24844 GGSKITNYIVEKCATTAERWLRVGQA 24869



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 17/112 (15%)

Query: 1262 PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEI--WD---SANKTWKEL--AT 1314
            PDPP        I  +++ LSW     DGGS V  Y +E   WD   +  + W++     
Sbjct: 9707 PDPPIKLKIGL-ITKNTVHLSWKPPKNDGGSPVTHYIVECLAWDPTGTKKEAWRQCNKRD 9765

Query: 1315 CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVG----EKPEEP 1362
                 F V+DL+   EY+FRV+A+N  G S+PS      TVG    ++P+ P
Sbjct: 9766 VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPS-----ATVGPCDCQRPDMP 9812



 Score = 54.7 bits (130), Expect = 8e-07
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 12/132 (9%)

Query: 1239  YTLLVENKLG--SRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQS 1296
             + +  EN  G  S       T+   P  P GTP   D+   ++TL W     DGGS +  
Sbjct: 21524 FRVYAENSAGLSSPSDPSKFTLAVSPVDPPGTPDYIDVTRETITLKWNPPLRDGGSKIVG 21583

Query: 1297  YSIEIWDSANKTW-----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQES 1350
             YSIE     N+ W      +++ C+   + V  L P   Y+FR+ A N  GT S PSQ S
Sbjct: 21584 YSIE-KRQGNERWVRCNFTDVSECQ---YTVTGLSPGDRYEFRIIARNAVGTISPPSQSS 21639

Query: 1351  ELTTVGEKPEEP 1362
              +    ++   P
Sbjct: 21640 GIIMTRDENVPP 21651



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 35/117 (29%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 1677 LEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQ 1736
            +EAV  +   VKP F + ++++ + EGS      +  G P+P++VW K+   I   ++ +
Sbjct: 1501 VEAVEHQ---VKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPK 1557

Query: 1737 IDYD-EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEE 1792
            I  +   G  +L I      D A YT  A+N  G  T   ++ VE +E  E E E +
Sbjct: 1558 IRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE-VEFAEPEPERK 1613



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 82/353 (23%), Positives = 125/353 (35%), Gaps = 50/353 (14%)

Query: 1031  FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLN-GKTLKTTKFIILSQEGSLCSVSIE 1089
             F+ KL    +  G+   L  + S  P   + W  +    L+  +  I +   +L    I 
Sbjct: 10519 FRDKLT---IRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKI- 10574

Query: 1090  KALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTES 1149
             KA   D G Y  V +N  G  +  CQV V D P                   PPV     
Sbjct: 10575 KAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPG------------------PPVGPVSF 10616

Query: 1150  DATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQI 1209
             D   K        P        I     +K   G+ V +    + +   TC   K  K +
Sbjct: 10617 DEVTKDYMVISWKPPLDDGGSKITNYIIEKKEVGKDVWM-PVTSASAKTTC---KVSKLL 10672

Query: 1210  QESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTP 1269
             +  +++   ++EN                Y +       S +A+    V D PD P  T 
Sbjct: 10673 EGKDYIFRIHAEN---------------LYGISDPLVSDSMKAKDRFRVPDAPDQPIVTE 10717

Query: 1270  CASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS---TSFNVQDLL 1326
                D    S  ++W    +DGG  + +Y +E  ++ +K W  +        T F V DLL
Sbjct: 10718 VTKD----SALVTW-NKPHDGGKPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLL 10772

Query: 1327  PDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVD 1379
                +Y+FRV A N  G  +PS  S+     +   +P   V     D     VD
Sbjct: 10773 EGCQYEFRVSAENEIGIGDPSPPSKPVFAKDPIAKPSPPVNPEAIDTTCNSVD 10825



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 34/114 (29%), Positives = 48/114 (42%), Gaps = 17/114 (14%)

Query: 129   KQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRP 188
             +QL  PV++K L                   PP F        V  G+  +      GRP
Sbjct: 15828 RQLSVPVIAKDL-----------------VIPPAFKLLFNTFTVLAGEDLKVDVPFIGRP 15870

Query: 189   QPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKA 242
              P VTW K NVPL+ + RV+        +L I    ++DVG Y   + N +G+A
Sbjct: 15871 TPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEA 15924



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 26/77 (33%), Positives = 44/77 (57%)

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             V+ GQ  +    I+GRP+P +TW K  +PL+ + R++V++   +  L I   ++DD G Y
Sbjct: 16936 VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQY 16995

Query: 232   TCLVVNGSGKASMSAEL 248
                V N  G+ + S E+
Sbjct: 16996 GITVANVVGQKTASIEI 17012



 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 4/94 (4%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIR---ESRHFQIDYDEDGNC 1745
             P F+  + +     G   RF   I  +P+P V W+K  Q I+     + +  + D+ G  
Sbjct: 25385 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDK-GLY 25443

Query: 1746  SLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              L I+ V  DDDA+YT  A N  GE +C A+L V
Sbjct: 25444 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 25477



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 42/120 (35%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 1667 ESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDD 1726
            +S +  + A L  V    P +K    + I  LEV  G  A+F C+I+  P+    WFK  
Sbjct: 4511 DSGKTATSAKLTVVKRAAPVIK----RKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAG 4566

Query: 1727 QSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGE 1786
            + I ES    I   +  + SL I      D  +YTCKA N  G  +CTA L V T+  GE
Sbjct: 4567 REIYESDKCSIRSSKYIS-SLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-TVPGGE 4624



 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 1/111 (0%)

Query: 1678  EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQI 1737
             E  A E    KP     ++D  V   S A+F  K  G P P  +W KD ++I +   +++
Sbjct: 26536 EPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKL 26595

Query: 1738  DYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGE 1788
               D+ G   L I      D   YTC   NS G  + + +L ++ +++ E +
Sbjct: 26596 SEDK-GGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQ 26645



 Score = 53.5 bits (127), Expect = 2e-06
 Identities = 66/288 (22%), Positives = 114/288 (39%), Gaps = 41/288 (14%)

Query: 448  SSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGVAELHIQDA 504
            +  +K+  V E +    +C V    VP + WL NG  I+ +       +  + +L I + 
Sbjct: 2839 TKTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNT 2897

Query: 505  LPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQG-LSDL 563
              ED   YT +  N   QVS +  VT                       PI +   L D+
Sbjct: 2898 STEDSAEYTFVCGN--DQVSATLTVT-----------------------PIMITSMLKDI 2932

Query: 564  KVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGT 623
               +   +T  V V+        WL NG EI+ ++      +   HSL I+ V   D   
Sbjct: 2933 NAEEKDTITFEVTVNYEGI-SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAAD 2991

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
            YT      AG+  + A L V+  H      F    + +     +  +  C ++ +P  TV
Sbjct: 2992 YTF----VAGKATSTATLYVEARHIE----FRKHIKDIKVLEKKRAMFECEVS-EPDITV 3042

Query: 684  HWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRV 731
             W++D + L + T   ++ + + V  L++   +   AG+Y ++    V
Sbjct: 3043 QWMKDDQEL-QITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNV 3089



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 95/436 (21%), Positives = 157/436 (36%), Gaps = 67/436 (15%)

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             ++ G   R    I GRP P+V W K +  ++ +A + V+      VL+   VN+ D G Y
Sbjct: 16649 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTSLVLD--NVNRYDSGKY 16706

Query: 232   TCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAA 291
             T  + N SG  + SA ++++ LD+        +   N  V +   + +S   +   L+  
Sbjct: 16707 TLTLENSSG--TKSAFVTVRVLDT-------PSPPVNLKVTEITKDSVSITWEPPLLDGG 16757

Query: 292   AKSKNCSSPQRGGS-PPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAA 350
             +K KN    +R  +   +AA          K++  ++    +    V  +    I L A 
Sbjct: 16758 SKIKNYIVEKREATRKSYAAVVTNCHKNSWKIDQLQEG--CSYYFRVTAENEYGIGLPAQ 16815

Query: 351   RVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRD 410
                P   A    V  P G+           +    +P     D  SK     + M+ +  
Sbjct: 16816 TADPIKVAE---VPQPPGKITVDDVTRNSVSLSWTKP---EHDGGSKIIQYIVEMQAKHS 16869

Query: 411   SAFPKFESKPQSQEVKENQT----VKFRC-----------EGLAVMEVA------PSFSS 449
               + +       Q V  N T      FR              LAV  VA      P    
Sbjct: 16870 EKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKP 16929

Query: 450   VLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALP 506
                  +V  GQD  ++  + G P P ITW  +G P++       T    +  L I++   
Sbjct: 16930 AFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHK 16989

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM 566
             +D G Y     N +GQ + S  +   +K             P  P  P+    +S     
Sbjct: 16990 DDGGQYGITVANVVGQKTASIEIVTLDK-------------PDPPKGPVKFDDVS----- 17031

Query: 567   DGSQVTMTVQVSGNPP 582
                    ++ +S NPP
Sbjct: 17032 -----AESITLSWNPP 17042



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/82 (29%), Positives = 41/82 (50%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +++K G+  R    + GRP P+VTW K  V ++    + +++  G   L +    +D  G
Sbjct: 21663 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRG 21722

Query: 230   VYTCLVVNGSGKASMSAELSIQ 251
             VYT    N SG A    ++ +Q
Sbjct: 21723 VYTVEAKNASGSAKAEIKVKVQ 21744



 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 24/92 (26%), Positives = 53/92 (57%), Gaps = 1/92 (1%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI 1748
             P   K ++D+    G AA+  C+I G P P++ W++  + + +SR +++  D   +   +
Sbjct: 24228 PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTV 24287

Query: 1749  ISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             +++   +D+  YTC A N +GE   +++L+++
Sbjct: 24288 MTEE-QEDEGVYTCIATNEVGEVETSSKLLLQ 24318



 Score = 52.8 bits (125), Expect = 3e-06
 Identities = 48/199 (24%), Positives = 78/199 (39%), Gaps = 12/199 (6%)

Query: 551   PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHS 610
             PT  +       + V  G  V + + ++G PPP   W   G++++ESE    E       
Sbjct: 23431 PTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAK 23490

Query: 611   LCIQEVFPEDTGTYTCEAWNSAGEV-RTQAVLTVQEPHDGTQPWFISK--PRSVTASL-- 665
             L I+E    DTG YT E  N  G    T  V+ + +P   T P  I +    S+T S   
Sbjct: 23491 LTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITISWEP 23550

Query: 666   ----GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAG 721
                 G + L    +         WL   +++ + T  F  L   + +   +     +  G
Sbjct: 23551 PELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRFGIG 23610

Query: 722   QYEILLKNRVGECSCQVSL 740
              Y   L++ V EC   + +
Sbjct: 23611 SY---LQSEVIECRSSIRI 23626



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 32   APAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR-GTFS 90
            AP FI  P    + EG +  F  +V G P+P V W ++G P+T+G R+ +    + G   
Sbjct: 1035 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1094

Query: 91   LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSF 127
            LVI     +D G+YT    N  G    +  L  E  +
Sbjct: 1095 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADY 1131



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 2/119 (1%)

Query: 1661  LNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEV 1720
             ++A+  +   D  Q  +  +A++   + P F        V+ G   + D    G P P V
Sbjct: 15816 VSAQNEKGISDPRQLSVPVIAKDLV-IPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAV 15874

Query: 1721  VWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              W KD+  ++++     +  E+ N  L I D C +D   Y  K  NS GEA  T  +IV
Sbjct: 15875 TWHKDNVPLKQTTRVNAESTEN-NSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIV 15932



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 94/441 (21%), Positives = 159/441 (36%), Gaps = 63/441 (14%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V ++ G   R    ++GRP P +TW K  + L   A +  +E   + +++   VN+ D G
Sbjct: 23151 VTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSLLIVD--KVNRYDAG 23208

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSF-VRETKATNSDVRKE---------VTNVI 279
              YT    N SGK S +  + +        S  V+E    +  +  E         V N I
Sbjct: 23209 KYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGGAPVNNYI 23268

Query: 280   SKESKLDSLEAAAKSKNCSSPQRGGSP------------PWAANSQPQPPRESKLESCKD 327
              ++ +         +  CS      S             P       +P   S      +
Sbjct: 23269 VEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVLVSE 23328

Query: 328   SPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQP 387
              P    +  V+  T S++TL       +P   G   L+    E  +    R     T +P
Sbjct: 23329 VPLVPAKLEVVDVTKSTVTL----AWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKP 23384

Query: 388   GLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSF 447
              +    V S         EG++     + +++    E +E  T     + L V+      
Sbjct: 23385 TVLEHTVTSL-------NEGEQYLFRIRAQNEKGVSEPRETVTA-VTVQDLRVLPTIDLS 23436

Query: 448   SSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-RSTCE--AGVAELHIQDA 504
             +   K   V  G+   L   + G P P  +W   G  ++ + R T E    VA+L I++ 
Sbjct: 23437 TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRET 23496

Query: 505   LPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLK 564
                D G YT   +N  G  S +  V + +K             P  PT PI       + 
Sbjct: 23497 TIRDTGEYTLELKNVTGTTSETIKVIILDK-------------PGPPTGPI------KID 23537

Query: 565   VMDGSQVTMTVQVSGNPPPEV 585
              +D + +T++ +     PPE+
Sbjct: 23538 EIDATSITISWE-----PPEL 23553



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 62/233 (26%), Positives = 97/233 (41%), Gaps = 22/233 (9%)

Query: 1155  KKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFG---KVTGTQPITCTWMKFRKQIQE 1211
             K   P TP     PP+    P +       SV L     K  G   +T  +++ ++   +
Sbjct: 24010 KSEEPVTPKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTD 24069

Query: 1212  S--EHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG-SRQAQVNLTVV-----DKPD 1263
                 H K + +     +T L    E+   + ++ +N +G S  +  +  VV     DKP 
Sbjct: 24070 KWVRHNKTQITTTMYTVTGLVPDAEYQ--FRIIAQNDVGLSETSPASEPVVCKDPFDKPS 24127

Query: 1264  PPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCRSTSFN 1321
              P      S I   S+TL W     DGG  +  Y +E   S +  WK+      +   F 
Sbjct: 24128 QPGELEILS-ISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFT 24186

Query: 1322  VQDLLPDHEYKFRVRAINVYGTSEP-----SQESELTTVGEKPEEPKDEVEVS 1369
             +  LL   EY+FRV A N  G S P     S +++LT+ GE P   K+  +V+
Sbjct: 24187 IGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTS-GEAPGIRKEMKDVT 24238



 Score = 52.4 bits (124), Expect = 4e-06
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 171   VVKEGQMGRFSCKITGRPQP-QVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V +EG   ++ CKI    Q  QVTW  G   L+ S +  ++ ++G+ +L +  + + D G
Sbjct: 25273 VGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDG 25332

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRET 264
              Y C VVN  G+ S  AEL ++G+      + R T
Sbjct: 25333 TYRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRT 25367



 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 72/338 (21%), Positives = 111/338 (32%), Gaps = 54/338 (15%)

Query: 1036  QDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPED 1095
             ++ H+  G  L L   +   P   + W    +   T   I ++  GS   + I  A  ED
Sbjct: 10921 REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEIRNAAHED 10978

Query: 1096  RGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKK 1155
              G+Y    +N AG    S +V V D P              P+      +  +S     K
Sbjct: 10979 GGIYSLTVENPAGSKTVSVKVLVLDKPGP------------PRDLEVSEIRKDSCYLTWK 11026

Query: 1156  KPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM 1215
             +P                         G SV     V      +  W       ++  H 
Sbjct: 11027 EPLDD----------------------GGSVITNYVVERRDVASAQWSPLSATSKKKSHF 11064

Query: 1216  KVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP--PAGTPCAS- 1272
                 +E    L  +AA            EN+ G          +   DP  P G P    
Sbjct: 11065 AKHLNEGNQYLFRVAA------------ENQYGRGPFVETPKPIKALDPLHPPGPPKDLH 11112

Query: 1273  --DIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHE 1330
               D+  + ++L W     DGGS +  Y +E  +   + W +  T  +    V  L     
Sbjct: 11113 HVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECVVTGLQQGKT 11172

Query: 1331  YKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEV 1368
             Y+FRV+A N+ G   P     +    EK   P  E++V
Sbjct: 11173 YRFRVKAENIVGLGLPDTTIPI-ECQEKLVPPSVELDV 11209



 Score = 52.0 bits (123), Expect = 5e-06
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 1/104 (0%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             L IK G + + +  V+G P P+VTW ++G  I       +   + G+ SL +     + R
Sbjct: 21663 LIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTSLFVRDATRDHR 21721

Query: 102   GKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFS 145
             G YT EA N SG+ +  +++ V+ +  K +G    +   G++ +
Sbjct: 21722 GVYTVEAKNASGSAKAEIKVKVQDTPGKVVGPIRFTNITGEKMT 21765



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 90/418 (21%), Positives = 158/418 (37%), Gaps = 69/418 (16%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VV+ G   R    I GRP P+VTW K N+ L+  A +  +E     +L I   N+ D G
Sbjct: 14481 LVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTE--SFTLLIIPECNRYDTG 14538

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSF-VRETKATNSDVR-----------KEVTN 277
              +   + N +GK   S  ++++ LD+      +R T  T   V              +TN
Sbjct: 14539 KFVMTIENPAGK--KSGFVNVRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITN 14596

Query: 278   VISKE---SKLDSLEAAAKSKNCSSPQRGGSP-------PWAANSQ--PQPPRESKLESC 325
              I ++   ++     A  K   C+    G S          A N     +P   ++    
Sbjct: 14597 YIVEKREATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKA 14656

Query: 326   KDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTR 385
              ++P       ++  T S+++L      P+P+  G   ++    E +R    +     T 
Sbjct: 14657 SEAPSPPDSLNIMDITKSTVSL----AWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTV 14712

Query: 386   QPGLGSQDVVSKAANR-----RIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAV 440
             +   G + VV           ++        + P+ ES+P    + + QT+      L  
Sbjct: 14713 K---GLECVVRNLTEGEEYTFQVMAVNSAGRSAPR-ESRP---VIVKEQTM------LPE 14759

Query: 441   MEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI---QYARSTCEAGVA 497
             +++   +  ++   A   G +  ++  V G P P +TW    Q +   Q       A   
Sbjct: 14760 LDLRGIYQKLVIAKA---GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATST 14816

Query: 498   ELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPI 555
              L+I + +  D G Y   A N +G+V     + VH+              P  PT PI
Sbjct: 14817 ILNINECVRSDSGPYPLTARNIVGEVGDVITIQVHD-------------IPGPPTGPI 14861



 Score = 51.6 bits (122), Expect = 7e-06
 Identities = 40/153 (26%), Positives = 63/153 (41%), Gaps = 18/153 (11%)

Query: 1202  WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLG---SRQAQVNLTV 1258
             W K  K +  + H KV     G               + +  EN  G          +  
Sbjct: 20411 WQKANKLVIRTTHFKVTTISAGLIYE-----------FRVYAENAAGVGKPSHPSEPVLA 20459

Query: 1259  VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCR 1316
             +D  +PP      +DI  +S++LSW   ++DGGS +  Y +E  D  +  W +       
Sbjct: 20460 IDACEPPRNVRI-TDISKNSVSLSWQQPAFDGGSKITGYIVERRDLPDGRWTKASFTNVT 20518

Query: 1317  STSFNVQDLLPDHEYKFRVRAINVYGT-SEPSQ 1348
              T F +  L  + +Y+FRV A N  G+ S PS+
Sbjct: 20519 ETQFIISGLTQNSQYEFRVFARNAVGSISNPSE 20551



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 55/198 (27%), Positives = 76/198 (38%), Gaps = 39/198 (19%)

Query: 452  KDCAVIEGQDFVLQCSVRGTPVPRITWLLNG---QPIQYARSTCEAGVAELHIQDALPED 508
            KD   +E      + SV    VP + W       +P    R   E  V +L +Q+  P D
Sbjct: 2756 KDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSD 2814

Query: 509  HGTYTCLAENALGQVSCSAWV---TVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKV 565
             G YT +    +GQ+ C A +   T+H  K+ +  E      P   TA            
Sbjct: 2815 AGEYTAV----VGQLECKAKLFVETLHITKTMKNIE-----VPETKTA------------ 2853

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYT 625
                  +   +VS    P + WL NG EI+ SE F    +G  H L I     ED+  YT
Sbjct: 2854 ------SFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYT 2906

Query: 626  CEAWNSAGEVRTQAVLTV 643
                N     +  A LTV
Sbjct: 2907 FVCGND----QVSATLTV 2920



 Score = 51.2 bits (121), Expect = 9e-06
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

Query: 1259 VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT--CR 1316
            +  P PP   P  +D  S+++ L W   +++GG  +  Y ++        W        +
Sbjct: 8695 ISPPGPPI--PRVTDTSSTTIELEWEPPAFNGGGEIVGYFVDKQLVGTNEWSRCTEKMIK 8752

Query: 1317 STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
               + V+++    +YK RV A+N  G   P  E++  TV E  E P  E++VS
Sbjct: 8753 VRQYTVKEIREGADYKLRVSAVNAAGEGPPG-ETQPVTVAEPQEPPAVELDVS 8804



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 71/323 (21%), Positives = 113/323 (34%), Gaps = 62/323 (19%)

Query: 1056  PPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSC- 1114
             PP T+ W  + K L +     +    S   ++I +    D G Y    +N  G+ + S  
Sbjct: 20994 PPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTV 21053

Query: 1115  QVTVDDAPASENTKAPEMKSRRPKSSL--PPVLGTES---DATVKKKPAPKTPPKAAMPP 1169
              V V D PA+      +  SR   + L  PP++   S   +  ++K+ A K         
Sbjct: 21054 SVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKR-------- 21105

Query: 1170  QIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTIL 1229
                                            TW     +   +    ++ SE        
Sbjct: 21106 -------------------------------TWSVVSHKCSSTSFKLIDLSEKTPFF--- 21131

Query: 1230  AARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCAS--DIRSSSLTLSWYGSS 1287
                      + +L EN++G  +       V   + PA     S  D   +S+ LSW    
Sbjct: 21132 ---------FRVLAENEIGIGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPD 21182

Query: 1288  YDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             +DGGS +  Y +E      +TW      ++    V  L      +FRV A N  G S+P 
Sbjct: 21183 FDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPV 21242

Query: 1348  QESELTTVGEKPEEPKDEVEVSD 1370
                 + TV E    P  EV++SD
Sbjct: 21243 TIGPI-TVKELIITP--EVDLSD 21262



 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 41/157 (26%), Positives = 69/157 (43%), Gaps = 9/157 (5%)

Query: 1220  SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQ--VNLTVVDKPDPPAGTPCA---SDI 1274
             SE   K+T L    E+   + ++ EN  G   A     L    +P  P G P     +D 
Sbjct: 21903 SETRFKVTGLTEGNEYE--FHVMAENAAGVGPASGISRLIKCREPVNPPGPPTVVKVTDT 21960

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL--ATCRSTSFNVQDLLPDHEYK 1332
               ++++L W    +DGG  +  Y IE+  +    W ++    C  T + V DL    EYK
Sbjct: 21961 SKTTVSLEWSKPVFDGGMEIIGYIIEMCKADLGDWHKVNAEACVKTRYTVTDLQAGEEYK 22020

Query: 1333  FRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
             FRV AIN  G  +  + +      ++   P+ +++ +
Sbjct: 22021 FRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDAN 22057



 Score = 50.1 bits (118), Expect = 2e-05
 Identities = 28/95 (29%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

Query: 649   GTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVF 708
             G  P    + + VT  LG++  +SC I G P P + W R GK L + +  +++  +    
Sbjct: 24225 GEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQ-SRKYKMSSDGRTH 24283

Query: 709   TLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
             TL +   +    G Y  +  N VGE      L+LQ
Sbjct: 24284 TLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQ 24318



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 36/155 (23%), Positives = 61/155 (39%), Gaps = 12/155 (7%)

Query: 145  SAPAVETRPSIWGECPPKF--ATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQ 202
            S P  E +     E P  F     L  + VK G        +TG+P+P++TW K ++ L+
Sbjct: 7368 SRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILK 7427

Query: 203  PSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQG---------- 252
               R+++        + I    + D G Y    VN  G+A+   E+++            
Sbjct: 7428 QDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPPAAFDI 7487

Query: 253  LDSANRSFVRETKATNSDVRKEVTNVISKESKLDS 287
             D  N S +        D   ++TN + +    DS
Sbjct: 7488 TDVTNESCLLTWNPPRDDGGSKITNYVVERRATDS 7522



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 10/118 (8%)

Query: 1262 PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC------ 1315
            P PP G P        S+ +SW     +GGS +  Y +E  +  +  W  ++        
Sbjct: 9294 PGPP-GKPKVLARTKGSMLVSWTPPLDNGGSPITGYWLEKREEGSPYWSRVSRAPITKVG 9352

Query: 1316 -RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK--PEEPKDEVEVSD 1370
             +   FNV  LL   +Y+FR  AIN  G   PS+ S+    G+   P  P    EV D
Sbjct: 9353 LKGVEFNVPRLLEGVKYQFRAMAINAAGIGPPSEPSDPEVAGDPIFPPGPPSCPEVKD 9410



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 76/335 (22%), Positives = 109/335 (32%), Gaps = 60/335 (17%)

Query: 1043  GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCV 1102
             G  + L   V   PP  I W+     L+    + +        +  E     D G Y   
Sbjct: 13403 GVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYILT 13462

Query: 1103  AKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTP 1162
              +N  G+ E +  V V D P                   PPV  T  + +         P
Sbjct: 13463 LENSCGKKEYTIVVKVLDTPG------------------PPVNVTVKEISKDSAYVTWEP 13504

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
             P       II +   ++       +   K   T    C+   FR          V N E 
Sbjct: 13505 PIIDGGSPIINYVVQKR-------DAERKSWSTVTTECSKTSFR----------VANLEE 13547

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRS---SSL 1279
             G               + +  EN+ G          V     P G      +RS   SS 
Sbjct: 13548 GKSYF-----------FRVFAENEYGIGDPGETRDAVKASQTP-GPVVDLKVRSVSKSSC 13595

Query: 1280  TLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAIN 1339
             ++ W     DGGS +  Y ++     NK W+ +    S  ++ +DL    EY FRV A N
Sbjct: 13596 SIGWKKPHSDGGSRIIGYVVDFLTEENK-WQRVMKSLSLQYSAKDLTEGKEYTFRVSAEN 13654

Query: 1340  VYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEK 1374
               G   P   SE+T V       +D+V   D D K
Sbjct: 13655 ENGEGTP---SEITVVA------RDDVVAPDLDLK 13680



 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 1/82 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             S +  +GQ + I   I+G P PT+ W +DG  L K T    V  + D+ TL +K+     
Sbjct: 16933 SYSVQVGQDLKIEVPISGRPKPTITWTKDGLPL-KQTTRINVTDSLDLTTLSIKETHKDD 16991

Query: 720   AGQYEILLKNRVGECSCQVSLM 741
              GQY I + N VG+ +  + ++
Sbjct: 16992 GGQYGITVANVVGQKTASIEIV 17013



 Score = 49.3 bits (116), Expect = 3e-05
 Identities = 24/81 (29%), Positives = 40/81 (49%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             + VK G        + G+P P V+W K    L+P+  + ++ +  +  LE+  VN+ D G
Sbjct: 13000 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 13059

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              YT    N SG  S + +L +
Sbjct: 13060 DYTITAENSSGSKSATIKLKV 13080



 Score = 48.9 bits (115), Expect = 4e-05
 Identities = 67/319 (21%), Positives = 114/319 (35%), Gaps = 50/319 (15%)

Query: 1062  WTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDA 1121
             W+  GK ++ +    ++   +   ++I+ A  +D G Y   A N  G      +VTV D 
Sbjct: 14108 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDV 14167

Query: 1122  PASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVR 1181
             P                   PP     S+ + +K     TPP       I  +  +++  
Sbjct: 14168 PG------------------PPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKR-- 14207

Query: 1182  AGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTL 1241
               E+  L             W    + IQ   H+  +  + G++     +   H G    
Sbjct: 14208 --ETSRLL------------WTVVSEDIQSCRHVATKLIQ-GNEYIFRVSAVNHYG---- 14248

Query: 1242  LVENKLGSRQAQVNLTVVDK--PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
                   G       + +VD+  P  P   P  S++  ++ T+SW     DGGS +  Y +
Sbjct: 14249 -----KGEPVQSEPVKMVDRFGPPGPPEKPEVSNVTKNTATVSWKRPVDDGGSEITGYHV 14303

Query: 1300  EIWDSANKTWKELATCRSTSF--NVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGE 1357
             E  +  +  W        +     V  L     Y+FRV A N  G   PS+ S+   + +
Sbjct: 14304 ERREKKSLRWVRAIKTPVSDLRCKVTGLQEGSTYEFRVSAENRAGIGPPSEASDSVLMKD 14363

Query: 1358  K--PEEPKDEVEVSDDDEK 1374
                P  P     V+D  +K
Sbjct: 14364 AAYPPGPPSNPHVTDTTKK 14382



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 92/445 (20%), Positives = 156/445 (35%), Gaps = 76/445 (17%)

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             +K G   R S  I G P P+VTW K +      AR+ V+       LEI     +D G+Y
Sbjct: 10925 IKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK--LEIRNAAHEDGGIY 10982

Query: 232   TCLVVNGSGKASMSAELSIQGLDSANR----SFVRET------KATNSDVRKEVTNVISK 281
             +  V N +G  ++S ++ +       R    S +R+       K    D    +TN + +
Sbjct: 10983 SLTVENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVE 11042

Query: 282   ESKLDS-----LEAAAKSKN--CSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQ 334
                + S     L A +K K+        G    +   ++ Q  R   +E+ K      P 
Sbjct: 11043 RRDVASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPL 11102

Query: 335   TPV--------LQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQ 386
              P         +    + ++L   +   +  +P  G L    EE                
Sbjct: 11103 HPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEE---------------- 11146

Query: 387   PGLGSQDVV--SKAANRRIPMEGQRDSAFPKFESKPQS--QEVKENQTVKFRCEGLAVME 442
                G+QD +      N    + G +     +F  K ++       + T+   C+   V  
Sbjct: 11147 ---GTQDWIKFKTVTNLECVVTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPP 11203

Query: 443   VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI---QYARSTCEAGVAEL 499
                    +++   V  G        +RG PVP   W  +G  I   ++     +   + L
Sbjct: 11204 SVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVL 11263

Query: 500   HIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQG 559
              I++ L  D G Y     NA G  + +  +TV +              P  PT PI    
Sbjct: 11264 TIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD-------------VPGPPTGPI---- 11306

Query: 560   LSDLKVMDGSQVTMTVQVSGNPPPE 584
                  ++D +   MT  +S  PP +
Sbjct: 11307 ----NILDVTPEHMT--ISWQPPKD 11325



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 15/123 (12%)

Query: 12    ISKTSLSVDPSRVDSMPLTEAPAFILPPRN---------LCIKEGATAKFEGRVRGYPEP 62
             I++T++++ P    S P+T   A  +PPR          L +K G     +  V G P P
Sbjct: 12962 IARTAVNISPPSEPSDPVTIL-AENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMP 13020

Query: 63    QVTWHRNGQPI--TSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
              V+W ++G  +    G +  +    R   +L + +V+ +D G YT  A N SG++  T++
Sbjct: 13021 TVSWKKDGTLLKPAEGIKMAMQ---RNLCTLELFSVNRKDSGDYTITAENSSGSKSATIK 13077

Query: 121   LTV 123
             L V
Sbjct: 13078 LKV 13080



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 1/86 (1%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V+ K G+  +      GRP P VTW K    L   AR S+   +   +L I  V ++D G
Sbjct: 20976 VIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTG 21035

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDS 255
              Y   + NG G+   S+ +S++ LD+
Sbjct: 21036 KYILTIENGVGEPK-SSTVSVKVLDT 21060



 Score = 48.5 bits (114), Expect = 6e-05
 Identities = 34/119 (28%), Positives = 53/119 (44%), Gaps = 10/119 (8%)

Query: 1256  LTVVDKPDPPAG--TPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA 1313
             +  +D   PP     P  +D   +S++L+W     +GGS V  Y IE+       W +  
Sbjct: 23719 IVAMDPIAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTK-- 23776

Query: 1314  TCRSTSFNVQDLLPDH-----EYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVE 1367
              C +T   +++    H     EY+FRV A N  G  EP++      V E  E P  E++
Sbjct: 23777 -CNTTPTKIREYTLTHLPQGAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELD 23834



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 88/408 (21%), Positives = 158/408 (38%), Gaps = 69/408 (16%)

Query: 179   RFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG 238
             R    I GRP P+V W + +   +   + S+   +   +L +  VN+ D G Y   V N 
Sbjct: 15574 RLFVPIKGRPAPEVKWARDHG--ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENS 15631

Query: 239   SGKASMSAELSIQGLDSANRSF---VRETKATNS---------DVRKEVTNVISKESKLD 286
             SG  S SA ++++ LD+        V+E   T+          D   ++ N I ++ +  
Sbjct: 15632 SG--SKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEKREST 15689

Query: 287   SLEAAAKSKNCSSP-------QRGGSPPWAANSQPQP----PRESKLESCKDSPRTAP-- 333
                 +  + NC          Q G S  +   ++ +     P E+  ES K S R  P  
Sbjct: 15690 RKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLAENEYGIGLPAETA-ESVKASERPLPPG 15748

Query: 334   QTPVLQKTSSSITLQAARVQPEPRAPGLGVL---SPSGEERKRPAPPRPATFPTRQPGLG 390
             +  ++  T +S++L   + + +  +  LG +      G ++         T  T   GL 
Sbjct: 15749 KITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATIT-GL- 15806

Query: 391   SQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSV 450
                +  +  + R+  + ++  + P+  S P   +                + + P+F  +
Sbjct: 15807 ---IQGEEYSFRVSAQNEKGISDPRQLSVPVIAKD---------------LVIPPAFKLL 15848

Query: 451   LKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCEA--GVAELHIQDALPE 507
                  V+ G+D  +     G P P +TW  +  P+ Q  R   E+    + L I+DA  E
Sbjct: 15849 FNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACRE 15908

Query: 508   DHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPI 555
             D G Y     N+ G+   +  V V +K             P  PT P+
Sbjct: 15909 DVGHYVVKLTNSAGEAIETLNVIVLDK-------------PGPPTGPV 15943



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 39/126 (30%), Positives = 60/126 (47%), Gaps = 19/126 (15%)

Query: 129   KQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRP 188
             +QLG PV+++          +E +PS+  E P  F T      VK  +  +      GRP
Sbjct: 19075 RQLGVPVIARD---------IEIKPSV--ELP--FHT----FNVKAREQLKIDVPFKGRP 19117

Query: 189   QPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAEL 248
             Q  V W K    L+ + RV+VS    +  L I   +++DVG Y   V N +G  S++  +
Sbjct: 19118 QATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG--SITVPI 19175

Query: 249   SIQGLD 254
             +I  LD
Sbjct: 19176 TIIVLD 19181



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

Query: 106   CEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGEC--PPKF 163
             C  TN         ELT +  +  +    V ++   D  S P+  T P I  +   PP+ 
Sbjct: 19429 CNYTNIQETYFEVTELTEDQRYEFR----VFARNAADSVSEPSESTGPIIVKDDVEPPRV 19484

Query: 164   ATKL---GRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEI 220
                +     +VVK G++ + +  I GRP P ++W K  + ++  AR  +   +   +L +
Sbjct: 19485 MMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTV 19544

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
                 + D G Y   + N +G  S++    +
Sbjct: 19545 KDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 19574



 Score = 48.1 bits (113), Expect = 7e-05
 Identities = 38/158 (24%), Positives = 63/158 (39%), Gaps = 9/158 (5%)

Query: 1631  AVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPY 1690
             AV +  + S M   S +   KS        L++ +  +  ++  A LE  + E+      
Sbjct: 26190 AVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRK 26249

Query: 1691  FSKTI--------RDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
                T+        R + V EG +ARF C  +G P P V W +  Q +  S   Q+   + 
Sbjct: 26250 IKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTK- 26308

Query: 1743  GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
                +  IS V   D+  Y+    NS G+      L ++
Sbjct: 26309 YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 26346



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 38/132 (28%), Positives = 58/132 (43%), Gaps = 14/132 (10%)

Query: 546  VAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH--FE 603
            ++ S+     F   + + ++++G  VT   ++SG P P++ W  +G  I+  E +   F 
Sbjct: 1237 ISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFL 1296

Query: 604  QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS------- 656
            Q G + SL I  V PED G YT  A N  G       L V+       P +I        
Sbjct: 1297 QDG-RASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSR 1355

Query: 657  ----KPRSVTAS 664
                 PRSV+ S
Sbjct: 1356 IRSLSPRSVSRS 1367



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 3/101 (2%)

Query: 1682 EEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVV--WFKDDQSIRESRHFQIDY 1739
            +++   KP+F K +  L +     A F+C++    DP +V  W  D + +  +   ++  
Sbjct: 1650 DKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRM-I 1708

Query: 1740 DEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
            +E G CSL        D    TC+A N  G    +A LIV+
Sbjct: 1709 NEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVK 1749



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 44/182 (24%), Positives = 76/182 (41%), Gaps = 9/182 (4%)

Query: 1194 GTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQ 1253
            G  P+T  ++  ++++      KV +     + T+    Q     + +   NK G  +  
Sbjct: 7210 GGSPLT-GYVVEKREVSRKTWTKVMDFVTDLEFTVPDLVQGKEYLFKVCARNKCGPGEPA 7268

Query: 1254 -----VNL-TVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANK 1307
                 VN+ T    PDPP       D  ++S+ L+W     DGGS ++ Y +E     + 
Sbjct: 7269 YVDEPVNMSTPATVPDPPENVKWR-DRTANSIFLTWDPPKNDGGSRIKGYIVERCPRGSD 7327

Query: 1308 TWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEV 1366
             W         T   V  L     Y +RV+A+N  G S+PS+ +E     +  E P+  +
Sbjct: 7328 KWVACGEPVAETKMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFL 7387

Query: 1367 EV 1368
            +V
Sbjct: 7388 DV 7389



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             VT  +G +V +     G P P++ WL+DG  L K++      + E+  TL +K  +  H 
Sbjct: 21268 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPL-KESEFVRFSKTENKITLSIKNAKKEHG 21326

Query: 721   GQYEILLKNRVGECSCQVSLMLQNSSARALPRG 753
             G+Y ++L N V  C   V + +      + P+G
Sbjct: 21327 GKYTVILDNAV--CRIAVPITVITLGPPSKPKG 21357



 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 35/144 (24%), Positives = 60/144 (41%), Gaps = 17/144 (11%)

Query: 506   PEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLP----VAPSKPTAPIFLQGLS 561
             P D   +  +A NA+G +S            S+ S  ++     V P     P +  GL 
Sbjct: 21615 PGDRYEFRIIARNAVGTIS----------PPSQSSGIIMTRDENVPPIVEFGPEYFDGLI 21664

Query: 562   DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
                +  G  + +   V G P P V W  +G EI++  +          SL +++   +  
Sbjct: 21665 ---IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHR 21721

Query: 622   GTYTCEAWNSAGEVRTQAVLTVQE 645
             G YT EA N++G  + +  + VQ+
Sbjct: 21722 GVYTVEAKNASGSAKAEIKVKVQD 21745



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 117/571 (20%), Positives = 206/571 (36%), Gaps = 81/571 (14%)

Query: 158  ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQV 217
            E  P F  KL      E       C+++      V W K    + PS + S+      ++
Sbjct: 5355 EADPYFTVKLHDKTAVEKDEITLKCEVS--KDVPVKWFKDGEEIVPSPKYSIKADGLRRI 5412

Query: 218  LEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDS---ANRSFVRET-----KATNS 269
            L+I   +  D G Y C       KA+++ E  +  ++        FV ET     + +  
Sbjct: 5413 LKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEP 5472

Query: 270  DVR---KEVTNVISKESKLDSLEAAAKS----KNCSSPQRGGSPPWAANSQPQPPRESK- 321
            DV    K     ++     + +E   K      NC     G     AAN++     + K 
Sbjct: 5473 DVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKE 5532

Query: 322  LESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPAT 381
            L     +P +     V +K  +    + +R +P+      G    +G++R          
Sbjct: 5533 LPLIFITPLS--DVKVFEKDEAKFECEVSR-EPKTFRWLKGTQEITGDDR---------- 5579

Query: 382  FPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVM 441
            F   + G     V+  AA          D A   FE++       ++ + K   EG+ + 
Sbjct: 5580 FELIKDGTKHSMVIKSAA--------FEDEAKYMFEAE------DKHTSGKLIIEGIRLK 5625

Query: 442  EVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELHI 501
             + P     LKD    E +  V    +    + R+ W  N Q +   RS        + +
Sbjct: 5626 FLTP-----LKDVTAKEKESAVFTVELSHDNI-RVKWFKNDQRLHTTRS--------VSM 5671

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
            QD       T+  L+ +   Q+   A            SE  L V       P F   L 
Sbjct: 5672 QDEGKTHSITFKDLSIDDTSQIRVEA--------MGMSSEAKLTVLEGD---PYFTGKLQ 5720

Query: 562  DLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDT 621
            D   ++  +V +  ++S    P V W  +G EI+ S++   +  G +  L +++    D 
Sbjct: 5721 DYTGVEKDEVILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDI 5779

Query: 622  GTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFP 681
            G YTC+     G  +T   L +++     +   +    SV     ++      I+ D   
Sbjct: 5780 GQYTCD----CGTDKTSGKLDIED----REIKLVRPLHSVEVMETETARFETEISEDDI- 5830

Query: 682  TVHWLRDGKALCKDTGHFEVLQNEDVFTLVL 712
              +W   G+AL + T   E+ +   + +LVL
Sbjct: 5831 HANWKLKGEALLQ-TPDCEIKEEGKIHSLVL 5860



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/115 (27%), Positives = 50/115 (43%), Gaps = 3/115 (2%)

Query: 1259 VDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE--LATCR 1316
            +++P PP     +SD   SS+ L W     DGGS +  Y IE  +     W    +    
Sbjct: 6984 IERPSPPVNLT-SSDQTQSSVQLKWEPPLKDGGSPILGYIIERCEEGKDNWIRCNMKLVP 7042

Query: 1317 STSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD 1371
              ++ V  L   ++Y +RV A N  G S+PS+     T  +   EP  ++    D
Sbjct: 7043 ELTYKVTGLEKGNKYLYRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKD 7097



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 39/133 (29%), Positives = 61/133 (45%), Gaps = 7/133 (5%)

Query: 505   LPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPS-KPTAPIFLQGLSDL 563
             +P++  T T L E A  Q    A   V+    S  S+ +  +A +  P   + +   S L
Sbjct: 12941 IPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLL 13000

Query: 564   KVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFP---ED 620
              V  G+ V +   V G P P V W  +G  ++ +E     +   Q +LC  E+F    +D
Sbjct: 13001 TVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGI---KMAMQRNLCTLELFSVNRKD 13057

Query: 621   TGTYTCEAWNSAG 633
             +G YT  A NS+G
Sbjct: 13058 SGDYTITAENSSG 13070



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 25/82 (30%), Positives = 36/82 (43%)

Query: 171   VVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGV 230
             + KE    R    I G+P P V+W KG  PL    RVSV        L ++   + D G 
Sbjct: 13688 LAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGK 13747

Query: 231   YTCLVVNGSGKASMSAELSIQG 252
             YT  + N +G    +  + + G
Sbjct: 13748 YTITLKNVAGTKEGTISIKVVG 13769



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 30/95 (31%), Positives = 46/95 (48%), Gaps = 1/95 (1%)

Query: 29    LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
             LT  P+  LP     I+ G   K E  V G P P ++W ++G+P+    R  ++     T
Sbjct: 18003 LTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATST 18062

Query: 89    FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
               L I   +++D GKYT  ATN +G     + + V
Sbjct: 18063 V-LHIKEGNKDDFGKYTVTATNSAGTATENLSVIV 18096



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 1/119 (0%)

Query: 1662  NAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVV 1721
             NA    S    S   +    E  P +  +  +    L +  G + R    ++G P P V 
Sbjct: 21627 NAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVT 21686

Query: 1722  WFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             WFKD   I +  + +I  D  G+ SL + D   D    YT +A N+ G A    ++ V+
Sbjct: 21687 WFKDGVEIEKRMNMEIT-DVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 21744



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELA---TCRST 1318
             P PP G P         + + W     DGG+ + +Y ++  +  +  W  +        T
Sbjct: 22935 PSPP-GIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDT 22993

Query: 1319  SFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEP 1362
                V  L+   +Y+FRV A+N  G SEPS+ S   +  E    P
Sbjct: 22994 RLKVTSLMEGCDYQFRVTAVNAAGNSEPSEASNFISCREPSYTP 23037



 Score = 47.4 bits (111), Expect = 1e-04
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 4     VKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQ 63
             V +   S  S++   ++P     +P  E    +   + + I+ GA+ +    V G P P 
Sbjct: 23115 VNVKGMSEYSESIAEIEPVERIEIPDLELADDL--KKTVTIRAGASLRLMVSVSGRPPPV 23172

Query: 64    VTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
             +TW + G  + S  R ++D        L++  V+  D GKYT EA N SG +  TV + V
Sbjct: 23173 ITWSKQGIDLAS--RAIIDT-TESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKV 23229



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 70/343 (20%), Positives = 122/343 (35%), Gaps = 60/343 (17%)

Query: 919  KKKLPAENGSSSAETLNAKAVESSKPLSNAQPS--GPLKPVGNAKPAETLKPMGNAKPAE 976
            ++++ + +GS   E +    VES   +S  + S       V         K + +A  ++
Sbjct: 4333 QEEMDSFSGSQKVEPITEPEVESKYLISTEEVSYFNVQSRVKYLDATPVTKGVASAVVSD 4392

Query: 977  TLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQ 1036
              K   + KP E  + +S E   ++V   V  +    G    +         P     L 
Sbjct: 4393 E-KQDESLKPSEEKEESSSESGTEEVAT-VKIQEAEGGLIKED--------GPMIHTPLV 4442

Query: 1037 DVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPED- 1095
            D    EG  + L   +++     + W    K + + +     Q+ +  ++ I+K   ED 
Sbjct: 4443 DTVSEEGDIVHLTTSITN--AKEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDH 4500

Query: 1096 RGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKK 1155
            +G Y C A ND+G+   S ++TV                                    K
Sbjct: 4501 QGEYVCEALNDSGKTATSAKLTV-----------------------------------VK 4525

Query: 1156 KPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHM 1215
            + AP    K           E  +V  G   +   ++     +   W K  ++I ES+  
Sbjct: 4526 RAAPVIKRKI----------EPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKC 4575

Query: 1216 KVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
             + +S+  S L IL  +   CG YT    N+ GS      LTV
Sbjct: 4576 SIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTV 4618



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 100/477 (20%), Positives = 188/477 (39%), Gaps = 71/477 (14%)

Query: 683  VHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPW-HAGQYEILLKNRVGECSCQVSLM 741
            V+W  + K +  D   F+ LQ+++ +TLV+ KV    H G+Y     N  G+ +    L 
Sbjct: 4464 VNWYFENKLVPSDE-KFKCLQDQNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSAKLT 4522

Query: 742  LQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVR 801
            +   +A  + R  EP    ++  G +           ++R  W   G+  + E D   +R
Sbjct: 4523 VVKRAAPVIKRKIEPL---EVALGHLAKFTCEIQSAPNVRFQWFKAGRE-IYESDKCSIR 4578

Query: 802  G--------VLKRRV-ETRQHTEEAIRQQE----VEQLDFRDLLGKKVSTKTLSEDDLKE 848
                     +L+ +V +  ++T +A  +         L      G+K   K L E   K 
Sbjct: 4579 SSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPER--KP 4636

Query: 849  IPAEQMDFRANLQR---QVKPKTVSEEERKVHSP-----------QQVDFRSVLAKKGTS 894
             P E++  ++ L++   + +PK   ++  KV  P           ++V+  +V  ++   
Sbjct: 4637 EPKEEVVLKSVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRE--R 4694

Query: 895  KTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPL 954
            K P P KVP  KPA P           LPA       E   A+      P    +P+   
Sbjct: 4695 KIPEPTKVPEIKPAIP-----------LPAPEPKPKPE---AEVKTIKPPPVEPEPTPIA 4740

Query: 955  KPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAG 1014
             PV    P    K    A   E  KP G   P + +   +   ++ + +       G   
Sbjct: 4741 APV--TVPVVGKKAEAKAPKEEAAKPKG---PIKGVPKKTPSPIEAERRKLRPGSGGEKP 4795

Query: 1015 TTDNEKRSESQGTAPAFKQKLQDVHVAE----GKKLLLQCQVSSDPPATII--WTLNGKT 1068
              +     + +     F ++++D+ + E    G   + +C VS   P+T I  W  +G  
Sbjct: 4796 PDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVS---PSTAITTWMKDGSN 4852

Query: 1069 LKTT---KFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAP 1122
            ++ +   +FI   ++  L  + ++ +   D G Y CV +    +   + ++ V++ P
Sbjct: 4853 IRESPKHRFIADGKDRKLHIIDVQLS---DAGEYTCVLRLGNKEKTSTAKLVVEELP 4906



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 104/465 (22%), Positives = 165/465 (35%), Gaps = 67/465 (14%)

Query: 115  RQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKL-----GR 169
            RQ TV+   EG+  K     V +   G     P  ET+P    E     A +L     G 
Sbjct: 8754 RQYTVKEIREGADYKLRVSAVNAAGEG-----PPGETQPVTVAEPQEPPAVELDVSVKGG 8808

Query: 170  VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
            + +  G+  R    +TGRP P   W K    L    RV +        L I    + D G
Sbjct: 8809 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKD-RVVIDNVGTKSELIIKDALRKDHG 8867

Query: 230  VYTCLVVNGSGKASMSAE----------LSIQGLDSANRSFVRETKATNSDVRKEVTNVI 279
             Y     N  G    +A           L ++ + +  +  +        D   E+T  I
Sbjct: 8868 RYVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDDGGSEITGFI 8927

Query: 280  --SKESKLDS----LEAAAKSKNCSSPQRGGSPPWAANSQPQ----PPRESKLESCKD-- 327
               K++K+ +    +E      + +    G    +   ++ +    PP E       D  
Sbjct: 8928 IERKDAKMHTWRQPIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPL 8987

Query: 328  SPRTAPQT-PVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPP-----RPAT 381
             P T+P+     ++T S+ITL       EPR+ G   +     E++R   P         
Sbjct: 8988 GPPTSPERLTYTERTKSTITLD----WKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRL 9043

Query: 382  FPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVM 441
             PT    + + D   +    R+    +   + P        Q+ +   T+K R       
Sbjct: 9044 CPTTSFLVENLDE-HQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRL------ 9096

Query: 442  EVAPSFSSVLKDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEA------ 494
                   SV  D   ++ G+   +   V G P+P+I W  N   I+      +       
Sbjct: 9097 -------SVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVS 9149

Query: 495  ---GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKS 536
                  EL I  A+ ED GTYT  A N LG V  +  V V+++ S
Sbjct: 9150 RSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPS 9194



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 109/532 (20%), Positives = 188/532 (35%), Gaps = 89/532 (16%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             L I+ G      GR  G P+P+V+W ++   +    R  +      T +L        D 
Sbjct: 10523 LTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKT-TPATLALEKIKAKRSDS 10581

Query: 102   GKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPP 161
             GKY     N +G+R+   ++ V       +G     +   D      +  +P +      
Sbjct: 10582 GKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYM---VISWKPPL-----D 10633

Query: 162   KFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLK-GNVPLQPSARVSVSEKNGMQVLEI 220
                +K+   ++++ ++G+              W+   +   + + +VS   +    +  I
Sbjct: 10634 DGGSKITNYIIEKKEVGKD------------VWMPVTSASAKTTCKVSKLLEGKDYIFRI 10681

Query: 221   HGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNS--------DVR 272
             H  N    G+   LV +     SM A+   +  D+ ++  V E    ++        D  
Sbjct: 10682 HAENL--YGISDPLVSD-----SMKAKDRFRVPDAPDQPIVTEVTKDSALVTWNKPHDGG 10734

Query: 273   KEVTNVISKESKLDSLEAAAKSKN----------------CSSPQRGGSPPWAANSQPQP 316
             K +TN I ++ +  S   A  +K+                C    R  +        P P
Sbjct: 10735 KPITNYILEKRETMSKRWARVTKDPIHPYTKFRVPDLLEGCQYEFRVSAENEIGIGDPSP 10794

Query: 317   PRE---SKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGV-LSPSGEERK 372
             P +   +K    K SP   P+       S  +T Q  R     +  G  V     G+E  
Sbjct: 10795 PSKPVFAKDPIAKPSPPVNPEAIDTTCNSVDLTWQPPRHDGGSKILGYIVEYQKVGDEEW 10854

Query: 373   RPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKF---------ESKPQSQ 423
             R A   P + P                  +  + G RD    KF         ES P   
Sbjct: 10855 RRANHTPESCP----------------ETKYKVTGLRDGQTYKFRVLAVNAAGESDPA-- 10896

Query: 424   EVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ 483
              V E   VK R E   ++  A    ++ ++  +  G    L   ++G P P++TW    +
Sbjct: 10897 HVPEPVLVKDRLEPPELILDA----NMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDR 10952

Query: 484   PIQY-ARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEK 534
                  AR       ++L I++A  ED G Y+   EN  G  + S  V V +K
Sbjct: 10953 DAPTKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLVLDK 11004



 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 74/370 (20%), Positives = 134/370 (36%), Gaps = 58/370 (15%)

Query: 1042  EGKKLLLQCQVSS-DPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYK 1100
             EG  +   C++ + D    + W    + L+ ++   ++ E  +  + ++     D G Y+
Sbjct: 25276 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 25335

Query: 1101  CVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKK-KPAP 1159
             C   ND G+     ++ V         +  +   RR               T+KK K   
Sbjct: 25336 CKVVNDYGEDSSYAELFVKGV-----REVYDYYCRR---------------TMKKIKRRT 25375

Query: 1160  KTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMK--- 1216
              T      PP+      ++    GE+V     +T       TW K  ++I+  ++ K   
Sbjct: 25376 DTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYT 25435

Query: 1217  VENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPP----------- 1265
              E+ +   +LTI +   +    YT++  NK G    +  LTV   P P            
Sbjct: 25436 FESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRL 25495

Query: 1266  -------AGTPCASDIRSSSL---TLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC 1315
                     G     +IR S +   TL W     DG       +IEI       +      
Sbjct: 25496 LANAECQEGQSVCFEIRVSGIPPPTLKW---EKDGQPLSLGPNIEIIHEGLDYY------ 25546

Query: 1316  RSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKE 1375
                + +++D LP+    +RV A N  G++      ++  +  K +E K + E     +K+
Sbjct: 25547 ---ALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQ 25603

Query: 1376  PEVDYRTVTI 1385
              +   R   I
Sbjct: 25604 IDKTLRMAEI 25613



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 74/344 (21%), Positives = 131/344 (38%), Gaps = 46/344 (13%)

Query: 33   PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
            P F+   + +   +G  A FE  V G P P VTW +  + + +   + +     G+ + +
Sbjct: 3767 PHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFI 3826

Query: 93   IHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR--------F 144
            ++    ED G Y C+A N  G      EL V          P  +K+  +          
Sbjct: 3827 VNDPQREDSGLYICKAENMLGESTCAAELLVLLEDTDMTDTPCKAKSTPEAPEDFPQTPL 3886

Query: 145  SAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS 204
              PAVE   S       + AT +   ++K   +   + +++     +   L   +PL   
Sbjct: 3887 KGPAVEALDS-----EQEIATFVKDTILKAALITEENQQLSYEHIAKANELSSQLPLGAQ 3941

Query: 205  ARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGS----GKASMSAELSIQGLDSANRSF 260
               S+ E++ +          +    + C  +NGS         S  L +Q + S  ++F
Sbjct: 3942 ELQSILEQDKL--------TPESTREFLC--INGSIHFQPLKEPSPNLQLQIVQS-QKTF 3990

Query: 261  VR---------ETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAAN 311
             +         ET+A  SD  K   + +S E +++SL         + P+ G  P     
Sbjct: 3991 SKEGILMPEEPETQAVLSDTEKIFPSAMSIE-QINSLTVEPLKTLLAEPE-GNYP----Q 4044

Query: 312  SQPQPPRESKLESCKDSPRTAPQTPVLQKTS--SSITLQAARVQ 353
            S  +PP  S L S  +    +P+   +  T+    +TLQ    Q
Sbjct: 4045 SSIEPPMHSYLTSVAEEV-LSPKEKTVSDTNREQRVTLQKQEAQ 4087



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 37    LPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAV 96
             LP      KE +  + +  ++G P P V+W +   P+ +  R  ++     T +L+++  
Sbjct: 13682 LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNT-TLIVYDC 13740

Query: 97    HEEDRGKYTCEATNGSGARQVTVELTVEG 125
              + D GKYT    N +G ++ T+ + V G
Sbjct: 13741 QKSDAGKYTITLKNVAGTKEGTISIKVVG 13769



 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 34/121 (28%), Positives = 53/121 (43%), Gaps = 14/121 (11%)

Query: 1648  SGRKSSTGSPTSPLNAEKLESE----EDVSQAFLEAVAEEKPHVKPYFSKTIRDLE-VVE 1702
             S ++  +  P+ P      E++    E V    + A  +    +K   SK I  L  VVE
Sbjct: 26376 SPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVE 26435

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTC 1762
              S  R           EV W+KD + ++E+ HFQ  Y  DG   L I+++   D  +Y C
Sbjct: 26436 SSVLRAK---------EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVC 26486

Query: 1763  K 1763
             +
Sbjct: 26487 E 26487



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 25/85 (29%), Positives = 45/85 (52%), Gaps = 4/85 (4%)

Query: 1035 LQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPE 1094
            L+DV+V EG K +L+C+VS     ++ W LN + +K    +    +G+   + I +    
Sbjct: 2405 LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHAS 2464

Query: 1095 DRGLYKCVAKNDAGQAECSCQVTVD 1119
            D G YK +     G+ E +C ++V+
Sbjct: 2465 DEGPYKLI----VGRVETNCNLSVE 2485



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 1685 PHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGN 1744
            PHV+  F + + DL+V E   ARF+C++    + +V WFKD   I++ + + I   +   
Sbjct: 6067 PHVE--FLRPLTDLQVREKEMARFECEL-SRENAKVKWFKDGAEIKKGKKYDI-ISKGAV 6122

Query: 1745 CSLIISDVCGDDDAKYTCK 1763
              L+I+    DD+A+Y+C+
Sbjct: 6123 RILVINKCLLDDEAEYSCE 6141



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 28/97 (28%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 440   VMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARS---TCEAGV 496
             ++E  P +   L    +  G+   ++  V+G PVPR+TW  +G  I+   +   T   G 
Sbjct: 21652 IVEFGPEYFDGL---IIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGS 21708

Query: 497   AELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHE 533
               L ++DA  +  G YT  A+NA G       V V +
Sbjct: 21709 TSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQD 21745



 Score = 45.8 bits (107), Expect = 4e-04
 Identities = 88/439 (20%), Positives = 162/439 (36%), Gaps = 71/439 (16%)

Query: 263   ETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSPQ-----RGGSPPWAA------- 310
             E     S  ++EVT +   E + +  + A +  + S+ +     R  SP +         
Sbjct: 25924 EKSRKKSRRQREVTEITEIEEEYEISKHAQRESSSSASRLLRRRRSLSPTYIELMRPVSE 25983

Query: 311   --NSQPQPPRESKLESCKDSP---RTAPQTP--VLQKTSSSITLQAARVQPEPRAPGLGV 363
                S+PQP  E + ++ + SP   RT P++P  V  + S S   ++AR     R   +  
Sbjct: 25984 LIRSRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFERSARFDIFSRYESMKA 26043

Query: 364   L---SPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP 420
                   + E +      +P T         +  +  +  + R+P  GQ        +SKP
Sbjct: 26044 ALKTQKTSERKYEVLSQQPFTLDH------APRITLRMRSHRVPC-GQNTRFILNVQSKP 26096

Query: 421   QSQ--------EVKENQTVKF-RCEGLAVME--------------VAPSFSSVLKDCAVI 457
              ++        E++E+  + +    G+  +E              V  ++     D A +
Sbjct: 26097 TAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATL 26156

Query: 458   E--GQDFVLQCSVR-GTPVPRITWLLNGQPIQYARST------CEAGVAELHIQDALPED 508
             +  G D+    S R    VPR  +    +   YA S+       EA  +   ++  + E 
Sbjct: 26157 DVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTET 26216

Query: 509   HGTYTCLAENALGQVSCSAWV--TVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM 566
               + +    +A  ++  +A    ++ EK ++RK +  L        A   L     + V 
Sbjct: 26217 RESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTL--------AARILTKPRSMTVY 26268

Query: 567   DGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTC 626
             +G     +    G P P V WL  G  +  S          + +  I  V   D G Y+ 
Sbjct: 26269 EGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSV 26328

Query: 627   EAWNSAGEVRTQAVLTVQE 645
                NS G+   +  LT+Q+
Sbjct: 26329 VVENSEGKQEAEFTLTIQK 26347



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 8/98 (8%)

Query: 1683 EKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDED 1742
            E  H++  F K I+D++V+E   A F+C++   PD  V W KDDQ ++ +   +I  ++ 
Sbjct: 3008 EARHIE--FRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKY 3064

Query: 1743 GNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
             +  L+I      D  KYT  A    G    TA+L VE
Sbjct: 3065 VH-RLLIPSTRMSDAGKYTVVA----GGNVSTAKLFVE 3097



 Score = 45.4 bits (106), Expect = 5e-04
 Identities = 23/83 (27%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 565   VMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTY 624
             +  G  + + + V G P P + W+ +G  ++++   + E+  T   L I+E   +D G Y
Sbjct: 18018 IQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKY 18077

Query: 625   TCEAWNSAG-EVRTQAVLTVQEP 646
             T  A NSAG      +V+ +++P
Sbjct: 18078 TVTATNSAGTATENLSVIVLEKP 18100



 Score = 45.1 bits (105), Expect = 6e-04
 Identities = 57/219 (26%), Positives = 87/219 (39%), Gaps = 16/219 (7%)

Query: 1159  PKTPPKAAMPPQIIQFPED-QKVRAGESVELFGKVTGTQPITCTWM--KFRKQIQESEHM 1215
             P  PP A   P++     +   +R  E         G   I   W+  K R  I   +  
Sbjct: 22532 PFVPPSAPTRPEVYHVSANAMSIRWEEPYH-----DGGSKIIGYWVEKKERNTILWVKEN 22586

Query: 1216  KVENSENGSKLTILAARQEH-CGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDI 1274
             KV   E   K+T L    E+    Y L       + +A   +   +  D P G P  +D+
Sbjct: 22587 KVPCLECNYKVTGLVEGLEYQFRTYALNAAGVSKASEASRPIMAQNPVDAP-GRPEVTDV 22645

Query: 1275  RSSSLTLSWYGSSYDGGSAVQSYSIE---IWDSANKTWKE--LATCRSTSFNVQDLLPDH 1329
               S+++L W   +YDGGS V  Y IE   + +  +  W +          F V  L    
Sbjct: 22646 TRSTVSLIWSAPAYDGGSKVVGYIIERKPVSEVGDGRWLKCNYTIVSDNFFTVTALSEGD 22705

Query: 1330  EYKFRVRAINVYGT-SEPSQESELTTVGEKPEEPKDEVE 1367
              Y+FRV A N  G  S+ S+ +   T  ++   PK E++
Sbjct: 22706 TYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELD 22744



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 28/112 (25%), Positives = 46/112 (41%), Gaps = 4/112 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATC----RS 1317
             P  P G P   D+  S+++L W    +DGGS +  Y +E        W    T       
Sbjct: 12884 PVDPPGKPEVIDVTKSTVSLIWARPKHDGGSKIIGYFVEACKLPGDKWVRCNTAPHQIPQ 12943

Query: 1318  TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVS 1369
               +    L    +Y+FR  A      S PS+ S+  T+  +   P+ ++ V+
Sbjct: 12944 EEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVA 12995



 Score = 44.7 bits (104), Expect = 8e-04
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQN-EDVFTLVLKKVQPWHAGQYE 724
             G SV +   I+G P PT+ W +D K L   T     ++N  D+ ++++K     ++G YE
Sbjct: 20582 GTSVKLRAGISGKPAPTIEWYKDDKEL--QTNALVCVENTTDLASILIKDADRLNSGCYE 20639

Query: 725   ILLKNRVGECSCQVSLML 742
             + L+N +G  S  + + +
Sbjct: 20640 LKLRNAMGSASATIRVQI 20657



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 183/961 (19%), Positives = 338/961 (35%), Gaps = 154/961 (16%)

Query: 180  FSCKITGRPQPQVTWLKG--NVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVN 237
            F+C I  +  P + W KG   +P +P+ +  +        L+I     +D+  Y   +  
Sbjct: 5020 FACDIA-KDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEG 5078

Query: 238  GSGKASMS-AELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKN 296
                A ++  E  ++ L       + E ++ + D      + I  + KL   E    S  
Sbjct: 5079 KRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEAD-IPGQWKLKG-ELLRPSPT 5136

Query: 297  CSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEP 356
            C     GG      +          L    ++  TA  T    +   ++ L+   V    
Sbjct: 5137 CEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERR 5196

Query: 357  RAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQR------D 410
            +A    VL+          P                D++  +    I  +G++      D
Sbjct: 5197 QARFECVLTREANVIWSKGP----------------DIIKSSDKFDIIADGKKHILVIND 5240

Query: 411  SAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRG 470
            S F   +    + EV+  +T       L V  +   F S L+D  V EG+     C +  
Sbjct: 5241 SQFD--DEGVYTAEVEGKKT----SARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSH 5294

Query: 471  TPVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVT 530
              +  + W  N   +  +R+   +   + H  +           + E  L  +S      
Sbjct: 5295 EKM-HVVWFKNDAKLHTSRTVLISSEGKTHKLE-----------MKEVTLDDIS-QIKAQ 5341

Query: 531  VHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHN 590
            V E  S+ + + L          P F   L D   ++  ++T+  +VS + P  V W  +
Sbjct: 5342 VKELSSTAQLKVL-------EADPYFTVKLHDKTAVEKDEITLKCEVSKDVP--VKWFKD 5392

Query: 591  GNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWN--SAGEVRTQA-VLTVQEPH 647
            G EI  S  +  +  G +  L I++   +D G Y C+     +   V  +A ++ V++P 
Sbjct: 5393 GEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPL 5452

Query: 648  DGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVH--WLRDGKALCKDTGHFEVLQNE 705
             G +  F+ +       L +             P VH  W   G+ L       E++++ 
Sbjct: 5453 YGVEV-FVGETAHFEIELSE-------------PDVHGQWKLKGQPLTASPD-CEIIEDG 5497

Query: 706  DVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS-----LMLQNSSARALPR-------- 752
                L+L   Q    G+      N     + +V       +   S  +   +        
Sbjct: 5498 KKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECE 5557

Query: 753  -GREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETR 811
              REP +   L G     +  G DR+  ++ G   +    ++    ED    +    +  
Sbjct: 5558 VSREPKTFRWLKGT---QEITGDDRFELIKDG--TKHSMVIKSAAFEDEAKYMFEAED-- 5610

Query: 812  QHTE-----EAIRQQEVEQLDFRDLLGKK----VSTKTLSEDDLKEIPAEQMDFRANLQR 862
            +HT      E IR + +  L  +D+  K+    V T  LS D+++      + +  N QR
Sbjct: 5611 KHTSGKLIIEGIRLKFLTPL--KDVTAKEKESAVFTVELSHDNIR------VKWFKNDQR 5662

Query: 863  QVKPKTVS-EEERKVHSPQQVDFRSVLAKKGTSKTPVPEKVPPPKPATPDFRSVLGGKKK 921
                ++VS ++E K HS   + F+  L+   TS+  V                 +  + K
Sbjct: 5663 LHTTRSVSMQDEGKTHS---ITFKD-LSIDDTSQIRVEAMG-------------MSSEAK 5705

Query: 922  LPAENGSS--SAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLKPMGNAKPAETLK 979
            L    G    + +  +   VE  + +   + S    PV   K  + +KP  NA       
Sbjct: 5706 LTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAV------ 5759

Query: 980  PMGNAKPDENLKSASKEE---LKKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQ 1036
                      +K+  K+    LKK +K+D+       GT     + + +       + L 
Sbjct: 5760 ----------IKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLH 5809

Query: 1037 DVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDR 1096
             V V E +    + ++S D      W L G+ L  T    + +EG + S+ +     +  
Sbjct: 5810 SVEVMETETARFETEISED-DIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQT 5868

Query: 1097 G 1097
            G
Sbjct: 5869 G 5869



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 5/84 (5%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS--LVIHAVHEE 99
             L +K G T +F   +RG P P   W  +G  I +   + ++      FS  L I      
Sbjct: 11215 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE---TDNFSSVLTIKNCLRR 11271

Query: 100   DRGKYTCEATNGSGARQVTVELTV 123
             D G+Y    +N +G++ V V LTV
Sbjct: 11272 DTGEYQITVSNAAGSKTVAVHLTV 11295



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 33/123 (26%), Positives = 53/123 (43%), Gaps = 2/123 (1%)

Query: 532   HEKKSSRKSEYLLPV-APSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHN 590
             +EK  S   +  +PV A      P F    +   V+ G  + + V   G P P V W  +
Sbjct: 15820 NEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKD 15879

Query: 591   GNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE-VRTQAVLTVQEPHDG 649
                ++++   + E       L I++   ED G Y  +  NSAGE + T  V+ + +P   
Sbjct: 15880 NVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPP 15939

Query: 650   TQP 652
             T P
Sbjct: 15940 TGP 15942



 Score = 44.3 bits (103), Expect = 0.001
 Identities = 81/396 (20%), Positives = 141/396 (35%), Gaps = 56/396 (14%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             VV++     R    I GRP+P+V W K    L   A++ V+  +   +L I  V + D G
Sbjct: 18812 VVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQIEVT--SSFTMLVIDNVTRFDSG 18869

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSF---VRETKATN---------SDVRKEVTN 277
              Y   + N SG  S +A ++++ LDS +      +RE K  +          D   ++TN
Sbjct: 18870 RYNLTLENNSG--SKTAFVNVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITN 18927

Query: 278   VISKESKLDSLEAAAKSKNCSSP-------QRGGSPPWAANSQPQPPRESKLESCKDSPR 330
              I ++ +      A  + NC+         Q G S  +   +  +       E+ +    
Sbjct: 18928 YIVEKRETTRKAYATITNNCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKV 18987

Query: 331   TAPQTPVLQKTSSSITLQAARVQPE-------PRAPGLGVLSPSGEERKRPAPPRPATFP 383
             + P  P  + T   +T   A ++ E        +  G  V   +    K     +  T  
Sbjct: 18988 SEPPLPPGRVTLVDVTRNTATIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLE 19047

Query: 384   TRQPGL--GSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVM 441
                 GL  G + V   AA         R    P      +  E+K +  + F    +   
Sbjct: 19048 ATISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVI---ARDIEIKPSVELPFHTFNVKAR 19104

Query: 442   EVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ---YARSTCEAGVAE 498
             E                     +    +G P   + W  +GQ ++       +    V  
Sbjct: 19105 E------------------QLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTS 19146

Query: 499   LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEK 534
             L I++A  ED GTY     N+ G ++    + V ++
Sbjct: 19147 LSIKEASKEDVGTYELCVSNSAGSITVPITIIVLDR 19182



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 160   PPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
             PPK      ++ +K G+  R    + G+P P   W KG   +  S+ ++V + +   +L 
Sbjct: 12594 PPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILI 12652

Query: 220   IHGVNQDDVGVYTCLVVNGSG 240
             I  V + D G Y+    N SG
Sbjct: 12653 IKDVTRKDSGYYSLTAENSSG 12673



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 112/518 (21%), Positives = 191/518 (36%), Gaps = 68/518 (13%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLD-CGIRGTFSLVIHAVHEEDRG 102
             I+ G+    +  V G PEP++ W +  + +    +  L   G R T   VI      D G
Sbjct: 22754 IRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRAT--AVIKFCDRSDSG 22811

Query: 103   KYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDR----FSAPAVETRPSIWGE 158
             KYT    N SG + V+V + V  S     G+  VS+   ++    +S P  +    I   
Sbjct: 22812 KYTLTVKNASGTKAVSVMVKVLDS-PGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHY 22870

Query: 159   CPPKFATKLGRVVVKEGQMGRFSCKITGRPQP-----QVTWLKGNVPLQPSARVSVSEKN 213
                +  T     V+ EG+    S  +T   +      +V  +    P  P     +  +N
Sbjct: 22871 IVERRETSRLNWVIVEGECPTLSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVARN 22930

Query: 214   GMQVLEIHGVNQD-DVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNS--- 269
                +    G+ ++   G    ++     ++    E+S   +D   +  +R T+       
Sbjct: 22931 SFTIPSPPGIPEEVGTGKEHIIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVV 22990

Query: 270   -DVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKD- 327
              D R +VT+++               + C    R  +   A NS+P     S   SC++ 
Sbjct: 22991 YDTRLKVTSLM---------------EGCDYQFRVTAVNAAGNSEPS--EASNFISCREP 23033

Query: 328   ----SPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEER-------KRPAP 376
                  P +AP+  V+  T  SI+L   +   +     +G +    E+           A 
Sbjct: 23034 SYTPGPPSAPR--VVDTTKHSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNAT 23091

Query: 377   PRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCE 436
              R   F      +G +     AA   + ++G  +           S+ + E + V+ R E
Sbjct: 23092 IRNTEFTVPDLKMGQKYSFRVAA---VNVKGMSE----------YSESIAEIEPVE-RIE 23137

Query: 437   GLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGV 496
              +  +E+A     + K   +  G    L  SV G P P ITW   G  +           
Sbjct: 23138 -IPDLELA---DDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTES 23193

Query: 497   AELHIQDALPE-DHGTYTCLAENALGQVSCSAWVTVHE 533
               L I D +   D G YT  AEN  G+ S +  V V++
Sbjct: 23194 YSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYD 23231



 Score = 43.5 bits (101), Expect = 0.002
 Identities = 37/135 (27%), Positives = 57/135 (42%), Gaps = 23/135 (17%)

Query: 4    VKLVASSHISKTSLSVDP---SRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP 60
            VK V ++ +SK S +V P    R D  P  +   F+       ++EG       +++G P
Sbjct: 9786 VKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFME------VEEGTNVNIVAKIKGVP 9839

Query: 61   EPQVTWHR-------NGQPI---TSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATN 110
             P +TW +       N +P+   T   + ++D     T +LVI      D G YT  A N
Sbjct: 9840 FPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVD----DTCTLVIPQSRRSDTGLYTITAVN 9895

Query: 111  GSGARQVTVELTVEG 125
              G     + L V G
Sbjct: 9896 NLGTASKEMRLNVLG 9910



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 2/104 (1%)

Query: 1690 YFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLII 1749
            + +KT++++EV E   A F+C++  +  P  +W K+   I  S  F+I      +  LII
Sbjct: 2837 HITKTMKNIEVPETKTASFECEVSHFNVPS-MWLKNGVEIEMSEKFKIVVQGKLH-QLII 2894

Query: 1750 SDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEE 1793
             +   +D A+YT    N    AT T   I+ T    +   EE++
Sbjct: 2895 MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKD 2938



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 27/82 (32%), Positives = 39/82 (47%), Gaps = 8/82 (9%)

Query: 1698 LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDE-------DGNCSLIIS 1750
            +EV EG+      KI+G P P + WFK      +++   + YD        D  C+L+I 
Sbjct: 9821 MEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKE-PVLYDTHVNKLVVDDTCTLVIP 9879

Query: 1751 DVCGDDDAKYTCKAVNSLGEAT 1772
                 D   YT  AVN+LG A+
Sbjct: 9880 QSRRSDTGLYTITAVNNLGTAS 9901



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 7/118 (5%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             + V+ GQ  R   ++ GRP+P +TW K    L    RV + +      L+I    + D G
Sbjct: 11613 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 11672

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDS 287
              Y     N SG A  SA +++  LD       +  K TN  V KE    IS E+ LD+
Sbjct: 11673 KYIISAKNSSGHAQGSAIVNV--LDRPGP--CQNLKVTN--VTKE-NCTISWENPLDN 11723



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 1/102 (0%)

Query: 1678  EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQI 1737
             E V E K  + P        + +  G   R +  + G P P   W K +  +  S H  +
Sbjct: 12583 EGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAV 12642

Query: 1738  DYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              +  D +  LII DV   D   Y+  A NS G  T   +++V
Sbjct: 12643 -HKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVV 12683



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 36/121 (29%), Positives = 49/121 (40%), Gaps = 7/121 (5%)

Query: 1662  NAEKLESEEDVSQAFLEAVAEEKP---HVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDP 1718
             NA  + SE   S   + A  E  P    + P +  TI    V  G + + D  I G P P
Sbjct: 16212 NAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTI---VVHAGESFKVDADIYGKPIP 16268

Query: 1719  EVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELI 1778
              + W K DQ +  +   +I    D   SL + D    D   Y  KA N  GE + T  + 
Sbjct: 16269 TIQWIKGDQELSNTARLEIK-STDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVK 16327

Query: 1779  V 1779
             V
Sbjct: 16328 V 16328



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query: 1262  PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFN 1321
             P PP      S +   S+TL W     DGGS +  Y IE  +  +  W  +         
Sbjct: 19678 PSPPTSLEITS-VTKESMTLCWSRPESDGGSEISGYIIERREKNSLRWVRVNKKPVYDLR 19736

Query: 1322  VQD--LLPDHEYKFRVRAINVYGTSEPSQESEL 1352
             V+   L    EY++RV A N  G S PS+ S L
Sbjct: 19737 VKSTGLREGCEYEYRVYAENAAGLSLPSETSPL 19769



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 57/243 (23%), Positives = 94/243 (38%), Gaps = 58/243 (23%)

Query: 1025 QGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATII--WTLNGKTLKTT-KFIILSQEG 1081
            +G    F ++LQD+ V E     L+C VS   P  I   W  N   LK+  K+ I S+ G
Sbjct: 2217 EGAVVEFVKELQDIEVPESYSGELECIVS---PENIEGKWYHNDVELKSNGKYTITSRRG 2273

Query: 1082 SLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSL 1141
               +++++    ED+G Y  V                                       
Sbjct: 2274 RQ-NLTVKDVTKEDQGEYSFV--------------------------------------- 2293

Query: 1142 PPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCT 1201
              + G ++   +K KP P           I+Q   DQKV  G+ V+L  KV+  + +   
Sbjct: 2294 --IDGKKTTCKLKMKPRPIA---------ILQGLSDQKVCEGDIVQLEVKVS-LESVEGV 2341

Query: 1202 WMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
            WMK  +++Q S+ + +   +    L I    +E  G Y+  +     S   +V++  VD 
Sbjct: 2342 WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV 2401

Query: 1262 PDP 1264
              P
Sbjct: 2402 ITP 2404



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 10/98 (10%)

Query: 1691 FSKTIRDLEVVE----GSAARFDCKIEGYPDPEVV-WFKDDQSIRES-RHFQIDYDEDGN 1744
            F K I+D+ + E    GS+A F+C +   P   +  W KD  +IRES +H  I   +D  
Sbjct: 4812 FVKEIKDIILTESEFVGSSAIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKDRK 4869

Query: 1745 CSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETM 1782
              +I  DV   D  +YTC       E T TA+L+VE +
Sbjct: 4870 LHII--DVQLSDAGEYTCVLRLGNKEKTSTAKLVVEEL 4905



 Score = 42.7 bits (99), Expect = 0.003
 Identities = 33/143 (23%), Positives = 57/143 (39%), Gaps = 12/143 (8%)

Query: 117   VTVELTVEGSFAKQLGQ-PVVSKTLGDRFSAPAVETRPSIWGE--------CPPKFATKL 167
             +  + TV G    Q  +  V++K      S P+  T P    +          PKF    
Sbjct: 17271 IETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDT- 17329

Query: 168   GRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDD 227
               +VV  G+  R    + G+P P + WL+G+  ++ SAR  +   +   +L +    + D
Sbjct: 17330 --IVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRID 17387

Query: 228   VGVYTCLVVNGSGKASMSAELSI 250
              G Y     N +G  S    + +
Sbjct: 17388 GGQYILRASNVAGSKSFPVNVKV 17410



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 12/133 (9%)

Query: 990  LKSASKEELK-KDVKNDVNCKRGHAGTTDNEKRSESQGTAPA----------FKQKLQDV 1038
            +KS  K +++ K + + +N +  H G   +      + T+ A          F++ ++D+
Sbjct: 2962 IKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDI 3021

Query: 1039 HVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGL 1098
             V E K+ + +C+VS +P  T+ W  + + L+ T  I + +E  +  + I      D G 
Sbjct: 3022 KVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGK 3080

Query: 1099 YKCVAKNDAGQAE 1111
            Y  VA  +   A+
Sbjct: 3081 YTVVAGGNVSTAK 3093



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 21/72 (29%), Positives = 34/72 (47%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             ++++ G   R    + GRP P++TW K NV L+    + +   +    L    VN+ D G
Sbjct: 13398 LILRAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAG 13457

Query: 230   VYTCLVVNGSGK 241
              Y   + N  GK
Sbjct: 13458 KYILTLENSCGK 13469



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 2/77 (2%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G  + + + V G P P V W      +++++  +FE   T   L I E    D+G Y   
Sbjct: 14775 GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLT 14834

Query: 628   AWNSAGEVRTQAVLTVQ 644
             A N  GEV    V+T+Q
Sbjct: 14835 ARNIVGEVGD--VITIQ 14849



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 25/148 (16%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCEAG--VAELHIQDALPE 507
             KD  V+  G+ F +   + G P+P I W+   Q +   AR   ++      L ++DA+  
Sbjct: 16245 KDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRV 16304

Query: 508   DHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLK--- 564
             D G Y   A+N  G+ S    VTV+ K   R         P  P  P+ + G++  K   
Sbjct: 16305 DSGNYILKAKNVAGERS----VTVNVKVLDR---------PGPPEGPVVISGVTAEKCTL 16351

Query: 565   -----VMDGSQVTMTVQVSGNPPPEVIW 587
                  + DG    +   V       ++W
Sbjct: 16352 AWKPPLQDGGSDIINYIVERRETSRLVW 16379



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 5/95 (5%)

Query: 1684  KPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDG 1743
             +P VKP FS       V  G   + +  I G P P + W KD   ++++    +  D   
Sbjct: 16924 EPDVKPAFSS----YSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVT-DSLD 16978

Query: 1744  NCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELI 1778
               +L I +   DD  +Y     N +G+ T + E++
Sbjct: 16979 LTTLSIKETHKDDGGQYGITVANVVGQKTASIEIV 17013



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 23/96 (23%), Positives = 46/96 (47%), Gaps = 1/96 (1%)

Query: 667   QSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEIL 726
             + + I     G P  TV+W +DG+ L K+T    V  ++ V +L +K+      G YE+ 
Sbjct: 19105 EQLKIDVPFKGRPQATVNWRKDGQTL-KETTRVNVSSSKTVTSLSIKEASKEDVGTYELC 19163

Query: 727   LKNRVGECSCQVSLMLQNSSARALPRGREPASCEDL 762
             + N  G  +  +++++ +      P   +  SC+ +
Sbjct: 19164 VSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSI 19199



 Score = 42.4 bits (98), Expect = 0.004
 Identities = 34/130 (26%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 520   LGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLK----VMDGSQVTMTV 575
             +GQ        V+ K  S  SE +  + P +      L+   DLK    +  G+ + + V
Sbjct: 23104 MGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMV 23163

Query: 576   QVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEV 635
              VSG PPP + W   G  I  +     +   +   L + +V   D G YT EA N +G+ 
Sbjct: 23164 SVSGRPPPVITWSKQG--IDLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKK 23221

Query: 636   RTQAVLTVQE 645
                 ++ V +
Sbjct: 23222 SATVLVKVYD 23231



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 30/89 (33%), Positives = 47/89 (52%), Gaps = 7/89 (7%)

Query: 1031 FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNG-KTLKTTKFIILSQEGSLCSVSIE 1089
            F + L+D  V EG   +L+C+VS +  A + W  NG + LK+ K+ I++ +G +  + I 
Sbjct: 5982 FTKPLEDQTVEEGATAVLECEVSREN-AKVKWFKNGTEILKSKKYEIVA-DGRVRKLVIH 6039

Query: 1090 KALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
               PED   Y C    DA   + SC + V
Sbjct: 6040 DCTPEDIKTYTC----DAKDFKTSCNLNV 6064



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 49/222 (22%), Positives = 76/222 (34%), Gaps = 44/222 (19%)

Query: 29   LTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT 88
            L E   F     N+ + E  T K    V   P  +V W++  + I   GR+ +    R  
Sbjct: 6154 LEEEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRYEILTEGRKR 6212

Query: 89   FSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPA 148
              LVI   H ED G Y C   +     +V V                             
Sbjct: 6213 I-LVIQNAHLEDAGNYNCRLPSSRTDGKVKVH---------------------------- 6243

Query: 149  VETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVS 208
                     E   +F +K   + + EG+   F C I+    P V W + +  L+   +  
Sbjct: 6244 ---------ELAAEFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYD 6293

Query: 209  VSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
            V      +VL +      D+G Y  +V    G A  +A L++
Sbjct: 6294 VIADGKKRVLVVKDATLQDMGTYVVMV----GAARAAAHLTV 6331



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 26/93 (27%), Positives = 39/93 (41%)

Query: 551   PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHS 610
             P+  + ++ +  L V  G+ V     + G P P   W  +G+EI+  E +  E       
Sbjct: 11203 PSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV 11262

Query: 611   LCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTV 643
             L I+     DTG Y     N+AG       LTV
Sbjct: 11263 LTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTV 11295



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +T   G +V +   + G P PTV W +DG  L K     ++    ++ TL L  V    +
Sbjct: 13000 LTVKAGTNVCLDATVFGKPMPTVSWKKDG-TLLKPAEGIKMAMQRNLCTLELFSVNRKDS 13058

Query: 721   GQYEILLKNRVGECSCQVSL 740
             G Y I  +N  G  S  + L
Sbjct: 13059 GDYTITAENSSGSKSATIKL 13078



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 171   VVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGV 230
             VV+ G   R      GRP P   W K +  L  S R  +   +    L +   N++D G 
Sbjct: 22063 VVRAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNRNDAGK 22120

Query: 231   YTCLVVNGSGKASMSAELSI 250
             YT  V N SG  S++  + +
Sbjct: 22121 YTLTVENNSGSKSITFTVKV 22140



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 13/142 (9%)

Query: 512   YTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDL-KVMDGSQ 570
             +  LA+NA G +S  +  T      + + EY    AP K      L G  DL  +  GS 
Sbjct: 22709 FRVLAKNAAGVISKGSEST---GPVTCRDEY----APPKAELDARLHG--DLVTIRAGSD 22759

Query: 571   VTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWN 630
             + +   V G P P++IW     E+   E    +  G + +  I+     D+G YT    N
Sbjct: 22760 LVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKN 22819

Query: 631   SAGEVRTQAVLTVQEPHDGTQP 652
             ++G   T+AV  + +  D   P
Sbjct: 22820 ASG---TKAVSVMVKVLDSPGP 22838



 Score = 42.0 bits (97), Expect = 0.005
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 12/117 (10%)

Query: 139   TLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGN 198
             T  D ++ P  E    + G+           V ++ G        + G+P+P++ W KG+
Sbjct: 22731 TCRDEYAPPKAELDARLHGDL----------VTIRAGSDLVLDAAVGGKPEPKIIWTKGD 22780

Query: 199   VPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDS 255
               L    +VS+          I   ++ D G YT  V N SG  ++S  + +  LDS
Sbjct: 22781 KELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV--LDS 22835



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 29/108 (26%), Positives = 52/108 (48%), Gaps = 7/108 (6%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F+K + ++EV E    +  C++   P  EV+W+K D+ I E+  ++I   E     L+I 
Sbjct: 6160 FTKNLANIEVSETDTIKLVCEVSK-PGAEVIWYKGDEEIIETGRYEI-LTEGRKRILVIQ 6217

Query: 1751 DVCGDDDAKYTCKAVNSLGEATCTA-ELIVETMEEGEG----EGEEEE 1793
            +   +D   Y C+  +S  +      EL  E + + +     EGE+ E
Sbjct: 6218 NAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAE 6265



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 33/122 (27%), Positives = 52/122 (42%), Gaps = 12/122 (9%)

Query: 8     ASSHISKTSLSVDPSRVDSMPLTEAPAFILPPR---NLCIKEGATAKFEGRVRGYPEPQV 64
             A+  ISK S S  P  + +    E P   + P+    + +  G T + E  V G P P +
Sbjct: 17295 AAGAISKPSDSTGP--ITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTI 17352

Query: 65    TWHRNGQPITSGGRFLLDCGIRGT---FSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
              W R  + I    R    C I+ T     L++      D G+Y   A+N +G++   V +
Sbjct: 17353 EWLRGDKEIEESAR----CEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNV 17408

Query: 122   TV 123
              V
Sbjct: 17409 KV 17410



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 8/105 (7%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             ++VK G     +    GRP P V W K +  L+  A V  ++      L I   N++D G
Sbjct: 19891 LIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTTDSR--TSLTIENANRNDSG 19948

Query: 230   VYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKE 274
              YT  + N    AS++  L ++ LD+        T  T  DV KE
Sbjct: 19949 KYTLTIQNVLSAASLT--LVVKVLDTPG----PPTNITVQDVTKE 19987



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 34/133 (25%), Positives = 51/133 (38%), Gaps = 9/133 (6%)

Query: 105   TCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFA 164
             TCE        Q  +E  V     K L  PV   T+G       + T      + P    
Sbjct: 21212 TCEIEVSQLKEQSVLEFRVFAKNEKGLSDPV---TIGPITVKELIITPEVDLSDIPG--- 21265

Query: 165   TKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVN 224
                 +V V+ G          G+P+P ++WLK  +PL+ S  V  S+      L I    
Sbjct: 21266 ---AQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAK 21322

Query: 225   QDDVGVYTCLVVN 237
             ++  G YT ++ N
Sbjct: 21323 KEHGGKYTVILDN 21335



 Score = 41.6 bits (96), Expect = 0.007
 Identities = 27/98 (27%), Positives = 40/98 (40%), Gaps = 3/98 (3%)

Query: 1687  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSI--RESRHFQIDYDEDGN 1744
             + P       D+ + EG      C   G P PEV W    + I  +E   F I+ + D  
Sbjct: 27022 IPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIE-NTDDL 27080

Query: 1745  CSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETM 1782
              +LII DV   D   YT    N  G  + T  + + ++
Sbjct: 27081 TTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI 27118



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 24/96 (25%), Positives = 43/96 (44%)

Query: 158  ECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQV 217
            +C P    +   ++V EG+           P P V+W K    ++ S R+++   +    
Sbjct: 8079 DCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH 8138

Query: 218  LEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGL 253
            LE+    + D G+YT  + N  G A+ S  + + GL
Sbjct: 8139 LEVPKSVRADAGIYTITLENKLGSATASINVKVIGL 8174



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 3/90 (3%)

Query: 445  PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-RSTCEAG--VAELHI 501
            P+      D  VIEG+   +    R  PVP ++W  +G+ ++ + R T +     A L +
Sbjct: 8082 PTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEV 8141

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTV 531
              ++  D G YT   EN LG  + S  V V
Sbjct: 8142 PKSVRADAGIYTITLENKLGSATASINVKV 8171



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 25/87 (28%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

Query: 1693  KTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDV 1752
             K I  L V  G+  RF   I G P P   W  D   I+   H+ ++ D   +  L I + 
Sbjct: 11210 KLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSV-LTIKNC 11268

Query: 1753  CGDDDAKYTCKAVNSLGEATCTAELIV 1779
                D  +Y     N+ G  T    L V
Sbjct: 11269 LRRDTGEYQITVSNAAGSKTVAVHLTV 11295



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 23/80 (28%), Positives = 36/80 (45%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +    G++ ++   I G P P V W +DGK L +     E+       TLV+K       
Sbjct: 18412 IVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDG 18471

Query: 721   GQYEILLKNRVGECSCQVSL 740
             GQY + L N  G  S  +++
Sbjct: 18472 GQYILKLSNVGGTKSIPITV 18491



 Score = 41.2 bits (95), Expect = 0.009
 Identities = 26/85 (30%), Positives = 34/85 (40%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V +  G  L+L   V   P   IIWT   K L   + + L   G   +  I+     D G
Sbjct: 22752 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 22811

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAP 1122
              Y    KN +G    S  V V D+P
Sbjct: 22812 KYTLTVKNASGTKAVSVMVKVLDSP 22836



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 535  KSSRKSEYLLPVAPSK-PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNE 593
            K SR +E +  V   + P   + ++ L+ L V  G+++ +   V+G P P++ W      
Sbjct: 7366 KPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMI 7425

Query: 594  IQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTV 643
            +++ +    E    + ++ I +    DTGTY  EA N  G  R  AV+ V
Sbjct: 7426 LKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCG--RATAVVEV 7473



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 1693 KTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDV 1752
            K +  L V  G+       + G P+P++ W K D  +++ +   I+ +     ++ I D 
Sbjct: 7390 KLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIE-NVPKKSTVTIVDS 7448

Query: 1753 CGDDDAKYTCKAVNSLGEATCTAELIV 1779
               D   Y  +AVN  G AT   E+ V
Sbjct: 7449 KRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 2/85 (2%)

Query: 1262 PDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSF 1320
            P PP      + I  ++  L W     DGGS + +Y +E  D   K W+ +  T + T  
Sbjct: 7779 PSPPRWLEVIN-ITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKC 7837

Query: 1321 NVQDLLPDHEYKFRVRAINVYGTSE 1345
             V  L     Y FRV A N  G S+
Sbjct: 7838 TVTPLTEGSLYVFRVAAENAIGQSD 7862



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 24/91 (26%), Positives = 37/91 (40%), Gaps = 1/91 (1%)

Query: 33    PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
             P  IL P  + IK G   + E  V G P P   W +    + +     +      +  L+
Sbjct: 12594 PPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSI-LI 12652

Query: 93    IHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
             I  V  +D G Y+  A N SG     +++ V
Sbjct: 12653 IKDVTRKDSGYYSLTAENSSGTDTQKIKVVV 12683



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 20/81 (24%), Positives = 39/81 (48%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VV  G+  +    I G+P P + W+KG+  L  +AR+ +   +    L +    + D G
Sbjct: 16248 IVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSG 16307

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              Y     N +G+ S++  + +
Sbjct: 16308 NYILKAKNVAGERSVTVNVKV 16328



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             ++ G   K E  + G P+P +TW ++G P+    R  +   +  T +L I   H++D G+
Sbjct: 16936 VQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT-TLSIKETHKDDGGQ 16994

Query: 104   YTCEATNGSGARQVTVEL 121
             Y     N  G +  ++E+
Sbjct: 16995 YGITVANVVGQKTASIEI 17012



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 1/93 (1%)

Query: 1687  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
             ++P          +  G   + +  + G P P + W KD + ++++    ++ +   +  
Sbjct: 18005 IQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVE-ETATSTV 18063

Query: 1747  LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             L I +   DD  KYT  A NS G AT    +IV
Sbjct: 18064 LHIKEGNKDDFGKYTVTATNSAGTATENLSVIV 18096



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 23/74 (31%), Positives = 33/74 (44%)

Query: 570   QVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAW 629
             Q+ + V   G P   V W  +G  ++E+   +     T  SL I+E   ED GTY     
Sbjct: 19106 QLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVS 19165

Query: 630   NSAGEVRTQAVLTV 643
             NSAG +     + V
Sbjct: 19166 NSAGSITVPITIIV 19179



 Score = 40.8 bits (94), Expect = 0.012
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 14/111 (12%)

Query: 642   TVQEPHDGTQPWFISK----PRS---------VTASLGQSVLISCAIAGDPFPTVHWLRD 688
             +V EP + T P  +      PR          +    G+ + I+  IAG P P + W +D
Sbjct: 19462 SVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKD 19521

Query: 689   GKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVS 739
             G  + ++    E++  ++   L +K       GQY + LKN  G  S  V+
Sbjct: 19522 GIEI-EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVN 19571



 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F+K + D  V EG+ A  +C++    + +V WFK+   I +S+ ++I  D      L+I 
Sbjct: 5982 FTKPLEDQTVEEGATAVLECEV-SRENAKVKWFKNGTEILKSKKYEIVADGRVR-KLVIH 6039

Query: 1751 DVCGDDDAKYTCKA 1764
            D   +D   YTC A
Sbjct: 6040 DCTPEDIKTYTCDA 6053



 Score = 40.4 bits (93), Expect = 0.016
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             + ++ G T +   RV+G PEP +TW + G+ +    R  L   +     L I      D 
Sbjct: 11613 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDL-PRVELQIKEAVRADH 11671

Query: 102   GKYTCEATNGSGARQ 116
             GKY   A N SG  Q
Sbjct: 11672 GKYIISAKNSSGHAQ 11686



 Score = 40.4 bits (93), Expect = 0.016
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTC---EAGVAELHIQDALPEDHGTYTCL 515
             GQ   +   V+G P P ITW   G+ +   +      +    EL I++A+  DHG Y   
Sbjct: 11618 GQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIIS 11677

Query: 516   AENALGQVSCSAWVTVHEK 534
             A+N+ G    SA V V ++
Sbjct: 11678 AKNSSGHAQGSAIVNVLDR 11696



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 33/111 (29%), Positives = 52/111 (46%), Gaps = 10/111 (9%)

Query: 20    DPSRVDSMPLT----EAPAFILPP---RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQP 72
             DP+ V    L     E P  IL     R   IK G T +    ++G P P+VTW +  + 
Sbjct: 10894 DPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRD 10953

Query: 73    ITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
               +  R  +D    G+   + +A H ED G Y+    N +G++ V+V++ V
Sbjct: 10954 APTKAR--IDVTPVGSKLEIRNAAH-EDGGIYSLTVENPAGSKTVSVKVLV 11001



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 529   VTVHEKKSSRKSEYLLP-VAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIW 587
             V V+EK  S      +P VA      P      S   V  G  + + V +SG P P + W
Sbjct: 16899 VAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITW 16958

Query: 588   LHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE-VRTQAVLTVQEP 646
               +G  ++++   +        +L I+E   +D G Y     N  G+   +  ++T+ +P
Sbjct: 16959 TKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKP 17018



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQ--YARSTCEAGVAE--LHIQDALP 506
             KD  V+  G+ FVL+  +RG P+P + W  +G+ ++   AR   ++ + +  L ++D + 
Sbjct: 18409 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIR 18468

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
              D G Y     N  G  S    V V ++             P  P  P+ + G++
Sbjct: 18469 TDGGQYILKLSNVGGTKSIPITVKVLDR-------------PGPPEGPLKVTGVT 18510



 Score = 40.0 bits (92), Expect = 0.020
 Identities = 20/73 (27%), Positives = 29/73 (39%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G  V + +   G PPP V W  +   +     +  E   +   L I +V   DTG Y   
Sbjct: 20981 GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILT 21040

Query: 628   AWNSAGEVRTQAV 640
               N  GE ++  V
Sbjct: 21041 IENGVGEPKSSTV 21053



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 33/107 (30%), Positives = 46/107 (42%), Gaps = 11/107 (10%)

Query: 47   GATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT---FSLVIHAVHEEDRGK 103
            G  AKF   ++  P  +  W + G+ I    +    C IR +    SL I      D G+
Sbjct: 4543 GHLAKFTCEIQSAPNVRFQWFKAGREIYESDK----CSIRSSKYISSLEILRTQVVDCGE 4598

Query: 104  YTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVE 150
            YTC+A+N  G+   T  LTV        G+  V K L +R   P  E
Sbjct: 4599 YTCKASNEYGSVSCTATLTV----TVPGGEKKVRKLLPERKPEPKEE 4641



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 33/101 (32%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 1668 SEEDVSQAFLEAV---AEEKPHV---KPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVV 1721
            S +D SQ  +EA+   +E K  V    PYF+  ++D   VE       C+I    D  V 
Sbjct: 5686 SIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISK-ADAPVK 5744

Query: 1722 WFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTC 1762
            WFKD + I+ S++  I  D      LI+      D  +YTC
Sbjct: 5745 WFKDGKEIKPSKNAVIKADGKKR-MLILKKALKSDIGQYTC 5784



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 29/110 (26%), Positives = 45/110 (40%), Gaps = 8/110 (7%)

Query: 21   PSR----VDSMPLTEAPAFILPPR---NLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPI 73
            PSR    + ++   EAP   L  +    L +K G   +    V G PEP++TW +    +
Sbjct: 7367 PSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMIL 7426

Query: 74   TSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
                R  ++  +    ++ I      D G Y  EA N  G     VE+ V
Sbjct: 7427 KQDKRITIE-NVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 7475



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 23/81 (28%), Positives = 34/81 (41%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +VVK G   RF   I G P P   W      ++     +V   N   VL I    + D G
Sbjct: 11215 LVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTG 11274

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              Y   V N +G  +++  L++
Sbjct: 11275 EYQITVSNAAGSKTVAVHLTV 11295



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 34/124 (27%), Positives = 52/124 (41%), Gaps = 19/124 (15%)

Query: 446   SFSSVLKDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAG----VAELH 500
             S     +D  V+  G+ F L+  V G P+P I WL   + I+ + + CE       A L 
Sbjct: 17321 SMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEES-ARCEIKNTDFKALLI 17379

Query: 501   IQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGL 560
             ++DA+  D G Y   A N  G  S    V V ++             P  P  P+ + G+
Sbjct: 17380 VKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDR-------------PGPPEGPVQVTGV 17426

Query: 561   SDLK 564
             +  K
Sbjct: 17427 TSEK 17430



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 29/123 (23%), Positives = 52/123 (42%), Gaps = 6/123 (4%)

Query: 4     VKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPP---RNLCIKEGATAKFEGRVRGYP 60
             +++ A + +     +  P  V      EAP   L     + + ++ G +A+     +G P
Sbjct: 17688 IRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARIHIPFKGRP 17747

Query: 61    EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
              P++TW R     T   +  ++ G+  T  L I      D GKY  +  N SG++   V 
Sbjct: 17748 TPEITWSREEGEFTD--KVQIEKGVNYT-QLSIDNCDRNDAGKYILKLENSSGSKSAFVT 17804

Query: 121   LTV 123
             + V
Sbjct: 17805 VKV 17807



 Score = 39.7 bits (91), Expect = 0.027
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 2/85 (2%)

Query: 1038  VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRG 1097
             V +  G  L L   VS  PP  I W+  G  L +   I  ++  SL  + ++K    D G
Sbjct: 23151 VTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTESYSL--LIVDKVNRYDAG 23208

Query: 1098  LYKCVAKNDAGQAECSCQVTVDDAP 1122
              Y   A+N +G+   +  V V D P
Sbjct: 23209 KYTIEAENQSGKKSATVLVKVYDTP 23233



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 65/327 (19%), Positives = 119/327 (36%), Gaps = 37/327 (11%)

Query: 652 PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDT-GHFEVLQNEDVFTL 710
           P F    +SV    G +      I+G P P V W RDG+ +   T    ++  ++    L
Sbjct: 6   PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65

Query: 711 VLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGAD 770
            +  V   ++G+Y +   N  G+ +    L+++  +A        P   + L    +   
Sbjct: 66  TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA-------PPNFVQRL--QSMTVR 116

Query: 771 GGGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQH------TEEAIRQQEVE 824
            G   R      G P     +    DG +++  L  ++            E         
Sbjct: 117 QGSQVRLQVRVTGIPTPVVKFY--RDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174

Query: 825 QLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDF 884
            ++  + +G+  ST  L     +E+PA++     +   Q+     +  E+K+ +    D 
Sbjct: 175 SVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVS-TAQISESRQTRIEKKIEA--HFDA 231

Query: 885 RSV----LAKKGTSKTPVPEKVPPPKPATPDFRS----VLGGKKKLPAENGSSSAETLNA 936
           RS+    +   G +   +P K PP  P  P  RS     +  K +L  +   S       
Sbjct: 232 RSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIR---- 287

Query: 937 KAVESSKPLSNAQPSGPLKPVGNAKPA 963
               S  P+ + +   P  PV +  PA
Sbjct: 288 ---HSPSPVRHVRAPTP-SPVRSVSPA 310



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 27/102 (26%), Positives = 38/102 (37%), Gaps = 1/102 (0%)

Query: 1678 EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQI 1737
            E V  + P  KP       D+ V+EG            P P V W KD + ++ S    +
Sbjct: 8071 ENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTM 8130

Query: 1738 DYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              D   +  L +      D   YT    N LG AT +  + V
Sbjct: 8131 KNDHI-SAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 8171



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 34/126 (26%), Positives = 52/126 (41%), Gaps = 7/126 (5%)

Query: 449  SVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCE--AGVAELHIQDALP 506
            SV     ++ G+   +   V G PVP   W      +   R   +     +EL I+DAL 
Sbjct: 8804 SVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTKSELIIKDALR 8863

Query: 507  EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM 566
            +DHG Y   A N+ G    +A V V +         +L + P      + L   SD +  
Sbjct: 8864 KDHGRYVITATNSCGSKFAAARVEVFDVPGP-----VLDLKPVVTNRKMCLLNWSDPEDD 8918

Query: 567  DGSQVT 572
             GS++T
Sbjct: 8919 GGSEIT 8924



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

Query: 666  GQSVLISCAIAGDPFPTVHWLRDGKA--LCKDTGH-------FEVLQNEDVFTLVLKKVQ 716
            G  + I   I G P P   W  DGKA    KD  H        E  +N  V  +++ + +
Sbjct: 9520 GSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSV--IIIPECK 9577

Query: 717  PWHAGQYEILLKNRVGE--CSCQVSLM 741
              H G+Y I  KN+ G+   +C+V +M
Sbjct: 9578 RSHTGKYSITAKNKAGQKTANCRVKVM 9604



 Score = 39.3 bits (90), Expect = 0.035
 Identities = 34/144 (23%), Positives = 58/144 (40%), Gaps = 9/144 (6%)

Query: 599   DFHFEQRGT--QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS 656
             D HFE  G    H    + +     G ++ E   S G +  +    V  P     P +  
Sbjct: 16190 DTHFEVTGLVEDHRYEFRVIARNAAGVFS-EPSESTGAITARD--EVDPPRISMDPKYKD 16246

Query: 657   KPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQ 716
                ++    G+S  +   I G P PT+ W++  + L  +T   E+   +   +L +K   
Sbjct: 16247 ---TIVVHAGESFKVDADIYGKPIPTIQWIKGDQEL-SNTARLEIKSTDFATSLSVKDAV 16302

Query: 717   PWHAGQYEILLKNRVGECSCQVSL 740
                +G Y +  KN  GE S  V++
Sbjct: 16303 RVDSGNYILKAKNVAGERSVTVNV 16326



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 31/105 (29%), Positives = 47/105 (44%), Gaps = 3/105 (2%)

Query: 1681 AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD 1740
            A+E     P     ++D+ V  G  A+F C ++     +V W  +   I ES   ++   
Sbjct: 3481 AKESTGEAPKIFLHLQDVTVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESE--RLKQS 3538

Query: 1741 EDGNCS-LIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
            ++GN   L I +V   D   Y+C   N  GE T +A L VE   E
Sbjct: 3539 QNGNIQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPE 3583



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 56/243 (23%), Positives = 87/243 (35%), Gaps = 50/243 (20%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+V   A + I+   L+V    +D         F +P +++ + E   A+FE  +    E
Sbjct: 5159 GEVLYQALNAITTAILTVKEIELD---------FAVPLKDVTVPERRQARFECVLTR--E 5207

Query: 62   PQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
              V W +    I S  +F +    +    LVI+    +D G YT E              
Sbjct: 5208 ANVIWSKGPDIIKSSDKFDIIADGKKHI-LVINDSQFDDEGVYTAE-------------- 5252

Query: 122  TVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFS 181
             VEG            K    R     +            KF + L    VKEG+   F 
Sbjct: 5253 -VEG------------KKTSARLFVTGIRL----------KFMSPLEDQTVKEGETATFV 5289

Query: 182  CKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGK 241
            C+++   +  V W K +  L  S  V +S +     LE+  V  DD+      V   S  
Sbjct: 5290 CELS-HEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSST 5348

Query: 242  ASM 244
            A +
Sbjct: 5349 AQL 5351



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 30/91 (32%), Positives = 42/91 (46%), Gaps = 6/91 (6%)

Query: 163  FATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHG 222
            FA  L  V V E +  RF C +T   +  V W KG   ++ S +  +       +L I+ 
Sbjct: 5183 FAVPLKDVTVPERRQARFECVLTR--EANVIWSKGPDIIKSSDKFDIIADGKKHILVIND 5240

Query: 223  VNQDDVGVYTCLVVNGSGKASMSAELSIQGL 253
               DD GVYT  V    GK + SA L + G+
Sbjct: 5241 SQFDDEGVYTAEV---EGKKT-SARLFVTGI 5267



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 21/81 (25%), Positives = 35/81 (43%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             + V  G  + +  +V G P P++ W   G  +   +     Q   +  L I+E    D G
Sbjct: 11613 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 11672

Query: 623   TYTCEAWNSAGEVRTQAVLTV 643
              Y   A NS+G  +  A++ V
Sbjct: 11673 KYIISAKNSSGHAQGSAIVNV 11693



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 1/124 (0%)

Query: 628   AWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLR 687
             A N+ G    +    V E  +   P  I  P  +T   G+ + I   + G P PT  W +
Sbjct: 12570 ARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKW-K 12628

Query: 688   DGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSA 747
              G+     + H  V + +    L++K V    +G Y +  +N  G  + ++ +++ ++  
Sbjct: 12629 KGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPG 12688

Query: 748   RALP 751
                P
Sbjct: 12689 PPQP 12692



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 29/103 (28%), Positives = 45/103 (43%), Gaps = 10/103 (9%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             SV A  G+ V +     G P PTV W +D K L  D   + +   +    L + +V    
Sbjct: 20975 SVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSD-ARYSIENTDSSSLLTIPQVTRND 21033

Query: 720   AGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDL 762
              G+Y + ++N VGE           SS  ++     PA+C+ L
Sbjct: 21034 TGKYILTIENGVGE---------PKSSTVSVKVLDTPAACQKL 21067



 Score = 38.9 bits (89), Expect = 0.045
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPI---QYARSTCEAGVAELHIQDALPEDHGTYTCL 515
             G +  L+   +G P P I+WL +G P+   ++ R +       L I++A  E  G YT +
Sbjct: 21273 GHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVI 21332

Query: 516   AENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPI 555
              +NA+ +++    V             L P  PSKP  PI
Sbjct: 21333 LDNAVCRIAVPITVIT-----------LGP--PSKPKGPI 21359



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 32/114 (28%), Positives = 49/114 (42%), Gaps = 3/114 (2%)

Query: 1146 GTESDAT-VKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
            G E+  T   + PAP   P    PP ++   ++  V  GESV L   ++G    T TW +
Sbjct: 875  GREAKVTETARVPAPVEIP--VTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYR 932

Query: 1205 FRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTV 1258
               QI+ S   ++      ++L I  A  E  G +T    N+ G+      L V
Sbjct: 933  EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 986



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 5/93 (5%)

Query: 545  PVAPSKPTAP----IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF 600
            PV  ++P  P    + +     +++M G  + +   V+G P P  +W     E+ + +  
Sbjct: 8787 PVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGEL-DKDRV 8845

Query: 601  HFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAG 633
              +  GT+  L I++   +D G Y   A NS G
Sbjct: 8846 VIDNVGTKSELIIKDALRKDHGRYVITATNSCG 8878



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTW--HRNGQPITSGGRFLLDCGIRGT-FSLVIHAVHE 98
             L +K G T + E  VRG P P+V W   ++   +T   R  +D     + FSL       
Sbjct: 11906 LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLT--KAKR 11963

Query: 99    EDRGKYTCEATNGSGA 114
              D GKY   ATN +G+
Sbjct: 11964 SDGGKYVVTATNTAGS 11979



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 33/131 (25%), Positives = 47/131 (35%), Gaps = 11/131 (8%)

Query: 33    PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
             PAF L      +  G   K +    G P P VTWH++  P+    R   +        L 
Sbjct: 15843 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAE-STENNSLLT 15901

Query: 93    IHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETR 152
             I     ED G Y  + TN +G    T+ + V        G   + +   D  +       
Sbjct: 15902 IKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLS----- 15956

Query: 153   PSIWGECPPKF 163
                WG  PPK+
Sbjct: 15957 ---WG--PPKY 15962



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

Query: 1696  RDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
             RD  VV  G   R +  + G P P + W + D+ I ES   +I  + D    LI+ D   
Sbjct: 17327 RDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDAIR 17385

Query: 1755  DDDAKYTCKAVNSLG 1769
              D  +Y  +A N  G
Sbjct: 17386 IDGGQYILRASNVAG 17400



 Score = 38.5 bits (88), Expect = 0.059
 Identities = 22/83 (26%), Positives = 37/83 (44%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             +  K G        I+GRP P+VTW    + L+ + RVS++       L +    + D G
Sbjct: 22352 ITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSG 22411

Query: 230   VYTCLVVNGSGKASMSAELSIQG 252
              Y   + N +G  + S  + + G
Sbjct: 22412 RYFLTLENTAGVKTFSVTVVVIG 22434



 Score = 38.1 bits (87), Expect = 0.078
 Identities = 58/270 (21%), Positives = 103/270 (38%), Gaps = 43/270 (15%)

Query: 472  PVPRITWL-LNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVT 530
            PV    W+ +N +PI+  +   E GV        +P+        A NA+G         
Sbjct: 8020 PVGTEKWMRVNSRPIKDLKFKVEEGV--------VPDKEYVLRVRAVNAIGV-------- 8063

Query: 531  VHEKKSSRKSEYLLPVAPS-KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLH 589
                + S  SE ++   P  KPT  +      D+ V++G ++++ V     P P V W  
Sbjct: 8064 ---SEPSEISENVVAKDPDCKPTIDLETH---DIIVIEGEKLSIPVPFRAVPVPTVSWHK 8117

Query: 590  NGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQA-VLTVQEPHD 648
            +G E++ S+    +       L + +    D G YT    N  G       V  +  P  
Sbjct: 8118 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLP-- 8175

Query: 649  GTQPWFISKPRSVTASLGQSVLISCAIAGDP------FPTVHWLRDGKALCKDTGHFEVL 702
               P    K   +T S       SC +  +P       P +H++ + +   + T +  V+
Sbjct: 8176 --GPCKDIKASDITKS-------SCKLTWEPPEFDGGTPILHYVLERREAGRRT-YIPVM 8225

Query: 703  QNEDVFTLVLKKVQPWHAGQYEILLKNRVG 732
              E+  +  +K + P     + +   N+VG
Sbjct: 8226 SGENKLSWTVKDLIPNGEYFFRVKAVNKVG 8255



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 7/92 (7%)

Query: 551  PTAPIFLQGLSD-LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF------HFE 603
            PT  + L    D +KV  G  V +   V+G P P++ W  N   I++  D          
Sbjct: 9090 PTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVS 9149

Query: 604  QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEV 635
            +   +  L I +   ED GTYT  A N  G V
Sbjct: 9150 RSEAKTELSIPKAVREDKGTYTVTASNRLGSV 9181



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 20/73 (27%), Positives = 33/73 (45%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V++K G+  R    ++GRP P + W K    L+ +A++ +   +    L      + D G
Sbjct: 15166 VILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSG 15225

Query: 230   VYTCLVVNGSGKA 242
              YT    N  G A
Sbjct: 15226 AYTLTATNPGGFA 15238



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 25/97 (25%), Positives = 46/97 (47%), Gaps = 5/97 (5%)

Query: 31    EAPAFILPPRN---LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPI-TSGGRFLLDCGIR 86
             +AP   L P+    + +  G T   E  +RG P P V W ++G+ +  +  R  +   I+
Sbjct: 18398 DAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQ 18457

Query: 87    GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
              T +LV+      D G+Y  + +N  G + + + + V
Sbjct: 18458 KT-TLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKV 18493



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 13/99 (13%)

Query: 548   PSKPTAPIFLQG-------LSDLKVMD------GSQVTMTVQVSGNPPPEVIWLHNGNEI 594
             PS+ T PI ++        + D+K  D      G  + +   ++G P P + W  +G EI
Sbjct: 19466 PSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEI 19525

Query: 595   QESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAG 633
             +E              L +++    DTG Y     N AG
Sbjct: 19526 EERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAG 19564



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 8/72 (11%)

Query: 562   DLKVMDGSQVTMTV--------QVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCI 613
             DL  + G+QVT+ +           G P P + WL +G  ++ESE   F +   + +L I
Sbjct: 21259 DLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSI 21318

Query: 614   QEVFPEDTGTYT 625
             +    E  G YT
Sbjct: 21319 KNAKKEHGGKYT 21330



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 20/83 (24%), Positives = 38/83 (45%)

Query: 1040  VAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLY 1099
             +  G+ L ++  V   P   + W  +G  ++    + ++      S+ +  A  + RG+Y
Sbjct: 21665 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 21724

Query: 1100  KCVAKNDAGQAECSCQVTVDDAP 1122
                AKN +G A+   +V V D P
Sbjct: 21725 TVEAKNASGSAKAEIKVKVQDTP 21747



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 43/188 (22%), Positives = 76/188 (40%), Gaps = 8/188 (4%)

Query: 595   QESEDFHFEQRGT-QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLT---VQEPH-DG 649
             Q+  DF  E   T Q +  ++ +  +    +  +A N AG    +   +   ++EP  + 
Sbjct: 22281 QKGSDFWVEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEP 22340

Query: 650   TQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFT 709
             T        + +T   G    I   I+G P P V W  +   L K+T    +   +D  T
Sbjct: 22341 TADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRL-KETDRVSITTTKDRTT 22399

Query: 710   LVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARAL-PRGREPASCED-LCGGGV 767
             L +K      +G+Y + L+N  G  +  V++++         P      S E  +   G 
Sbjct: 22400 LTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSVSAESCVLSWGE 22459

Query: 768   GADGGGSD 775
               DGGG++
Sbjct: 22460 PKDGGGTE 22467



 Score = 37.7 bits (86), Expect = 0.10
 Identities = 27/105 (25%), Positives = 50/105 (47%), Gaps = 5/105 (4%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             GS  T+ V +SG P P+V W      ++E++         + +L +++    D+G Y   
Sbjct: 22357 GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLT 22416

Query: 628   AWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLIS 672
               N+AG V+T +V  V     G     ++ P  V++   +S ++S
Sbjct: 22417 LENTAG-VKTFSVTVVVIGRPGP----VTGPIEVSSVSAESCVLS 22456



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 24/83 (28%), Positives = 36/83 (43%), Gaps = 4/83 (4%)

Query: 1698 LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS-LIISDVCGDD 1756
            ++++ G   R    + G P P  VW K++  + + R   +  D  G  S LII D    D
Sbjct: 8809 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDR---VVIDNVGTKSELIIKDALRKD 8865

Query: 1757 DAKYTCKAVNSLGEATCTAELIV 1779
              +Y   A NS G     A + V
Sbjct: 8866 HGRYVITATNSCGSKFAAARVEV 8888



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 32/123 (26%), Positives = 49/123 (39%), Gaps = 6/123 (4%)

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
            +  +A N+AG  +  A +   +      P  I     +    G +V I   I G PFPT+
Sbjct: 9784 FRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPTL 9843

Query: 684  HWLR------DGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQ 737
             W +      D K       H   L  +D  TLV+ + +    G Y I   N +G  S +
Sbjct: 9844 TWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKE 9903

Query: 738  VSL 740
            + L
Sbjct: 9904 MRL 9906



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +T  +GQ++ I   + G P P + W ++GK L ++    +++Q+     L +K+      
Sbjct: 11613 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK-RVDLIQDLPRVELQIKEAVRADH 11671

Query: 721   GQYEILLKNRVG 732
             G+Y I  KN  G
Sbjct: 11672 GKYIISAKNSSG 11683



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 3/79 (3%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNG---QPIQYARSTCEAGVAELHIQDALPEDHGTYTCL 515
             G +  L  +V G P+P ++W  +G   +P +  +   +  +  L +     +D G YT  
Sbjct: 13005 GTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTIT 13064

Query: 516   AENALGQVSCSAWVTVHEK 534
             AEN+ G  S +  + V +K
Sbjct: 13065 AENSSGSKSATIKLKVLDK 13083



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 9/125 (7%)

Query: 19    VDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGR 78
             VDP R+   P  +          + +  G + K +  + G P P + W +  Q +++  R
Sbjct: 16233 VDPPRISMDPKYKD--------TIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTAR 16284

Query: 79    FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSK 138
               +      T SL +      D G Y  +A N +G R VTV + V        G  V+S 
Sbjct: 16285 LEIKSTDFAT-SLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISG 16343

Query: 139   TLGDR 143
                ++
Sbjct: 16344 VTAEK 16348



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 9/116 (7%)

Query: 1671  DVSQAFLEAVAEEKPHVKPYF---SKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQ 1727
             D S +    +A+E+   +P F   S+  + L V  G++        G P P V+W K D 
Sbjct: 19862 DPSDSSDPQIAKEREE-EPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDT 19920

Query: 1728  SIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETME 1783
              +R   +       D   SL I +   +D  KYT    N L  A+ T  L+V+ ++
Sbjct: 19921 DLRTRAYVD---TTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLT--LVVKVLD 19971



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 1/100 (1%)

Query: 38    PPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVH 97
             P   + ++ G+  K +  + G P P+VT  R+G P+ +  RF  +       ++ +    
Sbjct: 20177 PSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE-NLTINLKESV 20235

Query: 98    EEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVS 137
               D G+Y   A N SG  +  + + V        G  V+S
Sbjct: 20236 TADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVIS 20275



 Score = 37.4 bits (85), Expect = 0.13
 Identities = 20/85 (23%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G+S+ I   + G P P V W +DG  + K   + E+       +L ++     H G Y +
Sbjct: 21668 GESLRIKALVQGRPVPRVTWFKDGVEIEKRM-NMEITDVLGSTSLFVRDATRDHRGVYTV 21726

Query: 726   LLKNRVGECSCQVSLMLQNSSARAL 750
               KN  G    ++ + +Q++  + +
Sbjct: 21727 EAKNASGSAKAEIKVKVQDTPGKVV 21751



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 87/433 (20%), Positives = 147/433 (33%), Gaps = 79/433 (18%)

Query: 1009 KRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKT 1068
            +  H G        + +   P      + V V EG+    +C+V+  P   + W LNG+ 
Sbjct: 1775 RMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQL 1834

Query: 1069 LKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAP--ASEN 1126
            ++ +K   +  +G +  + I      D G  K  A+N  G  E   ++ +       S  
Sbjct: 1835 IRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVL 1893

Query: 1127 TKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESV 1186
             +APE    RP+  +      + +     +P   T  K  +  +  +    +KV   ES 
Sbjct: 1894 RRAPE---PRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKV-PEESE 1949

Query: 1187 ELFGKVTGT------QPITCTWMKFRKQIQESEHM-------------------KVENSE 1221
            EL  K          + IT   +K RK+ +  E +                   K   +E
Sbjct: 1950 ELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAE 2009

Query: 1222 NGSKLTI---------LAARQEHCGCYTLLVENKLG-SRQAQVNLTVVDKPDPPAGTPCA 1271
             G K+TI         L+   E    +  +    +G    A   + VV KPDP       
Sbjct: 2010 EG-KITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPEC----- 2063

Query: 1272 SDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQDLLPDHEY 1331
                       WY +            IE  D     W E   C      ++D+  +   
Sbjct: 2064 ----------EWYKN---------GVKIERSDRIYWYWPEDNVCELV---IRDVTAEDSA 2101

Query: 1332 KFRVRAINVYGTSEPS-----QESELTTVGEKPEE----PKDEVEVSDDDEKEPEVDYRT 1382
               V+AIN+ G +        Q  +L T  ++ ++     KD +   + +  EP V  + 
Sbjct: 2102 SIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKW 2161

Query: 1383 VTINTEQKVSDFY 1395
                 E    D Y
Sbjct: 2162 YKDGMEVHEGDKY 2174



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 2/76 (2%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G  + +   VSG PPP V W  N NE    ++   E      S+ I+       G Y+  
Sbjct: 10234 GGVIRIIAYVSGKPPPTVTW--NMNERTLPQEATIETTAISSSMVIKNCQRSHQGVYSLL 10291

Query: 628   AWNSAGEVRTQAVLTV 643
             A N AGE +   ++ V
Sbjct: 10292 AKNEAGERKKTIIVDV 10307



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 6/85 (7%)

Query: 1694  TIRDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQ-SIRESRHFQIDYDED-GNCSLIIS 1750
             T RD+  V  G   R   +++G P+P++ W K+ +  +RE R   +D  +D     L I 
Sbjct: 11608 TCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKR---VDLIQDLPRVELQIK 11664

Query: 1751  DVCGDDDAKYTCKAVNSLGEATCTA 1775
             +    D  KY   A NS G A  +A
Sbjct: 11665 EAVRADHGKYIISAKNSSGHAQGSA 11689



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 29/107 (27%), Positives = 43/107 (40%), Gaps = 7/107 (6%)

Query: 1680  VAEEKPHVKPYFSKTIRDLE------VVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESR 1733
             V  E+  VK    K + DL+      V  G   R +  + G P PEV W KD  +   +R
Sbjct: 11882 VKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTR 11941

Query: 1734  HFQIDYDEDGNCS-LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
               ++  D   + S   ++     D  KY   A N+ G     A + V
Sbjct: 11942 SPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 11988



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 22/92 (23%), Positives = 40/92 (43%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             + +  G ++ +   V G P P   W    +E+  S      +  +   L I++V  +D+G
Sbjct: 12603 ITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSG 12662

Query: 623   TYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWF 654
              Y+  A NS+G    +  + V +     QP F
Sbjct: 12663 YYSLTAENSSGTDTQKIKVVVMDAPGPPQPPF 12694



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 3/72 (4%)

Query: 1698  LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
             + +  G + R    I+G P PEV W K D  IR++    +        SL++ +V   D 
Sbjct: 16647 INIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDV---TSSFTSLVLDNVNRYDS 16703

Query: 1758  AKYTCKAVNSLG 1769
              KYT    NS G
Sbjct: 16704 GKYTLTLENSSG 16715



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 1689  PYFSKTIRDLEVVE---GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNC 1745
             P     +   EVV+   G++ +    I G P P + W+KDD+ ++ +    ++   D   
Sbjct: 20565 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTD-LA 20623

Query: 1746  SLIISDVCGDDDAKYTCKAVNSLGEATCT 1774
             S++I D    +   Y  K  N++G A+ T
Sbjct: 20624 SILIKDADRLNSGCYELKLRNAMGSASAT 20652



 Score = 37.0 bits (84), Expect = 0.17
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V  + G   +    I+G+P P + W K +  LQ +A V V     +  + I   ++ + G
Sbjct: 20577 VKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSG 20636

Query: 230   VYTCLVVNGSGKASMSAELSIQGLD 254
              Y   + N  G A  SA + +Q LD
Sbjct: 20637 CYELKLRNAMGSA--SATIRVQILD 20659



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 28/108 (25%), Positives = 42/108 (38%), Gaps = 3/108 (2%)

Query: 143  RFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQ 202
            RF A   E R  +     PK  T    +VV  G+           P+ +  W K N PL 
Sbjct: 6677 RFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLS 6736

Query: 203  PSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSI 250
                 + +E+   ++LE     + D G Y  ++ N  GKA     L +
Sbjct: 6737 TKTIDTTAEQTSFRILE---AKKGDKGRYKIVLQNKHGKAEGFINLKV 6781



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 172  VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSV---SEKNGMQV-----LEIHGV 223
            V+EG       KI G P P +TW K   P +P  +  V   +  N + V     L I   
Sbjct: 9823 VEEGTNVNIVAKIKGVPFPTLTWFKAP-PKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQS 9881

Query: 224  NQDDVGVYTCLVVNGSGKASMSAELSIQG 252
             + D G+YT   VN  G AS    L++ G
Sbjct: 9882 RRSDTGLYTITAVNNLGTASKEMRLNVLG 9910



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 1/81 (1%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V+V+ G   R    + GRP P+VTW K  +      +  V   + M  L I    +DD G
Sbjct: 12311 VIVRAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRKGQVDLVDTMAFLVIPNSTRDDSG 12369

Query: 230   VYTCLVVNGSGKASMSAELSI 250
              Y+  +VN +G+ ++   + +
Sbjct: 12370 KYSLTLVNPAGEKAVFVNVRV 12390



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 37/151 (24%), Positives = 56/151 (37%), Gaps = 10/151 (6%)

Query: 516   AENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMT- 574
             A+N  G +S  +  T   +    K EY  P     PT          L +  G  + +  
Sbjct: 14045 AKNTAGAISAPSEST---ETIICKDEYEAPTIVLDPTIK------DGLTIKAGDTIVLNA 14095

Query: 575   VQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE 634
             + + G P P+  W   G +I+ S+        T   L I+    +D G YT  A N  G 
Sbjct: 14096 ISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGT 14155

Query: 635   VRTQAVLTVQEPHDGTQPWFISKPRSVTASL 665
                   +TV +      P  IS   +  A+L
Sbjct: 14156 KVEHVKVTVLDVPGPPGPVEISNVSAEKATL 14186



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 18/66 (27%), Positives = 29/66 (43%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G    +   VSG PPP + W  +G E++ +     +      +L  ++    D+G YT  
Sbjct: 15171 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 15230

Query: 628   AWNSAG 633
             A N  G
Sbjct: 15231 ATNPGG 15236



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 24/93 (25%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 565   VMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTY 624
             V  GS + + + +SG P P+V    +G  ++ +  F+ E      ++ ++E    D G Y
Sbjct: 20183 VRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRY 20242

Query: 625   TCEAWNSAGEVRTQA-VLTVQEPHDGTQPWFIS 656
                A NS+G  +    ++ +  P   T P  IS
Sbjct: 20243 EITAANSSGTTKAFINIVVLDRPGPPTGPVVIS 20275



 Score = 36.6 bits (83), Expect = 0.23
 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 5/109 (4%)

Query: 1674  QAFLEAVAEEKPHVKPYFSKTIRDLEVVE---GSAARFDCKIEGYPDPEVVWFKDDQSIR 1730
             +AF   + +E P ++P    T    +++    GS    D  I G P P+V W  ++  ++
Sbjct: 22326 EAFSSVIIKE-PQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLK 22384

Query: 1731  ESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             E+    I   +D   +L + D    D  +Y     N+ G  T +  ++V
Sbjct: 22385 ETDRVSITTTKD-RTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 22432



 Score = 36.2 bits (82), Expect = 0.29
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

Query: 1007 NCKRGHAGTTD----NEKRSESQGTAP---AFKQKLQDVHVAEGKKLLLQCQVSSDPPAT 1059
            NC+    G  D    N K S      P      + L+DV V  G+     C++S +    
Sbjct: 5862 NCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYED-IP 5920

Query: 1060 IIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKN 1105
            + W L GK L+ +  ++   EG + ++++     ED G  +  AK+
Sbjct: 5921 VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD 5966



 Score = 36.2 bits (82), Expect = 0.29
 Identities = 19/81 (23%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             ++  + G++  +   + G P PT+ WLR  K + +++   E+   +    L++K      
Sbjct: 17329 TIVVNAGETFRLEADVHGKPLPTIEWLRGDKEI-EESARCEIKNTDFKALLIVKDAIRID 17387

Query: 720   AGQYEILLKNRVGECSCQVSL 740
              GQY +   N  G  S  V++
Sbjct: 17388 GGQYILRASNVAGSKSFPVNV 17408



 Score = 36.2 bits (82), Expect = 0.29
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 3/80 (3%)

Query: 659   RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPW 718
             ++VT   G S+ +  +++G P P + W + G  L        +   E    L++ KV  +
Sbjct: 23149 KTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDL---ASRAIIDTTESYSLLIVDKVNRY 23205

Query: 719   HAGQYEILLKNRVGECSCQV 738
              AG+Y I  +N+ G+ S  V
Sbjct: 23206 DAGKYTIEAENQSGKKSATV 23225



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 26/91 (28%), Positives = 39/91 (42%), Gaps = 3/91 (3%)

Query: 161  PKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEI 220
            P   T L   V +EG +   +  IT   +  V W   N  +    +    +      L I
Sbjct: 4435 PMIHTPLVDTVSEEGDIVHLTTSITNAKE--VNWYFENKLVPSDEKFKCLQDQNTYTLVI 4492

Query: 221  HGVNQDD-VGVYTCLVVNGSGKASMSAELSI 250
              VN +D  G Y C  +N SGK + SA+L++
Sbjct: 4493 DKVNTEDHQGEYVCEALNDSGKTATSAKLTV 4523



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 37/186 (19%), Positives = 66/186 (35%), Gaps = 32/186 (17%)

Query: 88   TFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAP 147
            T S ++  + E    ++  +A N  G  + ++ L V                + D    P
Sbjct: 9046 TTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNV---------------VIQDDEVPP 9090

Query: 148  AVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS--- 204
             ++ R S+ G+           + VK G+       +TG P P++ W K    ++     
Sbjct: 9091 TIKLRLSVRGDT----------IKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDA 9140

Query: 205  ---ARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSF- 260
                +  VS       L I    ++D G YT    N  G    +  + +    S  R+  
Sbjct: 9141 LQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPPRNLA 9200

Query: 261  VRETKA 266
            V + KA
Sbjct: 9201 VTDIKA 9206



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 1/75 (1%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G +V     I G P PT  W  DG  + K   H+ V  +     L +K       G+Y+I
Sbjct: 11220 GTTVRFPAIIRGVPVPTAKWTTDGSEI-KTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 11278

Query: 726   LLKNRVGECSCQVSL 740
              + N  G  +  V L
Sbjct: 11279 TVSNAAGSKTVAVHL 11293



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 28/97 (28%), Positives = 43/97 (44%), Gaps = 5/97 (5%)

Query: 31    EAPAFILPPR---NLCIKEGATAKFEG-RVRGYPEPQVTWHRNGQPITSGGRFLLDCGIR 86
             EAP  +L P     L IK G T       + G P P+ +W + G+ I       +     
Sbjct: 14069 EAPTIVLDPTIKDGLTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPT 14128

Query: 87    GTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
              +   + +A  + D G+YT  ATN  G +   V++TV
Sbjct: 14129 SSMLTIKYATRK-DAGEYTITATNPFGTKVEHVKVTV 14164



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 3/80 (3%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             I+ G + +    ++G P P+V W +    I      ++D     T SLV+  V+  D GK
Sbjct: 16649 IRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA--IIDVTSSFT-SLVLDNVNRYDSGK 16705

Query: 104   YTCEATNGSGARQVTVELTV 123
             YT    N SG +   V + V
Sbjct: 16706 YTLTLENSSGTKSAFVTVRV 16725



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 3/91 (3%)

Query: 33    PAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLV 92
             P+  LP     +K     K +   +G P+  V W ++GQ +    R  +    +   SL 
Sbjct: 19090 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSS-KTVTSLS 19148

Query: 93    IHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
             I    +ED G Y    +N +G+  +TV +T+
Sbjct: 19149 IKEASKEDVGTYELCVSNSAGS--ITVPITI 19177



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 1713  EGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGE 1770
             +G P P V W KD++++     + I+ + D +  L I  V  +D  KY     N +GE
Sbjct: 20991 KGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDTGKYILTIENGVGE 21047



 Score = 35.8 bits (81), Expect = 0.38
 Identities = 20/106 (18%), Positives = 44/106 (41%), Gaps = 2/106 (1%)

Query: 1015  TTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTK- 1073
             +T    ++  +G  P  +    D+ + EGK L + C  + +P   + W+  G+ + + + 
Sbjct: 27010 STSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQ 27069

Query: 1074  -FIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
                 +     L ++ I     +D GLY     N+ G    +  + +
Sbjct: 27070 GRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 27115



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 47/231 (20%), Positives = 82/231 (35%), Gaps = 56/231 (24%)

Query: 1031 FKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEK 1090
            F + L ++ V+E   + L C+VS  P A +IW    + +  T    +  EG    + I+ 
Sbjct: 6160 FTKNLANIEVSETDTIKLVCEVSK-PGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQN 6218

Query: 1091 ALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESD 1150
            A  ED G Y C                                 R P S         +D
Sbjct: 6219 AHLEDAGNYNC---------------------------------RLPSS--------RTD 6237

Query: 1151 ATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQ 1210
              VK            +  + I  P++ ++  GE  E    ++  +     W +  K ++
Sbjct: 6238 GKVKVH---------ELAAEFISKPQNLEILEGEKAEFVCSIS-KESFPVQWKRDDKTLE 6287

Query: 1211 ESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDK 1261
              +   V        L +  A  +  G Y ++V    G+ +A  +LTV++K
Sbjct: 6288 SGDKYDVIADGKKRVLVVKDATLQDMGTYVVMV----GAARAAAHLTVIEK 6334



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 16/82 (19%), Positives = 37/82 (45%)

Query: 169   RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDV 228
             ++ ++ G+    + + +G+P+P+V+W K    +    R  +        LE     + D 
Sbjct: 10522 KLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDS 10581

Query: 229   GVYTCLVVNGSGKASMSAELSI 250
             G Y  +V N +G      ++++
Sbjct: 10582 GKYCVVVENSTGSRKGFCQVNV 10603



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 25/96 (26%), Positives = 37/96 (38%), Gaps = 4/96 (4%)

Query: 550   KPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWL--HNGNEIQESEDFHFEQRGT 607
             KP   + L G+  L V  G  + +   V G P PEV W    +  ++  S     + R  
Sbjct: 11895 KPVLDLKLSGV--LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRAD 11952

Query: 608   QHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTV 643
                  + +    D G Y   A N+AG     A + V
Sbjct: 11953 SSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 11988



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 31/122 (25%), Positives = 47/122 (38%), Gaps = 9/122 (7%)

Query: 512   YTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQV 571
             +  +A+NA G +S  +  T      + K E  LP     P      +    + V  G   
Sbjct: 17288 FRVIAKNAAGAISKPSDST---GPITAKDEVELPRISMDP------KFRDTIVVNAGETF 17338

Query: 572   TMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNS 631
              +   V G P P + WL    EI+ES     +    +  L +++    D G Y   A N 
Sbjct: 17339 RLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNV 17398

Query: 632   AG 633
             AG
Sbjct: 17399 AG 17400



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 6/101 (5%)

Query: 437   GLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTC---E 493
             G  V+++   ++ V+K  A   G    L+  + G P P I W  + + +Q     C    
Sbjct: 20563 GGPVIDLPLEYTEVVKYRA---GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENT 20619

Query: 494   AGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEK 534
               +A + I+DA   + G Y     NA+G  S +  V + +K
Sbjct: 20620 TDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDK 20660



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             + V++G + R +  I G+P P   W K    +   A ++ SE +    L I   ++ D G
Sbjct: 23841 IFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETH--TELVIKEADRGDSG 23898

Query: 230   VYTCLVVNGSGKASMSAELSIQG 252
              Y  ++ N  GK ++  ++ + G
Sbjct: 23899 TYDLVLENKCGKKAVYIKVRVIG 23921



 Score = 35.4 bits (80), Expect = 0.50
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 3/92 (3%)

Query: 1689  PYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDY-DEDGNCSL 1747
             P  +  +R   V  G   RF   ++  P  EV W+ +   ++ES   +I Y +  G  +L
Sbjct: 26069 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESS--KIHYTNTSGVLTL 26126

Query: 1748  IISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
              I D   DD   Y     N  GEA+  A L V
Sbjct: 26127 EILDCHTDDSGTYRAVCTNYKGEASDYATLDV 26158



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 2/74 (2%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F   + D++V E   A+F+C++   P     W K  Q I     F++  D   + S++I 
Sbjct: 5537 FITPLSDVKVFEKDEAKFECEVSREP-KTFRWLKGTQEITGDDRFELIKDGTKH-SMVIK 5594

Query: 1751 DVCGDDDAKYTCKA 1764
                +D+AKY  +A
Sbjct: 5595 SAAFEDEAKYMFEA 5608



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 169   RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDV 228
             R+VV  G + R    ++G+P P VTW      L   A +  +  +   V  I    +   
Sbjct: 10228 RIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSSMV--IKNCQRSHQ 10285

Query: 229   GVYTCLVVNGSGK 241
             GVY+ L  N +G+
Sbjct: 10286 GVYSLLAKNEAGE 10298



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 6/82 (7%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNG--QPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             ++ G   +    VRG P P+VTW + G    +  G   L+D        LVI     +D 
Sbjct: 12313 VRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKGQVDLVDT----MAFLVIPNSTRDDS 12368

Query: 102   GKYTCEATNGSGARQVTVELTV 123
             GKY+    N +G + V V + V
Sbjct: 12369 GKYSLTLVNPAGEKAVFVNVRV 12390



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 24/82 (29%), Positives = 36/82 (43%), Gaps = 1/82 (1%)

Query: 1698  LEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDD 1757
             L V  G+    D  + G P P V W KD   ++ +   ++    +  C+L +  V   D 
Sbjct: 13000 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRN-LCTLELFSVNRKDS 13058

Query: 1758  AKYTCKAVNSLGEATCTAELIV 1779
               YT  A NS G  + T +L V
Sbjct: 13059 GDYTITAENSSGSKSATIKLKV 13080



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

Query: 546   VAPSKPTAP-IFLQGLSDLKVM--DGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHF 602
             VA     AP + L+GL DL  +  + S   + + + G P P V W    + +        
Sbjct: 13667 VARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSV 13726

Query: 603   EQRGTQHSLCIQEVFPEDTGTYTCEAWNSAG-EVRTQAVLTVQEPHDGTQP 652
             E      +L + +    D G YT    N AG +  T ++  V +P   T P
Sbjct: 13727 ESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGP 13777



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 24/99 (24%), Positives = 38/99 (38%), Gaps = 10/99 (10%)

Query: 142   DRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPL 201
             D + AP +   P+I          K G  +V        +  I G+P P+ +W K    +
Sbjct: 14066 DEYEAPTIVLDPTI----KDGLTIKAGDTIVLN------AISILGKPLPKSSWSKAGKDI 14115

Query: 202   QPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG 240
             +PS    ++      +L I    + D G YT    N  G
Sbjct: 14116 RPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 14154



 Score = 35.0 bits (79), Expect = 0.66
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             +V    G ++ +   I+G P P V   RDG  L K T  F      +  T+ LK+     
Sbjct: 20180 TVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPL-KATMRFNTEITAENLTINLKESVTAD 20238

Query: 720   AGQYEILLKNRVGECSCQVSLML 742
             AG+YEI   N  G     +++++
Sbjct: 20239 AGRYEITAANSSGTTKAFINIVV 20261



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 20/79 (25%), Positives = 32/79 (40%), Gaps = 13/79 (16%)

Query: 623  TYTCEAWNSAGE----VRTQAVLTVQEPHDGTQPWFISKP---------RSVTASLGQSV 669
            TYT +      E    VR +    + EP   T P     P          S+    G  +
Sbjct: 8333 TYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRTSLEVKRGDEI 8392

Query: 670  LISCAIAGDPFPTVHWLRD 688
             +  +I+G P+PT+ W++D
Sbjct: 8393 ALDASISGSPYPTITWIKD 8411



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 16/67 (23%), Positives = 28/67 (41%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
             G    +   + G P P + W+    E+  +     +      SL +++    D+G Y  +
Sbjct: 16253 GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILK 16312

Query: 628   AWNSAGE 634
             A N AGE
Sbjct: 16313 AKNVAGE 16319



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 22/81 (27%), Positives = 38/81 (46%), Gaps = 5/81 (6%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS-LVIHAVHEEDRG 102
             ++  AT +    ++G PEP+V W +    +T   +      +  +F+ LVI  V   D G
Sbjct: 18814 LRASATLRLFVTIKGRPEPEVKWEKAEGILTDRAQI----EVTSSFTMLVIDNVTRFDSG 18869

Query: 103   KYTCEATNGSGARQVTVELTV 123
             +Y     N SG++   V + V
Sbjct: 18870 RYNLTLENNSGSKTAFVNVRV 18890



 Score = 34.7 bits (78), Expect = 0.86
 Identities = 23/93 (24%), Positives = 35/93 (37%), Gaps = 1/93 (1%)

Query: 1687  VKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCS 1746
             +KP          V      + D   +G P   V W KD Q+++E+    +   +    S
Sbjct: 19088 IKPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVT-S 19146

Query: 1747  LIISDVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
             L I +   +D   Y     NS G  T    +IV
Sbjct: 19147 LSIKEASKEDVGTYELCVSNSAGSITVPITIIV 19179



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 3/87 (3%)

Query: 1695 IRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
            ++D  V E     F+C++      +  WF+++++I +S  + I   +D   +L I D   
Sbjct: 6341 LKDTRVKEQQEVVFNCEVNT-EGAKAKWFRNEEAIFDSSKYII-LQKDLVYTLRIRDAHL 6398

Query: 1755 DDDAKYTCKAVNSLGE-ATCTAELIVE 1780
            DD A Y     N  GE     A LIVE
Sbjct: 6399 DDQANYNVSLTNHRGENVKSAANLIVE 6425



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 33/116 (28%), Positives = 48/116 (41%), Gaps = 10/116 (8%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNL-CIKEGATAKFEGRVR--- 57
            G+  L   S  +K  +S DPS +   PLT   AF+ P  +L   K+G        +    
Sbjct: 7054 GNKYLYRVSAENKAGVS-DPSEILG-PLTADDAFVEPTMDLSAFKDGLEVIVPNPITILV 7111

Query: 58   ---GYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATN 110
               GYP P  TW    + + +G R  +   +     LVI      D+G YT +  N
Sbjct: 7112 PSTGYPRPTATWCFGDKVLETGDRVKMKT-LSAYAELVISPSERSDKGIYTLKLEN 7166



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 21/85 (24%), Positives = 33/85 (38%), Gaps = 2/85 (2%)

Query: 168   GRVVVKEGQMGRFSCKITGRPQPQVTWLKGN--VPLQPSARVSVSEKNGMQVLEIHGVNQ 225
             G + VK G   R    + G+P P+V W K      L  S RV +  +       +    +
Sbjct: 11904 GVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKR 11963

Query: 226   DDVGVYTCLVVNGSGKASMSAELSI 250
              D G Y     N +G     A +++
Sbjct: 11964 SDGGKYVVTATNTAGSFVAYATVNV 11988



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 1692  SKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISD 1751
             S+  + + V  G +AR     +G P PE+ W +++    +    ++  ++  N + +  D
Sbjct: 17723 SELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTD----KVQIEKGVNYTQLSID 17778

Query: 1752  VCGDDDA-KYTCKAVNSLG 1769
              C  +DA KY  K  NS G
Sbjct: 17779 NCDRNDAGKYILKLENSSG 17797



 Score = 34.3 bits (77), Expect = 1.1
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 6/109 (5%)

Query: 21    PSRVDSMPLTEAPAFILPPR---NLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGG 77
             P  V    + E P + L  R    + +++G   +    ++G P P   W + GQ I+   
Sbjct: 23817 PGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISK-- 23874

Query: 78    RFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGS 126
             R ++      T  LVI      D G Y     N  G + V +++ V GS
Sbjct: 23875 RAMIATSETHT-ELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVIGS 23922



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 51/246 (20%), Positives = 95/246 (38%), Gaps = 41/246 (16%)

Query: 451  LKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALPE 507
            L+D    E Q+ V +  +  + +  + W    + I+ +   +      + +L + + + +
Sbjct: 2493 LRDLTCTETQNVVFEVELSHSGID-VLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKD 2551

Query: 508  DHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMD 567
            D G YT  A    G+   S  +TV               A SKP        L+D  V +
Sbjct: 2552 DEGKYTFYA----GENMTSGKLTVAGG------------AISKP--------LTDQTVAE 2587

Query: 568  GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCE 627
              +     +V+ NP  +  WL +G  +  + +   E  G +  L I     +D G YT +
Sbjct: 2588 SQEAVFECEVA-NPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYK 2646

Query: 628  AWNSAGEVRTQAVLTVQEPHDGTQPWFISKP-RSVTASLGQSVLISCAIAGDPFPTVHWL 686
               S    +T A L V+          I K  +++T +  Q  + +  +       V W+
Sbjct: 2647 VATS----KTSAKLKVEAVK-------IKKTLKNLTVTETQDAVFTVELTHPNVKGVQWI 2695

Query: 687  RDGKAL 692
            ++G  L
Sbjct: 2696 KNGVVL 2701



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 3/73 (4%)

Query: 661   VTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHA 720
             +    G  + I   ++G P PTV W  + + L ++     +       ++V+K  Q  H 
Sbjct: 10229 IVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEA---TIETTAISSSMVIKNCQRSHQ 10285

Query: 721   GQYEILLKNRVGE 733
             G Y +L KN  GE
Sbjct: 10286 GVYSLLAKNEAGE 10298



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTC 1762
             G A R +  + G P P + W KD + +  +   +I    D + +L+  D    D   YT 
Sbjct: 15171 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKI-ADFSTNLVNKDSTRRDSGAYTL 15229

Query: 1763  KAVNSLGEA 1771
              A N  G A
Sbjct: 15230 TATNPGGFA 15238



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/116 (26%), Positives = 48/116 (41%), Gaps = 20/116 (17%)

Query: 20    DPSRVDSMPLTEAPAFILPP---------RNLCIKEGATAKFEGRVRGYPEPQVTWHRNG 70
             +P+ V   P  E    +LPP         + + I+   T +    ++G P P+V W R+ 
Sbjct: 15536 EPALVPGTPKAEDR--MLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDH 15593

Query: 71    QPITSGGRFLLDCGIRGTFS---LVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
                   G  L    I  T S   L++  V+  D GKY     N SG++   V + V
Sbjct: 15594 ------GESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRV 15643



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             + +  G  + + V + G P PEV W     EI+++         T  SL +  V   D+G
Sbjct: 16647 INIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVTSSFT--SLVLDNVNRYDSG 16704

Query: 623   TYTCEAWNSAG 633
              YT    NS+G
Sbjct: 16705 KYTLTLENSSG 16715



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 1/77 (1%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G+ + I   + G P P + W++DG+ L K T    V +      L +K+      G+Y +
Sbjct: 18021 GEDLKIEIPVIGRPRPNISWVKDGEPL-KQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 18079

Query: 726   LLKNRVGECSCQVSLML 742
                N  G  +  +S+++
Sbjct: 18080 TATNSAGTATENLSVIV 18096



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 4/108 (3%)

Query: 17    LSVDPSRVDSMPLT-EAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITS 75
             +++ P  V  + +T E     +P   + ++ G     E   +G P+P ++W ++G P+  
Sbjct: 21242 VTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKE 21301

Query: 76    GGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTV 123
                F+         +L I    +E  GKYT    N     ++ V +TV
Sbjct: 21302 -SEFVRFSKTENKITLSIKNAKKEHGGKYTVILDN--AVCRIAVPITV 21346



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 20/76 (26%), Positives = 31/76 (40%), Gaps = 3/76 (3%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQ---YARSTCEAGVAELHIQDALPEDHGTYTCL 515
             G  F +   + G P P++TW L    ++       T       L ++D++  D G Y   
Sbjct: 22357 GSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLT 22416

Query: 516   AENALGQVSCSAWVTV 531
              EN  G  + S  V V
Sbjct: 22417 LENTAGVKTFSVTVVV 22432



 Score = 33.9 bits (76), Expect = 1.5
 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 17/109 (15%)

Query: 1676  FLEAVAEEKPHVKPYFSKTIRDLEVVE----------GSAARFDCKIEGYPDPEVVWFKD 1725
             + E++AE    ++P     I DLE+ +          G++ R    + G P P + W K 
Sbjct: 23123 YSESIAE----IEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSK- 23177

Query: 1726  DQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCT 1774
              Q I  +    ID  E  +  LI+  V   D  KYT +A N  G+ + T
Sbjct: 23178 -QGIDLASRAIIDTTESYSL-LIVDKVNRYDAGKYTIEAENQSGKKSAT 23224



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 27/89 (30%), Positives = 41/89 (46%), Gaps = 6/89 (6%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F   + D  V EG  A F C++  +    VVWFK+D  +  SR   I   E     L + 
Sbjct: 5271 FMSPLEDQTVKEGETATFVCELS-HEKMHVVWFKNDAKLHTSRTVLIS-SEGKTHKLEMK 5328

Query: 1751 DVCGDDDAKYTCKAVNSLGEATCTAELIV 1779
            +V  DD ++   +    + E + TA+L V
Sbjct: 5329 EVTLDDISQIKAQ----VKELSSTAQLKV 5353



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 22/84 (26%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 1691 FSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIIS 1750
            F   ++D+   E  +A F  ++  + +  V WFK+DQ +  +R   +  DE    S+   
Sbjct: 5626 FLTPLKDVTAKEKESAVFTVELS-HDNIRVKWFKNDQRLHTTRSVSMQ-DEGKTHSITFK 5683

Query: 1751 DVCGDDDAKYTCKAVNSLGEATCT 1774
            D+  DD ++   +A+    EA  T
Sbjct: 5684 DLSIDDTSQIRVEAMGMSSEAKLT 5707



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 20/72 (27%), Positives = 32/72 (44%)

Query: 185  TGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASM 244
            TG P+P  TW  G+  L+   RV +   +    L I    + D G+YT  + N     S 
Sbjct: 7114 TGYPRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISG 7173

Query: 245  SAELSIQGLDSA 256
              ++++    SA
Sbjct: 7174 EIDVNVIARPSA 7185



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 27/116 (23%), Positives = 45/116 (38%), Gaps = 9/116 (7%)

Query: 10   SHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRN 69
            S IS+  ++ DP           P   L   ++ + EG         R  P P V+WH++
Sbjct: 8067 SEISENVVAKDPDC--------KPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKD 8118

Query: 70   GQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEG 125
            G+ + +  R  +          V  +V   D G YT    N  G+   ++ + V G
Sbjct: 8119 GKEVKASDRLTMKNDHISAHLEVPKSV-RADAGIYTITLENKLGSATASINVKVIG 8173



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 24/99 (24%), Positives = 37/99 (37%), Gaps = 5/99 (5%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQYARS-----TCEAGVAELHIQDALPEDHGTYT 513
             G    L+  VRG P P + W  +       RS        A  ++  +  A   D G Y 
Sbjct: 11911 GDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYV 11970

Query: 514   CLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPT 552
               A N  G     A V V +K    ++  ++ V+  + T
Sbjct: 11971 VTATNTAGSFVAYATVNVLDKPGPVRNLKIVDVSSDRCT 12009



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 40    RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGT-FSLVIHA--V 96
             + L ++ G T +    V+G P P++TW +    +    R  LD  I+ T F   +    V
Sbjct: 13396 KTLILRAGVTMRLYVPVKGRPPPKITWSKPN--VNLRDRIGLD--IKSTDFDTFLRCENV 13451

Query: 97    HEEDRGKYTCEATNGSGARQVTVELTV 123
             ++ D GKY     N  G ++ T+ + V
Sbjct: 13452 NKYDAGKYILTLENSCGKKEYTIVVKV 13478



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 1/70 (1%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGK 103
             +K G   + E  V G P P + W ++G+ +    +  +      T +LV       D G 
Sbjct: 15168 LKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFST-NLVNKDSTRRDSGA 15226

Query: 104   YTCEATNGSG 113
             YT  ATN  G
Sbjct: 15227 YTLTATNPGG 15236



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 33/148 (22%), Positives = 53/148 (35%), Gaps = 5/148 (3%)

Query: 42    LCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDR 101
             + +K G   K    + G P P ++W ++G  I    R  +      T  L +      D 
Sbjct: 19494 IVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTL-LTVKDCIRRDT 19552

Query: 102   GKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFS----APAVETRPSIWG 157
             G+Y     N +G R V V   V        G   ++    ++ S     P  +    I  
Sbjct: 19553 GQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCSLSWGRPQEDGGADIDY 19612

Query: 158   ECPPKFATKLGRVVVKEGQMGRFSCKIT 185
                 K  T      + EG++   SCK+T
Sbjct: 19613 YIVEKRETSHLAWTICEGELQMTSCKVT 19640



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 36/123 (29%), Positives = 48/123 (39%), Gaps = 8/123 (6%)

Query: 4     VKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPP---RNLCIKEGATAKFEGRVRGYP 60
             VK V     S  S S DP         E P F +     + L +K GA+       RG P
Sbjct: 19852 VKSVNKVGASDPSDSSDPQIAKERE--EEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRP 19909

Query: 61    EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE 120
              P V W +    + +  R  +D     T SL I   +  D GKYT    N   A  +T+ 
Sbjct: 19910 VPNVLWSKPDTDLRT--RAYVDTTDSRT-SLTIENANRNDSGKYTLTIQNVLSAASLTLV 19966

Query: 121   LTV 123
             + V
Sbjct: 19967 VKV 19969



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 25/88 (28%), Positives = 35/88 (39%), Gaps = 7/88 (7%)

Query: 448   SSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAE----LHIQD 503
             S + K   V  G  F +    RG PVP + W    +P    R+       +    L I++
Sbjct: 19885 SEMRKTLIVKAGASFTMTVPFRGRPVPNVLW---SKPDTDLRTRAYVDTTDSRTSLTIEN 19941

Query: 504   ALPEDHGTYTCLAENALGQVSCSAWVTV 531
             A   D G YT   +N L   S +  V V
Sbjct: 19942 ANRNDSGKYTLTIQNVLSAASLTLVVKV 19969



 Score = 33.5 bits (75), Expect = 1.9
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTG 622
             L V  G+  TMTV   G P P V+W     +++     + +   ++ SL I+     D+G
Sbjct: 19891 LIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRA--YVDTTDSRTSLTIENANRNDSG 19948

Query: 623   TYTCEAWN 630
              YT    N
Sbjct: 19949 KYTLTIQN 19956



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 50/246 (20%), Positives = 84/246 (34%), Gaps = 53/246 (21%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G  KL+     +  +LSV+  ++           I   R+L   E     FE  +  +  
Sbjct: 2467 GPYKLIVGRVETNCNLSVEKIKI-----------IRGLRDLTCTETQNVVFEVEL-SHSG 2514

Query: 62   PQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVEL 121
              V W+   + I    ++ ++   +  + L +  + ++D GKYT  A    G    + +L
Sbjct: 2515 IDVLWNFKDKEIKPSSKYKIEAHGK-IYKLTVLNMMKDDEGKYTFYA----GENMTSGKL 2569

Query: 122  TVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFS 181
            TV G          +SK L D+                            V E Q   F 
Sbjct: 2570 TVAGG--------AISKPLTDQ---------------------------TVAESQEAVFE 2594

Query: 182  CKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGK 241
            C++   P  +  WL+    L  +  +        + L I     DD+G YT  V      
Sbjct: 2595 CEVAN-PDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTS 2653

Query: 242  ASMSAE 247
            A +  E
Sbjct: 2654 AKLKVE 2659



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 32/135 (23%), Positives = 51/135 (37%), Gaps = 17/135 (12%)

Query: 1656 SPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVK--------------PYFSKTIRDLEVV 1701
            S T  +++E    + ++ +  L+ +++ K  VK              PYF+  + D   V
Sbjct: 5311 SRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAV 5370

Query: 1702 EGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYT 1761
            E       C++    D  V WFKD + I  S  + I  D      L I      D  +Y 
Sbjct: 5371 EKDEITLKCEVS--KDVPVKWFKDGEEIVPSPKYSIKADGLRRI-LKIKKADLKDKGEYV 5427

Query: 1762 CKAVNSLGEATCTAE 1776
            C       +A  T E
Sbjct: 5428 CDCGTDKTKANVTVE 5442



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 25/92 (27%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 1038 VHVAEGKKLLLQCQVSSDPPATIIWTLNGKTL-KTTKFIILSQEG-----SLCSVSIEKA 1091
            + V  G+ + +   V+  P   I W+ N   + K T  + +++E      +   +SI KA
Sbjct: 9103 IKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKA 9162

Query: 1092 LPEDRGLYKCVAKNDAGQAECSCQVTVDDAPA 1123
            + ED+G Y   A N  G    +  V V D P+
Sbjct: 9163 VREDKGTYTVTASNRLGSVFRNVHVEVYDRPS 9194



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 3/84 (3%)

Query: 1696  RDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGD 1755
             R+  +  G   R    I+G P P+V W K+D+        +ID    G+  L I +   +
Sbjct: 10921 REQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKA--RIDVTPVGS-KLEIRNAAHE 10977

Query: 1756  DDAKYTCKAVNSLGEATCTAELIV 1779
             D   Y+    N  G  T + +++V
Sbjct: 10978 DGGIYSLTVENPAGSKTVSVKVLV 11001



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 27/115 (23%), Positives = 48/115 (41%), Gaps = 19/115 (16%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAELH----IQDALP 506
             +D  V++ G+   +   + G P+P I+W  +G  I+  R+  E    + H    ++D + 
Sbjct: 19491 RDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIE-ERARTEIISTDNHTLLTVKDCIR 19549

Query: 507   EDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLS 561
              D G Y    +N  G  S +    V +K             P  P  P+ + GL+
Sbjct: 19550 RDTGQYVLTLKNVAGTRSVAVNCKVLDK-------------PGPPAGPLEINGLT 19591



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 57    RGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSG 113
             +G P P VTW ++ + + S  R+ ++     +  L I  V   D GKY     NG G
Sbjct: 20991 KGRPPPTVTWRKDEKNLGSDARYSIE-NTDSSSLLTIPQVTRNDTGKYILTIENGVG 21046



 Score = 33.1 bits (74), Expect = 2.5
 Identities = 20/81 (24%), Positives = 35/81 (43%), Gaps = 5/81 (6%)

Query: 44    IKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFS-LVIHAVHEEDRG 102
             ++ GA+ +     +G P P   W +    ++       D     +FS L +   +  D G
Sbjct: 22064 VRAGASIRLFIAYQGRPTPTAVWSKPDSNLS----LRADIHTTDSFSTLTVENCNRNDAG 22119

Query: 103   KYTCEATNGSGARQVTVELTV 123
             KYT    N SG++ +T  + V
Sbjct: 22120 KYTLTVENNSGSKSITFTVKV 22140



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 1695 IRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
            + D +V EG   + + K+      E VW KD Q ++ S    I  D+  +  L+I D+  
Sbjct: 2316 LSDQKVCEGDIVQLEVKVS-LESVEGVWMKDGQEVQPSDRVHIVIDKQSH-MLLIEDMTK 2373

Query: 1755 DDDAKYTCKAVNSLGEAT 1772
            +D   Y+   + +LG +T
Sbjct: 2374 EDAGNYSF-TIPALGLST 2390



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 22/88 (25%), Positives = 33/88 (37%), Gaps = 8/88 (9%)

Query: 1043 GKKLLLQCQVSSDPPATIIWTLNGKTLKTTKFII--------LSQEGSLCSVSIEKALPE 1094
            G ++ +   +   P     W  +GK  K  K  +        L    +   + I +    
Sbjct: 9520 GSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRS 9579

Query: 1095 DRGLYKCVAKNDAGQAECSCQVTVDDAP 1122
              G Y   AKN AGQ   +C+V V D P
Sbjct: 9580 HTGKYSITAKNKAGQKTANCRVKVMDVP 9607



 Score = 32.7 bits (73), Expect = 3.3
 Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 3/68 (4%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG-DDDAKYT 1761
             GS    D  + G P+P+++W K D+ +       + Y   G  +  +   C   D  KYT
Sbjct: 22757 GSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQY--TGKRATAVIKFCDRSDSGKYT 22814

Query: 1762  CKAVNSLG 1769
                 N+ G
Sbjct: 22815 LTVKNASG 22822



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 25/86 (29%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 1696 RDLEVVEGSAARFDCKI--EGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVC 1753
            ++LE++EG  A F C I  E +P   V W +DD+++     + +  D      L++ D  
Sbjct: 6254 QNLEILEGEKAEFVCSISKESFP---VQWKRDDKTLESGDKYDVIADGKKRV-LVVKDAT 6309

Query: 1754 GDDDAKYTCKAVNSLGEATCTAELIV 1779
              D   Y    V  +G A   A L V
Sbjct: 6310 LQDMGTY----VVMVGAARAAAHLTV 6331



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 23/93 (24%), Positives = 41/93 (44%), Gaps = 6/93 (6%)

Query: 545   PVAPSKPTAP--IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHF 602
             P+      AP  + L     L +  G    +T + SG P P+V W  +  ++ E +  H 
Sbjct: 10503 PITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHI 10562

Query: 603   EQRGTQHSLCIQEVFPE--DTGTYTCEAWNSAG 633
               + T  +L ++++  +  D+G Y     NS G
Sbjct: 10563 --KTTPATLALEKIKAKRSDSGKYCVVVENSTG 10593



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 1/66 (1%)

Query: 675   IAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGEC 734
             I G P P+V W +    L  DT    V  +    TL++   Q   AG+Y I LKN  G  
Sbjct: 13701 IKGKPAPSVSWKKGEDPLATDT-RVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 13759

Query: 735   SCQVSL 740
                +S+
Sbjct: 13760 EGTISI 13765



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 6/75 (8%)

Query: 452   KDCAVIE-GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAE----LHIQDALP 506
             KD  +++ G+ F L+  V G P P + W  +G+ ++   +  E  +A+    L  +D+  
Sbjct: 15163 KDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELE-GTAKLEIKIADFSTNLVNKDSTR 15221

Query: 507   EDHGTYTCLAENALG 521
              D G YT  A N  G
Sbjct: 15222 RDSGAYTLTATNPGG 15236



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 26/126 (20%), Positives = 51/126 (40%), Gaps = 25/126 (19%)

Query: 459   GQDFVLQCSVRGTPVPRITWLLNGQPIQYARSTCEAGVAE---LHIQDALPEDHGTYTCL 515
             G +  +   + G P+P++T   +G P++          AE   +++++++  D G Y   
Sbjct: 20186 GSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEIT 20245

Query: 516   AENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVM--------- 566
             A N+ G       + V ++             P  PT P+ +  +++  V          
Sbjct: 20246 AANSSGTTKAFINIVVLDR-------------PGPPTGPVVISDITEESVTLKWEPPKYD 20292

Query: 567   DGSQVT 572
              GSQVT
Sbjct: 20293 GGSQVT 20298



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 2/94 (2%)

Query: 551   PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHS 610
             P   + L+    +K   G+ V +   +SG P P + W  +  E+Q +     E      S
Sbjct: 20565 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 20624

Query: 611   LCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQ 644
             + I++    ++G Y  +  N+ G     A + VQ
Sbjct: 20625 ILIKDADRLNSGCYELKLRNAMGS--ASATIRVQ 20656



 Score = 32.3 bits (72), Expect = 4.3
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 1/87 (1%)

Query: 37    LPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAV 96
             +P + + +  G   +    + G P P  +W   G  +    R  ++   +    L I   
Sbjct: 23438 MPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTK-VAKLTIRET 23496

Query: 97    HEEDRGKYTCEATNGSGARQVTVELTV 123
                D G+YT E  N +G    T+++ +
Sbjct: 23497 TIRDTGEYTLELKNVTGTTSETIKVII 23523



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 4/91 (4%)

Query: 1691 FSKTIRDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLII 1749
            F++ ++D+   E  + A F+C+    P  +V W+KD   + E   +++  D   +  L I
Sbjct: 2130 FTQELQDVVAKEKDTMATFECETSE-PFVKVKWYKDGMEVHEGDKYRMHSDRKVH-FLSI 2187

Query: 1750 SDVCGDDDAKYTCKAVNSLGEATCTAELIVE 1780
              +   D   Y+C  V      T TA+LIVE
Sbjct: 2188 LTIDTSDAEDYSCVLVEDENVKT-TAKLIVE 2217



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 26/119 (21%), Positives = 49/119 (41%), Gaps = 21/119 (17%)

Query: 1625 WQKTGNAVR-------AIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFL 1677
            W K G  V+        I + S M +I  ++  K   G+ +  + A  L +   VS   +
Sbjct: 2342 WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMT--KEDAGNYSFTIPALGLSTSGRVSVYSV 2399

Query: 1678 EAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQ 1736
            + +              ++D+ V+EG+ A  +CK+       V W+ +D+ I+     Q
Sbjct: 2400 DVITP------------LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQ 2446



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 26/80 (32%), Positives = 37/80 (46%), Gaps = 7/80 (8%)

Query: 1694  TIRDLEVVE-GSAARFDCKIEGYPDPEVVWFKD--DQSIRESRHFQIDYDEDGNCSLIIS 1750
             ++R L +V  G   R    + G P P+V W K   D  +R+    Q+D   D    L+I 
Sbjct: 12306 SMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGIDNVVRKG---QVDL-VDTMAFLVIP 12361

Query: 1751  DVCGDDDAKYTCKAVNSLGE 1770
             +   DD  KY+   VN  GE
Sbjct: 12362 NSTRDDSGKYSLTLVNPAGE 12381



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 24/93 (25%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 659   RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFT-LVLKKVQP 717
             R++    G S+ I   I G P P V W +D   L K+  + E   N + FT L++ +   
Sbjct: 14479 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINL-KNRANIE---NTESFTLLIIPECNR 14534

Query: 718   WHAGQYEILLKNRVGECSCQVSLMLQNSSARAL 750
             +  G++ + ++N  G+ S  V++ + ++    L
Sbjct: 14535 YDTGKFVMTIENPAGKKSGFVNVRVLDTPGPVL 14567



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 1/72 (1%)

Query: 1696  RDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
             +D+ VV  G     +  I G P P+VVW KD + + E+             +L++ D   
Sbjct: 18409 KDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIR 18468

Query: 1755  DDDAKYTCKAVN 1766
              D  +Y  K  N
Sbjct: 18469 TDGGQYILKLSN 18480



 Score = 32.0 bits (71), Expect = 5.6
 Identities = 38/175 (21%), Positives = 68/175 (38%), Gaps = 15/175 (8%)

Query: 45    KEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKY 104
             K G+    +  + G P P+VTW      +    R  +    +   +L +      D G+Y
Sbjct: 22355 KAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITT-TKDRTTLTVKDSMRGDSGRY 22413

Query: 105   TCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFA 164
                  N +G +  +V + V G      G   VS          + E+    WGE      
Sbjct: 22414 FLTLENTAGVKTFSVTVVVIGRPGPVTGPIEVSSV--------SAESCVLSWGEPKDGGG 22465

Query: 165   TKLGRVVVKEGQMGRFSCKITG----RPQPQVTWLKGNVPLQPSARVSVSEKNGM 215
             T++   +V++ + G  + ++      R Q +VT L     ++ S RVS   + G+
Sbjct: 22466 TEITNYIVEKRESGTTAWQLVNSSVKRTQIKVTHL--TKYMEYSFRVSSENRFGV 22518



 Score = 31.6 bits (70), Expect = 7.3
 Identities = 22/79 (27%), Positives = 33/79 (41%), Gaps = 3/79 (3%)

Query: 1702  EGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYT 1761
             E S  R    I+G P P V W K +  +       ++     N +LI+ D    D  KYT
Sbjct: 13691 ENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVE-SSAVNTTLIVYDCQKSDAGKYT 13749

Query: 1762  CKAVNSLG--EATCTAELI 1778
                 N  G  E T + +++
Sbjct: 13750 ITLKNVAGTKEGTISIKVV 13768



 Score = 31.6 bits (70), Expect = 7.3
 Identities = 18/67 (26%), Positives = 29/67 (43%), Gaps = 3/67 (4%)

Query: 458   EGQDFVLQCSVRGTPVPRITWLLNGQPIQY-ARSTCEAGVAE--LHIQDALPEDHGTYTC 514
             E  +F L+  ++G P P ++W     P+    R + E+      L + D    D G YT 
Sbjct: 13691 ENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTI 13750

Query: 515   LAENALG 521
               +N  G
Sbjct: 13751 TLKNVAG 13757



 Score = 31.6 bits (70), Expect = 7.3
 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 568   GSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGT--QHSLCIQEVFPEDTGTYT 625
             G    +   + G P P+V+W  +G E++E+     E + T  + +L +++    D G Y 
Sbjct: 18417 GETFVLEADIRGKPIPDVVWSKDGKELEETA-ARMEIKSTIQKTTLVVKDCIRTDGGQYI 18475

Query: 626   CEAWNSAG 633
              +  N  G
Sbjct: 18476 LKLSNVGG 18483



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 30/130 (23%), Positives = 53/130 (40%), Gaps = 17/130 (13%)

Query: 1664 EKLESEEDVSQAFLEAVAEEKPHVK-------------PYFSKTIRDLEVVEGSAARFDC 1710
            E L+  E+  ++  E+  EE   VK             P     + D    EG       
Sbjct: 4397 ESLKPSEEKEESSSESGTEEVATVKIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTT 4456

Query: 1711 KIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDD-DAKYTCKAVNSLG 1769
             I      EV W+ +++ +     F+   D++   +L+I  V  +D   +Y C+A+N  G
Sbjct: 4457 SITNAK--EVNWYFENKLVPSDEKFKCLQDQN-TYTLVIDKVNTEDHQGEYVCEALNDSG 4513

Query: 1770 EATCTAELIV 1779
            +   +A+L V
Sbjct: 4514 KTATSAKLTV 4523



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 8/112 (7%)

Query: 1007 NCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNG 1066
            NC+   + T    K  E    A  F  K Q++ + EG+K    C +S +    + W  + 
Sbjct: 6228 NCRLPSSRTDGKVKVHE---LAAEFISKPQNLEILEGEKAEFVCSISKE-SFPVQWKRDD 6283

Query: 1067 KTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
            KTL++     +  +G    + ++ A  +D G Y  +     G A  +  +TV
Sbjct: 6284 KTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVM----VGAARAAAHLTV 6331



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 3/88 (3%)

Query: 450  VLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCE--AGVAELHIQDALP 506
            +L    V  G    L  +V G P P+ITW      + Q  R T E     + + I D+  
Sbjct: 7391 LLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKR 7450

Query: 507  EDHGTYTCLAENALGQVSCSAWVTVHEK 534
             D GTY   A N  G+ +    V V +K
Sbjct: 7451 SDTGTYIIEAVNVCGRATAVVEVNVLDK 7478



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 23/79 (29%), Positives = 33/79 (41%), Gaps = 10/79 (12%)

Query: 456  VIEGQDFVLQCSVRGTPVPRITWLL-------NGQPIQYARSTCEAGVAE---LHIQDAL 505
            V EG +  +   ++G P P +TW         N +P+ Y     +  V +   L I  + 
Sbjct: 9823 VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 9882

Query: 506  PEDHGTYTCLAENALGQVS 524
              D G YT  A N LG  S
Sbjct: 9883 RSDTGLYTITAVNNLGTAS 9901



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 3/75 (4%)

Query: 1696  RDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGD 1755
             R L V  G + R    I+G P PEV W KD+ +++   + +   + +    LII +    
Sbjct: 14479 RTLVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIE---NTESFTLLIIPECNRY 14535

Query: 1756  DDAKYTCKAVNSLGE 1770
             D  K+     N  G+
Sbjct: 14536 DTGKFVMTIENPAGK 14550



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 14/78 (17%)

Query: 563   LKVMDGSQVTMTVQVSGNPPPEVIW------LHNGNEIQESEDFHFEQRGTQHSLCIQEV 616
             L V  G  + + V + G P PEV W      L N   I+ +E F          L I E 
Sbjct: 14481 LVVRAGLSIRIFVPIKGRPAPEVTWTKDNINLKNRANIENTESFTL--------LIIPEC 14532

Query: 617   FPEDTGTYTCEAWNSAGE 634
                DTG +     N AG+
Sbjct: 14533 NRYDTGKFVMTIENPAGK 14550



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 16/69 (23%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLI-ISDVCGDDDAKYT 1761
             G   + +  + G P P V W K DQ +++++  +++++     +++ I++    D   Y 
Sbjct: 14775 GDNIKVEIPVLGRPKPTVTWKKGDQILKQTQ--RVNFETTATSTILNINECVRSDSGPYP 14832

Query: 1762  CKAVNSLGE 1770
               A N +GE
Sbjct: 14833 LTARNIVGE 14841



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 660   SVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWH 719
             +V    G++  +   ++G P PT+ W +DGK L + T   E+   +    LV K      
Sbjct: 15165 TVILKAGEAFRLEADVSGRPPPTMEWSKDGKEL-EGTAKLEIKIADFSTNLVNKDSTRRD 15223

Query: 720   AGQYEILLKNRVG 732
             +G Y +   N  G
Sbjct: 15224 SGAYTLTATNPGG 15236



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 22/75 (29%), Positives = 31/75 (41%), Gaps = 2/75 (2%)

Query: 1696  RDLEVVE-GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCG 1754
             RD+ VV+ G   + +  I G P P + W KD   I E    +I    D +  L + D   
Sbjct: 19491 RDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEI-ISTDNHTLLTVKDCIR 19549

Query: 1755  DDDAKYTCKAVNSLG 1769
              D  +Y     N  G
Sbjct: 19550 RDTGQYVLTLKNVAG 19564



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 19/71 (26%), Positives = 30/71 (42%)

Query: 170   VVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVG 229
             V V+ G   +    I+G+P P+VT  +  VPL+ + R +         + +      D G
Sbjct: 20181 VYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAG 20240

Query: 230   VYTCLVVNGSG 240
              Y     N SG
Sbjct: 20241 RYEITAANSSG 20251



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 5/73 (6%)

Query: 1703  GSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDA-KYT 1761
             G++ R     +G P P  VW K D ++      + D     + S +  + C  +DA KYT
Sbjct: 22067 GASIRLFIAYQGRPTPTAVWSKPDSNL----SLRADIHTTDSFSTLTVENCNRNDAGKYT 22122

Query: 1762  CKAVNSLGEATCT 1774
                 N+ G  + T
Sbjct: 22123 LTVENNSGSKSIT 22135



 Score = 31.2 bits (69), Expect = 9.5
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 1/68 (1%)

Query: 456   VIEGQDFVLQCSVRGTPVPRITWLLNGQPI-QYARSTCEAGVAELHIQDALPEDHGTYTC 514
             V +G    L   ++G P P   W   GQ I + A         EL I++A   D GTY  
Sbjct: 23843 VRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHTELVIKEADRGDSGTYDL 23902

Query: 515   LAENALGQ 522
             + EN  G+
Sbjct: 23903 VLENKCGK 23910


>gi|110349713 titin isoform novex-1 [Homo sapiens]
          Length = 27051

 Score =  295 bits (755), Expect = 3e-79
 Identities = 217/812 (26%), Positives = 353/812 (43%), Gaps = 130/812 (16%)

Query: 1028  APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKTT--KFIILSQEGSLCS 1085
             AP FK++L++++V       L C+V+  P   + W   GK +     K+ I   +G    
Sbjct: 24555 APHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQ 24614

Query: 1086  VSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVL 1145
             + I     +D  +Y+  A N  G    +  + V+                          
Sbjct: 24615 LIIASVTDDDATVYQVRATNQGGSVSGTASLEVE-------------------------- 24648

Query: 1146  GTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF 1205
                             P K  +P  +        +R GE V +    +G      TW K 
Sbjct: 24649 ---------------VPAKIHLPKTLEGMGAVHALR-GEVVSIKIPFSGKPDPVITWQKG 24692

Query: 1206  RKQIQESEHMKVENSENGSKLTIL-AARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP 1264
             +  I  + H +V  + + + L       ++  G Y +  +N+ G  Q  V L V D PDP
Sbjct: 24693 QDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADVPDP 24752

Query: 1265  PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRSTSFNVQD 1324
             P G    SD+   S+ L+W   + DGGS + +Y +E   +  + W  +   R T + V +
Sbjct: 24753 PRGVK-VSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETRYTVIN 24811

Query: 1325  LLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVT 1384
             L     Y+FRV A N +G S+PS+ SE T   E      +  E  D+     EV     +
Sbjct: 24812 LFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETR---EVSMTKAS 24868

Query: 1385  INTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIM 1444
              ++ +++ + Y I E LG G+FG V R VE  ++K +  KF K     ++  +++EISI+
Sbjct: 24869 HSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKV-KGTDQVLVKKEISIL 24927

Query: 1445  NCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGV 1504
             N   H  ++   ++FE    +VM+ E +SG ++FERI    FEL ERE + Y+ Q+ E +
Sbjct: 24928 NIARHRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEAL 24987

Query: 1505  EYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVI 1564
             +++H   I H D++PENI+   +  + IK+I+FG AR+L+   + ++LF  PE+ APEV 
Sbjct: 24988 QFLHSHNIGHFDIRPENIIYQTRRSSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVH 25047

Query: 1565  NYEPIGYATDMWSIGVICYIL--------------------------------------- 1585
              ++ +  ATDMWS+G + Y+L                                       
Sbjct: 25048 QHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKEISIEAM 25107

Query: 1586  ------------NRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVR 1633
                         +R+  ++ LQHPWL +  + +  K +   + ++Y      +K  N V 
Sbjct: 25108 DFVDRLLVKERKSRMTASEALQHPWLKQKIERVSTKVIRTLKHRRYY-HTLIKKDLNMVV 25166

Query: 1634  AIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSK 1693
             +  R+S    I      +S  G   + +    +E    VS   + AV EE  HVK     
Sbjct: 25167 SAARISCGGAI------RSQKGVSVAKVKVASIEI-GPVSGQIMHAVGEEGGHVK----- 25214

Query: 1694  TIRDLEVVEGSAARFDCKIEGY-PDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDV 1752
                           + CKIE Y    +V W+   + +  S  ++I Y EDG   L + D+
Sbjct: 25215 --------------YVCKIENYDQSTQVTWYFGVRQLENSEKYEITY-EDGVAILYVKDI 25259

Query: 1753  CGDDDAKYTCKAVNSLGEATCTAELIVETMEE 1784
                DD  Y CK VN  GE +  AEL V+ + E
Sbjct: 25260 TKLDDGTYRCKVVNDYGEDSSYAELFVKGVRE 25291



 Score =  166 bits (420), Expect = 2e-40
 Identities = 161/707 (22%), Positives = 277/707 (39%), Gaps = 57/707 (8%)

Query: 63    QVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELT 122
             +VTW+++G+ +   G F       GT+ L I+ + E D+G+Y CE +   G  +  ++  
Sbjct: 26376 EVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFM 26435

Query: 123   VEG-----------SFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVV 171
              +            S  K+  Q     T+  +    A E   S      P   T L    
Sbjct: 26436 GQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISS-----KPVIVTGLQDTT 26490

Query: 172   VKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVY 231
             V    + +F+ K TG P+P   W K    +    +  +SE  G   LEIH  +  D G+Y
Sbjct: 26491 VSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLY 26550

Query: 232   TCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAA 291
             TC V N +G  S S +L+I+ +       V   K   S++  +   V+ +E      + A
Sbjct: 26551 TCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQK--TSEITPQKKAVVQEEIS----QKA 26604

Query: 292   AKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQK--TSSSITLQA 349
              +S+     +       A   +      S  E  K S  T+ +  ++ +  T +S   + 
Sbjct: 26605 LRSEEIKMSEAKSQEKLALKEEASKVLIS--EEVKKSAATSLEKSIVHEEITKTSQASEE 26662

Query: 350   ARVQPEPRAPGLGVLSPSGEERKRPAPPRPAT---FPTRQPGLGSQD-----VVSKAANR 401
              R   E +A    +    G+     A    AT   +      L + +     V       
Sbjct: 26663 VRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTL 26722

Query: 402   RIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQD 461
              I     RD       SK +   VK    +    E    +  AP+F S  +   + EGQ+
Sbjct: 26723 TIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKE----LSDAPAFISQPRSQNINEGQN 26778

Query: 462   FVLQCSVRGTPVPRITWLLNGQPIQYARSTC---EAGVAELHIQDALPEDHGTYTCLAEN 518
              +  C + G P P I W  N  PI  + +        V  L I++A   D G YT  A+N
Sbjct: 26779 VLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKN 26838

Query: 519   ALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVS 578
               GQ S +A            S  +LP+   +P+  + L+   D   + GS  + +VQ+S
Sbjct: 26839 FRGQCSATA------------SLMVLPLV-EEPSREVVLRTSGDTS-LQGSFSSQSVQMS 26884

Query: 579   GNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQ 638
              +         + +      +  F     Q    +QE F E + +      N   ++ + 
Sbjct: 26885 ASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMT-QLESS 26943

Query: 639   AVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL-CKDTG 697
                 ++    G  P   + P  ++   G+ + ++CA  G+P P V W   G+ +  ++ G
Sbjct: 26944 TSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQG 27003

Query: 698   HFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQN 744
              F +   +D+ TL++  VQ    G Y + L N  G  S  V++ +++
Sbjct: 27004 RFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRS 27050



 Score =  144 bits (364), Expect = 6e-34
 Identities = 155/657 (23%), Positives = 238/657 (36%), Gaps = 132/657 (20%)

Query: 160  PPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLE 219
            PP+   +L  V V+ G+  RF   I+GRPQP+++W K    L    +           L 
Sbjct: 3192 PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLL 3251

Query: 220  IHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVI 279
            +     +D  VYTC   N  G A+                       T++ +  EV  V+
Sbjct: 3252 LIEAFPEDAAVYTCEAKNDYGVAT-----------------------TSASLSVEVPEVV 3288

Query: 280  SKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQ 339
            S + ++     A  +    +    G P   A  Q +        S     +    +   +
Sbjct: 3289 SPDQEMPVYPPAIITPLQDTVTSEGQP---ARFQCRVSGTDLKVSWYSKDKKIKPSRFFR 3345

Query: 340  KTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAA 399
             T    T Q    +  P   G      S    +                      VS  A
Sbjct: 3346 MTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ----------------------VSSTA 3383

Query: 400  NRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEG 459
            N  + +EG     F KFE    + +   + +V F+ E L      PSF   L    V  G
Sbjct: 3384 N--LSLEG-----FSKFEENTSNSQWHVSLSVSFKKEPLGQK---PSFIQPLSSLRVHNG 3433

Query: 460  QDFVLQCSVRGTPVPRITWLLNGQPIQYARSTC-----EAGVAELHIQDALPEDHGTYTC 514
            +       V G P P I W  N Q I   +          G+A + I DA  E  G Y+C
Sbjct: 3434 ETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQYSC 3493

Query: 515  LAENALGQVSCSAWVTV---------HEK-----------------------------KS 536
             A N+ G+ +C+A +TV         HE+                             + 
Sbjct: 3494 KAANSAGEATCAATLTVTPKAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQL 3553

Query: 537  SRKSEYL-----LPVAPSK------PTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEV 585
            S+ +E L      PV P+K       T PIF++ +S+  +  G   T++V V G P P++
Sbjct: 3554 SKINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKI 3613

Query: 586  IWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQ- 644
             W  NG  +  S D+ F   G  HSL I     ED G YTC A N  G+    A L +  
Sbjct: 3614 QWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINS 3673

Query: 645  --EPHDGTQ-----------------PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHW 685
              E H  T+                 P F+ + + +  + G   +    + G+P PTV W
Sbjct: 3674 KGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTW 3733

Query: 686  LRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLML 742
             ++ K LC    +  +       T ++   Q   +G Y    +N +GE +C   L++
Sbjct: 3734 FKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGESTCAAELLV 3790



 Score =  132 bits (333), Expect = 2e-30
 Identities = 177/693 (25%), Positives = 282/693 (40%), Gaps = 114/693 (16%)

Query: 40   RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF-SLVIHAVHE 98
            +N+ + E  TA FE  V  +  P + W +NG  I    +F +   ++G    L+I     
Sbjct: 2843 KNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIV--VQGKLHQLIIMNTST 2899

Query: 99   EDRGKYTCEATNGSGARQVTV----------------------ELTV--EGSFAKQLGQP 134
            ED  +YT    N   +  +TV                      E+TV  EG   K L   
Sbjct: 2900 EDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNG 2959

Query: 135  VVSKT---------------------LGDR----FSAPAVETRPSIWGECPP-KFATKLG 168
            V  K+                      GD     F A    +  +++ E    +F   + 
Sbjct: 2960 VEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIK 3019

Query: 169  RVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDV 228
             + V E +   F C+++  P   V W+K +  LQ + R+ + ++  +  L I      D 
Sbjct: 3020 DIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDA 3078

Query: 229  GVYTCLVVNGSGKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSL 288
            G YT +    +G    +A+L ++G D   RS           ++KEV  VI K+  +   
Sbjct: 3079 GKYTVV----AGGNVSTAKLFVEGRDVRIRS-----------IKKEV-QVIEKQRAVVEF 3122

Query: 289  EAAAKSKNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPR----TAPQTPVLQKTSSS 344
            E      +    + G    +    + +   E ++     S          T V  +  SS
Sbjct: 3123 EVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSS 3182

Query: 345  ITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLG---SQDVVSKAANR 401
            +TL     +P P+   L  L P   +  +PA          QP +     + ++S     
Sbjct: 3183 VTLYVNAPEP-PQV--LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKC 3239

Query: 402  RIPMEGQRDS-----AFPKFESKPQSQEVKENQTVKFRCEGLAVM--EVA---------- 444
            +   +GQ  +     AFP+ ++   + E K +  V      L+V   EV           
Sbjct: 3240 KFLHDGQEYTLLLIEAFPE-DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3298

Query: 445  PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQ---PIQYARSTCEAGVAELHI 501
            P+  + L+D    EGQ    QC V GT + +++W    +   P ++ R T      +L I
Sbjct: 3299 PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3357

Query: 502  QDALPEDHGTYTCLAENALGQVSCSAWVTVH------EKKSSRKSEYLLPVAPSKPTA-- 553
             +A PED GTYT +A NA+GQVS +A +++       E  S+ +    L V+  K     
Sbjct: 3358 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEGFSKFEENTSNSQWHVSLSVSFKKEPLGQ 3417

Query: 554  -PIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESED--FHFEQRGTQHS 610
             P F+Q LS L+V +G  V    +VSG P PE+ W HN   I  ++D  FHFE+      
Sbjct: 3418 KPSFIQPLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMAL 3477

Query: 611  LCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTV 643
            + I + + E  G Y+C+A NSAGE    A LTV
Sbjct: 3478 MLIVDAYSEHAGQYSCKAANSAGEATCAATLTV 3510



 Score =  132 bits (332), Expect = 3e-30
 Identities = 155/680 (22%), Positives = 250/680 (36%), Gaps = 97/680 (14%)

Query: 2    GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPE 61
            G+   VA  + S  +L V+          E P  +   + + ++ G  A+F   + G P+
Sbjct: 3170 GEYTFVAGRNRSSVTLYVNAP--------EPPQVLQELQPVTVQSGKPARFCAVISGRPQ 3221

Query: 62   PQVTWHRNGQPITSGGR--FLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTV 119
            P+++W++  Q +++G +  FL D      ++L++     ED   YTCEA N  G    + 
Sbjct: 3222 PKISWYKEEQLLSTGFKCKFLHD---GQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSA 3278

Query: 120  ELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGR 179
             L+VE                      P V +        PP   T L   V  EGQ  R
Sbjct: 3279 SLSVE---------------------VPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPAR 3317

Query: 180  FSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGS 239
            F C+++G    +V+W   +  ++PS    +++      LEI     +D G YT +  N  
Sbjct: 3318 FQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAV 3376

Query: 240  GKASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKE---------SKLDSLEA 290
            G+ S +A LS++G          E   +NS     ++    KE           L SL  
Sbjct: 3377 GQVSSTANLSLEGFSKF------EENTSNSQWHVSLSVSFKKEPLGQKPSFIQPLSSLRV 3430

Query: 291  AAKSKNCSSPQRGGSP----PWAANSQPQPPRESKLESCKDS------------PRTAPQ 334
                      +  G P     W  N Q   P +  +   ++S               A Q
Sbjct: 3431 HNGETVRFHARVSGIPKPEIQWFHNQQLILPTKDVVFHFEESTGMALMLIVDAYSEHAGQ 3490

Query: 335  TPVLQKTSSSITLQAARVQPEPRAPGLGVLSPSGEERKRPAPPRPATF-PTRQPGLGSQD 393
                   S+     AA +   P+AP   +     +E +       ++F    + GL S +
Sbjct: 3491 YSCKAANSAGEATCAATLTVTPKAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAE 3550

Query: 394  VVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKD 453
            +     N  + +  +      KF+S+ +                       P F   + +
Sbjct: 3551 LQLSKINETLELLSESPVYPTKFDSEKEG--------------------TGPIFIKEVSN 3590

Query: 454  CAVIEGQDFVLQCSVRGTPVPRITWLLNG---QPIQYARSTCEAGVAELHIQDALPEDHG 510
              +  G    L  +V G P P+I W  NG    P    +   +     L I     ED G
Sbjct: 3591 ADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEG 3650

Query: 511  TYTCLAENALGQVSCSAWVTVHEKKSSRK-SEYLLPVAPS-----KPTAPIFLQGLSDLK 564
             YTC+A N  G+  CSA++ ++ K    K +E    VA S      P  P FL+ L  ++
Sbjct: 3651 EYTCMASNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIR 3710

Query: 565  VMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH-FEQRGTQHSLCIQEVFPEDTGT 623
               G        V G P P V W     ++  S  +          +  + +   ED+G 
Sbjct: 3711 CAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGL 3770

Query: 624  YTCEAWNSAGEVRTQAVLTV 643
            Y C+A N  GE    A L V
Sbjct: 3771 YICKAENMLGESTCAAELLV 3790



 Score =  122 bits (306), Expect = 3e-27
 Identities = 158/734 (21%), Positives = 285/734 (38%), Gaps = 96/734 (13%)

Query: 666   GQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEI 725
             G  + ++  I G PFP   W ++G+ + K      +  +E    LV+K+     +G Y++
Sbjct: 23779 GGVIRLTIPIKGKPFPICKWTKEGQDISK---RAMIATSETHTELVIKEADRGDSGTYDL 23835

Query: 726   LLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGV------GADGGGSDRYGS 779
             +L+N+ G+ +  + + +  S     P G  P   +D+    V       AD GG+D  G 
Sbjct: 23836 VLENKCGKKAVYIKVRVIGSPNS--PEG--PLEYDDIQVRSVRVSWRPPADDGGADILGY 23891

Query: 780   LRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKK--VS 837
             +          W   +    VRG        +++ E   R     Q      L  +  V+
Sbjct: 23892 ILERREVPKAAWYTID--SRVRGTSLVVKGLKENVEYHFRVSAENQFGISKPLKSEEPVT 23949

Query: 838   TKT-LSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKKGT--S 894
              KT L+  +    P E +D   +       +   +   +V +   ++ +     K    +
Sbjct: 23950 PKTPLNPPEPPSNPPEVLDVTKSSVSLSWSRPKDDGGSRV-TGYYIERKETSTDKWVRHN 24008

Query: 895   KTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNA-KAVESSKPLSNAQPSGP 953
             KT +   +       PD       + ++ A+N    +ET  A + V    P       G 
Sbjct: 24009 KTQITTTMYTVTGLVPDAEY----QFRIIAQNDVGLSETSPASEPVVCKDPFDKPSQPGE 24064

Query: 954   LKPVGNAKPAETL---KP-MGNAKPAETLKPMGNAKPDENLKSASKEELKKD-------- 1001
             L+ +  +K + TL   KP     K             D   K ++KE +K          
Sbjct: 24065 LEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLL 24124

Query: 1002  ----------VKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQ 1051
                        +N+    R    T  + K   + G AP  +++++DV    G+   L CQ
Sbjct: 24125 EATEYEFRVFAENETGLSRPRR-TAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQ 24183

Query: 1052  VSSDPPATIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAE 1111
             +   P   I W   GK L  ++   +S +G   ++++     ED G+Y C+A N+ G+ E
Sbjct: 24184 IVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVE 24243

Query: 1112  CSCQVTVDDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQI 1171
              S ++ +   P                                    P  P K       
Sbjct: 24244 TSSKLLLQATPQFH---------------------------------PGYPLK------- 24263

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTIL-A 1230
                 E      G ++ L     G      TW   +K +Q SE++ +EN+E+ + L +   
Sbjct: 24264 ----EKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNV 24319

Query: 1231  ARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDG 1290
              R+ H G Y + + N  G+  A +++ + DKPD P G      +  +S  +SW   + DG
Sbjct: 24320 QRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDG 24379

Query: 1291  GSAVQSYSIEIWDS-ANKTWKELATCRS-TSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ 1348
             GS + +Y +E  ++     W+ +++  S T+  + +L  +  Y FRV A N +G S+P +
Sbjct: 24380 GSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLE 24439

Query: 1349  ESELTTVGEKPEEP 1362
              S +  +    E+P
Sbjct: 24440 VSSVVIIKSPFEKP 24453



 Score =  118 bits (295), Expect = 6e-26
 Identities = 175/807 (21%), Positives = 305/807 (37%), Gaps = 149/807 (18%)

Query: 552  TAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSL 611
            T P  + GL ++ V++G  VT+   +SG P P V W     +I+ S DF    +     L
Sbjct: 895  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 954

Query: 612  CIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQE-------------------------- 645
             I+E F ED+G +TC A N AG V T   L VQ                           
Sbjct: 955  MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1014

Query: 646  ---------------PHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGK 690
                           P +   P+FI+KP       G SV+  C + G+P P V+W + G 
Sbjct: 1015 DVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1074

Query: 691  ALCKDTGH-FEVLQNEDV--FTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSA 747
             L   TG+ ++V  N+      LV+       AG+Y I+++N+ GE S   SL L+ +  
Sbjct: 1075 PL--TTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL-LEEADY 1131

Query: 748  RALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWP-ARGQGWLEEEDGEDVRGVLKR 806
              L + ++    +      V        + G   PG+  +  +   E+E     + + K 
Sbjct: 1132 ELLMKSQQEMLYQTQVTAFV-----QEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKD 1186

Query: 807  RVETRQHTEEAIRQQEVEQLDFRDLLGKKVS---TKTLSEDDLKEIPAEQMDFRANLQRQ 863
             V  R + E+    QE     F + L K++     KT  E+ L+E   E+M    +    
Sbjct: 1187 TVVVRTYVED----QEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEA 1242

Query: 864  VKPKTVSEEERKVHSPQQVDFRSVLAKKGTSKTPVP--------EKVPPPKPATPDF--- 912
            V+    S  + ++ + + ++   V      S  P+P        +++   +    DF   
Sbjct: 1243 VE----SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQD 1298

Query: 913  -RSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSG-----PLKPVGNAKPAETL 966
             R+ L     LP + G  +A   N K         NA  SG     P  P+G      TL
Sbjct: 1299 GRASLRIPVVLPEDEGIYTAFASNIK--------GNAICSGKLYVEPAAPLGAPTYIPTL 1350

Query: 967  KPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRGHAGTTDNEKRSESQG 1026
            +P+   +   +L P   ++    +  A     +         +       +    S+ + 
Sbjct: 1351 EPVSRIR---SLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLER 1407

Query: 1027 T-APAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT--TKFIILSQEGSL 1083
               P F  K       EG+      +V   P     W  +G+ +    T  +++ ++G+ 
Sbjct: 1408 LYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ 1467

Query: 1084 CSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPEMKSRRPKSSLPP 1143
             S+ I  A P D G +  VA+N AG++  S  +TV+                        
Sbjct: 1468 -SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV---------------------- 1504

Query: 1144 VLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWM 1203
                                +  + P  ++  ++  ++ G  +E+  + TG       W+
Sbjct: 1505 --------------------EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWL 1544

Query: 1204 KFRKQIQESEH--MKVENSENGSKLTILAARQEHCGCYTLLVENKLG--SRQAQVNLTV- 1258
            K    I   ++  +++E ++  + L I +   +    YT    NK G  + + +VN+ V 
Sbjct: 1545 KNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1604

Query: 1259 VDKPDP------PAGTPCASDIRSSSL 1279
              +P+P      P GT  A +I +  L
Sbjct: 1605 FAEPEPERKLIIPRGTYRAKEIAAPEL 1631



 Score =  113 bits (282), Expect = 2e-24
 Identities = 211/1044 (20%), Positives = 358/1044 (34%), Gaps = 249/1044 (23%)

Query: 533   EKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGN 592
             +K S RK E L     +   AP     +   +V  G      + V   P  EV W HNG 
Sbjct: 25981 QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGV 26040

Query: 593   EIQESE----------------DFHFEQRGTQHSLCI----------------------- 613
             E+QES                 D H +  GT  ++C                        
Sbjct: 26041 ELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYA 26100

Query: 614   ---------QEVFPEDTGTYT-----------CEAWNSAGEVRTQAVLTVQE----PHDG 649
                      + VFPE T T              EA +S  EV++Q   T +      H  
Sbjct: 26101 SQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSA 26160

Query: 650   TQPW--------------------------FISKPRSVTASLGQSVLISCAIAGDPFPTV 683
             +                              ++KPRS+T   G+S   SC   G+P PTV
Sbjct: 26161 SAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTV 26220

Query: 684   HWLRDGKALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
              WLR G+ L     H +V   +   T  +  VQ    G Y ++++N  G+   + +L +Q
Sbjct: 26221 TWLRKGQVLSTSARH-QVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ 26279

Query: 744   NS------------------------SARALPRGREPASCEDLCGGGVGADGGGSDRYGS 779
              +                        + ++  R + P                 +++   
Sbjct: 26280 KARVTEKAVTSPPRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQH 26339

Query: 780   LRPGWPARGQGWLEEEDGEDVR--------GVLKRRVETRQHTEEAIRQQEVEQLDFRDL 831
             L    P +   +L+ E  +++          VL+ +  T     + +++    Q  +   
Sbjct: 26340 LPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSAD 26399

Query: 832   LGKKVSTKTLSEDD----LKEIPAEQMDFRANLQRQVKP-KTVSEEERKVHSPQQVDFR- 885
                ++    L+E D    + EI  E    + NLQ   +  K++ E+  K+   ++ D + 
Sbjct: 26400 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 26459

Query: 886   --SVLAKKGTSKTPVPEKVPP--------------------------PKPA---TPDFRS 914
               S + +K   K P P    P                          P+P    T D ++
Sbjct: 26460 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 26519

Query: 915   VL-GGKKKLPAENGS---------------------------SSAETLNAKAVESSKPLS 946
             +  GGK KL  + G                            SS+  L  KA++ ++   
Sbjct: 26520 ITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQK 26579

Query: 947   -NAQPSGPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENL---KSASK----EEL 998
              + Q +  + P   A   E +     A  +E +K M  AK  E L   + ASK    EE+
Sbjct: 26580 VSTQKTSEITPQKKAVVQEEISQ--KALRSEEIK-MSEAKSQEKLALKEEASKVLISEEV 26636

Query: 999   KKDVKNDVNCKRGHAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPA 1058
             KK     +     H   T   + SE   T    K     + + EG++L+L+  ++     
Sbjct: 26637 KKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG--AT 26694

Query: 1059  TIIWTLNGKTLKTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV 1118
              + W LNG  L  ++       GS  +++I++A   D G+  C++K   G  +C   +T+
Sbjct: 26695 DVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL 26754

Query: 1119  DDAPASENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQ 1178
                       + E+                SDA                 P  I  P  Q
Sbjct: 26755 ----------SKEL----------------SDA-----------------PAFISQPRSQ 26771

Query: 1179  KVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
              +  G++V    +++G       W K    I  S ++ +  S N   L I  A     G 
Sbjct: 26772 NINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGK 26831

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYS 1298
             YT+  +N  G   A  +L V+   + P+          +SL  S+   S    ++ Q  S
Sbjct: 26832 YTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEAS 26891

Query: 1299  IEIWDSANKTWKELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQ----ESELTT 1354
                + S++ +   +   +  S + Q +    E    + + +  G S  +Q     S++  
Sbjct: 26892 FSSFSSSSAS--SMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLK 26949

Query: 1355  VGEKPEEPKDEVEVSDDDEKEPEV 1378
              G +   PK E   SD    E +V
Sbjct: 26950 AGIRGIPPKIEALPSDISIDEGKV 26973



 Score =  111 bits (278), Expect = 6e-24
 Identities = 67/201 (33%), Positives = 103/201 (51%), Gaps = 4/201 (1%)

Query: 1167  MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKL 1226
             +PP+I+  PE   ++AG+ + +   V G    TC W K   ++  S H+ V  +++ S L
Sbjct: 12526 LPPKILM-PEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSIL 12584

Query: 1227  TILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGS 1286
              I    ++  G Y+L  EN  G+   ++ + V+D P PP      SDI + + +LSW+  
Sbjct: 12585 IIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPFDISDIDADACSLSWHIP 12644

Query: 1287  SYDGGSAVQSYSIEIWDSANKTW-KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSE 1345
               DGGS + +Y +E  D +   W   LA+   TS  V  L+P  EY FRVRA N +G SE
Sbjct: 12645 LEDGGSNITNYIVEKCDVSRGDWVTALASVTKTSCRVGKLIPGQEYIFRVRAENRFGISE 12704

Query: 1346  PSQESELTTVGE--KPEEPKD 1364
             P    ++        P EPK+
Sbjct: 12705 PLTSPKMVAQFPFGVPSEPKN 12725



 Score =  110 bits (276), Expect = 9e-24
 Identities = 154/692 (22%), Positives = 268/692 (38%), Gaps = 99/692 (14%)

Query: 63   QVTWHRNGQPITSGGRF--LLDCGIRGTFSLVIHAVHEED-RGKYTCEATNGSGARQVTV 119
            +V W+   + + S  +F  L D   + T++LVI  V+ ED +G+Y CEA N SG    + 
Sbjct: 4396 EVNWYFENKLVPSDEKFKCLQD---QNTYTLVIDKVNTEDHQGEYVCEALNDSGKTATSA 4452

Query: 120  ELTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGR 179
            +LTV    A     PV+ +                           K+  + V  G + +
Sbjct: 4453 KLTVVKRAA-----PVIKR---------------------------KIEPLEVALGHLAK 4480

Query: 180  FSCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGS 239
            F+C+I   P  +  W K    +  S + S+     +  LEI      D G YTC   N  
Sbjct: 4481 FTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEY 4540

Query: 240  GKASMSAEL--SIQGLDSANRSFVRETKATNSDVRKEVT--NVISKESKLDSLEAAAKS- 294
            G  S +A L  ++ G +   R  + E K    + ++EV   +V+ K  + +  +   K  
Sbjct: 4541 GSVSCTATLTVTVPGGEKKVRKLLPERK---PEPKEEVVLKSVLRKRPEEEEPKVEPKKL 4597

Query: 295  KNCSSPQRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQP 354
            +    P     PP      P+P  E ++ +     R  P+   + +   +I L A   +P
Sbjct: 4598 EKVKKPAVPEPPP------PKPVEEVEVPTVTKRERKIPEPTKVPEIKPAIPLPAPEPKP 4651

Query: 355  EPRAPGLGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFP 414
            +P A    +  P  E    P    P T P       ++    +AA  + P++G       
Sbjct: 4652 KPEAEVKTIKPPPVEPEPTPI-AAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPS 4710

Query: 415  KFES-----KPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIE----GQDFVLQ 465
              E+     +P S   K      F  +   +  V   F   +KD  + E    G   + +
Sbjct: 4711 PIEAERRKLRPGSGGEKPPDEAPFTYQ---LKAVPLKFVKEIKDIILTESEFVGSSAIFE 4767

Query: 466  CSVRGTPVPRI-TWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALG 521
            C V  +P   I TW+ +G  I+ +   R   +    +LHI D    D G YTC+      
Sbjct: 4768 CLV--SPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNK 4825

Query: 522  QVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQGL-SDLKVMDGSQVTMTVQVSGN 580
            + + +A + V E          LPV         F++ L  ++ V+ G  + ++ ++  N
Sbjct: 4826 EKTSTAKLVVEE----------LPVR--------FVKTLEEEVTVVKGQPLYLSCEL--N 4865

Query: 581  PPPEVIWLHNGNEIQESEDFHFE-QRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQA 639
               +V+W  +G  + E          G   +L I +    D GTYT    N+     +  
Sbjct: 4866 KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSC 4925

Query: 640  VLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL-CKDTGH 698
            V  V+   D    W +   R        + + +C IA D  P + W +    +  +    
Sbjct: 4926 VKVVEVIRD----WLVKPIRDQHVKPKGTAIFACDIAKDT-PNIKWFKGYDEIPAEPNDK 4980

Query: 699  FEVLQNEDVFTLVLKKVQPWHAGQYEILLKNR 730
             E+L++ +   L +K   P    +Y + ++ +
Sbjct: 4981 TEILRDGNHLYLKIKNAMPEDIAEYAVEIEGK 5012



 Score =  110 bits (275), Expect = 1e-23
 Identities = 73/206 (35%), Positives = 104/206 (50%), Gaps = 21/206 (10%)

Query: 444 APSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-----RSTCEAGVAE 498
           AP+F+  L+   V+EG     +  + G PVP ++W  +GQ I  +     + +   G A+
Sbjct: 5   APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64

Query: 499 LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKPTAPIFLQ 558
           L I      + G Y+  A N  GQ + +A + V       K+E     AP     P F+Q
Sbjct: 65  LTIPAVTKANSGRYSLKATNGSGQATSTAELLV-------KAE----TAP-----PNFVQ 108

Query: 559 GLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQHSLCIQEVFP 618
            L  + V  GSQV + V+V+G P P V +  +G EIQ S DF   Q G  +SL I E +P
Sbjct: 109 RLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYP 168

Query: 619 EDTGTYTCEAWNSAGEVRTQAVLTVQ 644
           ED+GTY+  A NS G   + A L VQ
Sbjct: 169 EDSGTYSVNATNSVGRATSTAELLVQ 194



 Score =  109 bits (272), Expect = 3e-23
 Identities = 83/306 (27%), Positives = 137/306 (44%), Gaps = 57/306 (18%)

Query: 30  TEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTF 89
           T+AP F  P +++ + EG+TA FE  + G+P P+V+W R+GQ I++        G++ +F
Sbjct: 3   TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTL----PGVQISF 58

Query: 90  S-----LVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGDRF 144
           S     L I AV + + G+Y+ +ATNGSG    T EL V+   A                
Sbjct: 59  SDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETA---------------- 102

Query: 145 SAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLKGNVPLQPS 204
                          PP F  +L  + V++G   R   ++TG P P V + +    +Q S
Sbjct: 103 ---------------PPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSS 147

Query: 205 ARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQG------------ 252
               +S++  +  L I     +D G Y+    N  G+A+ +AEL +QG            
Sbjct: 148 LDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTI 207

Query: 253 LDSANRSFVRETKATNS-DVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAAN 311
           + +A  S  R+T+     +   +  ++ + E  +D   AA +     +P R   PP   +
Sbjct: 208 VSTAQISESRQTRIEKKIEAHFDARSIATVEMVIDG--AAGQQLPHKTPPR--IPPKPKS 263

Query: 312 SQPQPP 317
             P PP
Sbjct: 264 RSPTPP 269



 Score =  109 bits (272), Expect = 3e-23
 Identities = 65/193 (33%), Positives = 101/193 (52%), Gaps = 3/193 (1%)

Query: 1180 VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
            V+AG  +EL   VTG      TW K    +++ + + +EN    S +TI+ +++   G Y
Sbjct: 7330 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 7389

Query: 1240 TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             +   N  G   A V + V+DKP PPA     +D+ + S  L+W     DGGS + +Y +
Sbjct: 7390 IIEAVNVCGRATAVVEVNVLDKPGPPAAFD-ITDVTNESCLLTWNPPRDDGGSKITNYVV 7448

Query: 1300 EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGE- 1357
            E   + ++ W +L +T + T+F    L+P+ EY FRV A N+YG  EP Q S +T   + 
Sbjct: 7449 ERRATDSEVWHKLSSTVKDTNFKATKLIPNKEYIFRVAAENMYGVGEPVQASPITAKYQF 7508

Query: 1358 KPEEPKDEVEVSD 1370
             P  P   +E SD
Sbjct: 7509 DPPGPPTRLEPSD 7521



 Score =  107 bits (266), Expect = 1e-22
 Identities = 159/700 (22%), Positives = 240/700 (34%), Gaps = 154/700 (22%)

Query: 40   RNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEE 99
            +N  I EG    F  ++ GYP P++ W+++G+ I  G R+ +D    G  SL I  V  E
Sbjct: 1252 KNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPE 1311

Query: 100  DRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTLGD----RFSAPAVETRPSI 155
            D G YT  A+N  G    + +L VE   A  LG P    TL      R  +P   +R  I
Sbjct: 1312 DEGIYTAFASNIKGNAICSGKLYVEP--AAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPI 1369

Query: 156  WGE------------------------------------CPPKFATKLGRVVVKEGQMGR 179
                                                     P F  K       EGQ  R
Sbjct: 1370 RMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTAR 1429

Query: 180  FSCKITGRPQPQVTWL-KGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNG 238
            F  K+ GRP P+  W   G   +       V +++G Q L I      D G +T +  N 
Sbjct: 1430 FDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNR 1489

Query: 239  SGKASMSAELSIQGLD-SANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNC 297
            +G++S+S  L+++ ++      FV + K  N          I + S+L+    A  + N 
Sbjct: 1490 AGRSSISVILTVEAVEHQVKPMFVEKLKNVN----------IKEGSRLEMKVRATGNPN- 1538

Query: 298  SSPQRGGSPPWAANSQ---PQPPRESKLESCKDSPRTAPQTPVLQ--------------- 339
                      W  NS    P    + ++E  K        + V Q               
Sbjct: 1539 ------PDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR 1592

Query: 340  -KTSSSITLQAARVQPEPRAPGLGVLSPSGEER-KRPAPP--RPATFPTRQPGLGSQDVV 395
              T   + ++    +PEP      ++ P G  R K  A P   P      Q      D+ 
Sbjct: 1593 DTTRCKVNVEVEFAEPEPERK---LIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLY 1649

Query: 396  SKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCA 455
             K   ++           P F+ K  S  +K      F C    +               
Sbjct: 1650 DKEKQQK-----------PFFKKKLTSLRLKRFGPAHFECRLTPI--------------- 1683

Query: 456  VIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTY 512
                          G P   + WL +G+P++ A   R   E G   L    A   D G  
Sbjct: 1684 --------------GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGII 1729

Query: 513  TCLAENALGQVSCSAWVTVHEKKSSRKSEYL------------------------LPVAP 548
            TC A N  G    SA + V ++KS  +   L                        +    
Sbjct: 1730 TCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQ 1789

Query: 549  SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQ 608
             +   P  +     ++V++G       +V+G P P+V W  NG  I++S+ F     G  
Sbjct: 1790 KEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI- 1848

Query: 609  HSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
            H L I +    DTG     A N  G +  +  L +Q+  D
Sbjct: 1849 HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1888



 Score =  102 bits (253), Expect = 4e-21
 Identities = 57/185 (30%), Positives = 97/185 (52%), Gaps = 7/185 (3%)

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAA 1231
             +++ E  K RAG SV+L   ++G    T  W K  K++Q +  + VEN+ + + + I  A
Sbjct: 20504 LEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDA 20563

Query: 1232  RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGG 1291
              + + GCY L + N +GS  A + + ++DKP PP G      + +  +TL W   + DGG
Sbjct: 20564 DRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEKITLLWRPPADDGG 20623

Query: 1292  SAVQSYSIEIWDSANKTW----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPS 1347
             + +  Y +E  +++   W    + L  C  T+  +   +  +EY FRVRA+N YG  EP 
Sbjct: 20624 AKITHYIVEKRETSRVVWSMVSEHLEECIITTTKI---IKGNEYIFRVRAVNKYGIGEPL 20680

Query: 1348  QESEL 1352
             +   +
Sbjct: 20681 ESDSV 20685



 Score =  101 bits (252), Expect = 6e-21
 Identities = 76/249 (30%), Positives = 112/249 (44%), Gaps = 8/249 (3%)

Query: 1167  MPPQI---IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENG 1223
             +PP +   ++  E   V+AG +V     + G    T  W     +I+  EH  VE     
Sbjct: 11134 VPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS 11193

Query: 1224  SKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSW 1283
             S LTI    +   G Y + V N  GS+   V+LTV+D P PP G     D+    +T+SW
Sbjct: 11194 SVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISW 11253

Query: 1284  YGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQDLLPDHEYKFRVRAINVYG 1342
                  DGGS V +Y +E  D+   TW  +++  S T   +  L    EY FRVRA N  G
Sbjct: 11254 QPPKDDGGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIG 11313

Query: 1343  TSEPSQESELTTVGEK--PEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEER 1400
                P  +S  T    K  P  P  +  V+D  E    V +     +    ++ +Y +E R
Sbjct: 11314 VG-PPLDSTPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYY-MERR 11371

Query: 1401  LGSGKFGQV 1409
               +GK+ +V
Sbjct: 11372 EVTGKWVRV 11380



 Score =  101 bits (252), Expect = 6e-21
 Identities = 58/205 (28%), Positives = 104/205 (50%), Gaps = 6/205 (2%)

Query: 1162  PPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSE 1221
             PP+ +M P+   + +   V AGES ++   + G    T  W+K  +++  +  +++++++
Sbjct: 16168 PPRISMDPK---YKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTD 16224

Query: 1222  NGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTL 1281
               + L++  A +   G Y L  +N  G R   VN+ V+D+P PP G    S + +   TL
Sbjct: 16225 FATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEGPVVISGVTAEKCTL 16284

Query: 1282  SWYGSSYDGGSAVQSYSIEIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINV 1340
             +W     DGGS + +Y +E  +++   W  + A  ++ S  V  LL  +EY FR+ A+N 
Sbjct: 16285 AWKPPLQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTFRIMAVNK 16344

Query: 1341  YGTSEPSQESELTTVGE--KPEEPK 1363
             YG  EP +   +        P+ PK
Sbjct: 16345 YGVGEPLESEPVVAKNPFVVPDAPK 16369



 Score =  101 bits (251), Expect = 7e-21
 Identities = 78/253 (30%), Positives = 112/253 (44%), Gaps = 15/253 (5%)

Query: 1174  FPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQ 1233
             F +   VRAG S+ LF    G    T  W K    +  S    +  +++ S LT+    +
Sbjct: 21991 FKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNR 22048

Query: 1234  EHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSA 1293
                G YTL VEN  GS+     + V+D P PP G     D+   S TL W     DGG+ 
Sbjct: 22049 NDAGKYTLTVENNSGSKSITFTVKVLDTPGPP-GPITFKDVTRGSATLMWDAPLLDGGAR 22107

Query: 1294  VQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESEL 1352
             +  Y +E  +++ ++W+ ++  C    F V DL     Y FRV A+N YG  EP +  E 
Sbjct: 22108 IHHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 22167

Query: 1353  TTVGEKPEEPK--DEVEVSDDDE----KEPEVD----YRTVTINTEQKVSDFYDIEERLG 1402
                 E+P  P+  D V+ S         +P+ D         +   QK SDF+ +E    
Sbjct: 22168 IVATEQPAPPRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFW-VEAGHT 22226

Query: 1403  SGKFGQVFRLVEK 1415
                   V RLVEK
Sbjct: 22227 KQLTFTVERLVEK 22239



 Score =  100 bits (250), Expect = 1e-20
 Identities = 71/255 (27%), Positives = 119/255 (46%), Gaps = 20/255 (7%)

Query: 1172  IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAA 1231
             ++F +   ++AGE+  L   V+G  P T  W K  K+++ +  ++++ ++  + L    +
Sbjct: 15093 VKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS 15152

Query: 1232  RQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGG 1291
              +   G YTL   N  G  +   N+ V+D+P PP G    +++ S    LSW+    DGG
Sbjct: 15153 TRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVTEVTSEKCVLSWFPPLDDGG 15212

Query: 1292  SAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQES 1350
             + +  Y ++  +++   W  +A+  + T   V  LL  +EY FRV A+N YG  EP +  
Sbjct: 15213 AKIDHYIVQKRETSRLAWTNVASEVQVTKLKVTKLLKGNEYIFRVMAVNKYGVGEPLESE 15272

Query: 1351  ELTTVGE--KPEEPKD-EVEVSDDDEK-----EPEVDYRTVTINTEQKVSDFYDIEERLG 1402
              +  V     P+ PK+ EV     D        P+ D  +  IN        Y +E R  
Sbjct: 15273 PVLAVNPYGPPDPPKNPEVTTITKDSMVVCWGHPDSDGGSEIIN--------YIVERR-- 15322

Query: 1403  SGKFGQVFRLVEKKT 1417
               K GQ +    KKT
Sbjct: 15323 -DKAGQRWIKCNKKT 15336



 Score =  100 bits (249), Expect = 1e-20
 Identities = 57/166 (34%), Positives = 88/166 (53%), Gaps = 1/166 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V AGE +++     G      TW K    ++++  +  E++EN S LTI  A +E  G Y
Sbjct: 15787 VLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHY 15846

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + + N  G     +N+ V+DKP PP G     ++ + S+TLSW    YDGGS++ +Y +
Sbjct: 15847 VVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIV 15906

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTS 1344
             E  D++  TW+ + AT   T+     L    EY+FR+ A N YG S
Sbjct: 15907 EKRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKS 15952



 Score =  100 bits (248), Expect = 2e-20
 Identities = 76/305 (24%), Positives = 116/305 (38%), Gaps = 60/305 (19%)

Query: 443  VAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPI----QYARSTCEAGVAE 498
            V   F S +K+  ++EG      C + G P+P+I W  +G+ I    +Y     + G A 
Sbjct: 1243 VESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRAS 1302

Query: 499  LHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEY---LLPVAPSKPTAP- 554
            L I   LPED G YT  A N  G   CS  + V          Y   L PV+  +  +P 
Sbjct: 1303 LRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPR 1362

Query: 555  -------------------------------------------------IFLQGLSDLKV 565
                                                             +F+      K 
Sbjct: 1363 SVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKC 1422

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEI--QESEDFHFEQRGTQHSLCIQEVFPEDTGT 623
            ++G      ++V G P PE  W H+G +I    +     ++ GTQ SL I    P D+G 
Sbjct: 1423 LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ-SLIIVPATPSDSGE 1481

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTV 683
            +T  A N AG      +LTV+      +P F+ K ++V    G  + +     G+P P +
Sbjct: 1482 WTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDI 1541

Query: 684  HWLRD 688
             WL++
Sbjct: 1542 VWLKN 1546



 Score =  100 bits (248), Expect = 2e-20
 Identities = 66/237 (27%), Positives = 109/237 (45%), Gaps = 19/237 (8%)

Query: 1167 MPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKF-------RKQIQESEHMKVEN 1219
            MPP I    E  +V  G +V +  K+ G    T TW K        ++ +    H+    
Sbjct: 9744 MPPSI-DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLV 9802

Query: 1220 SENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSL 1279
             ++   L I  +R+   G YT+   N LG+   ++ L V+ +P PP G      + +  +
Sbjct: 9803 VDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQM 9862

Query: 1280 TLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAI 1338
            TLSW+    DGGS + +Y IE  ++  KTW  +++  +  ++ +  LL  HEY FR+ A 
Sbjct: 9863 TLSWFPPKDDGGSKITNYVIEKREANRKTWVHVSSEPKECTYTIPKLLEGHEYVFRIMAQ 9922

Query: 1339 NVYGTSEPSQESELTTVGEKPEEPKD--EVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
            N YG  EP        +  +PE  ++   V  + D      V   ++T+N E+   D
Sbjct: 9923 NKYGIGEP--------LDSEPETARNLFSVPGAPDKPTVSSVTRNSMTVNWEEPEYD 9971



 Score = 99.4 bits (246), Expect = 3e-20
 Identities = 59/189 (31%), Positives = 97/189 (51%), Gaps = 4/189 (2%)

Query: 1163  PKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSEN 1222
             P+ +M P+   F +   V AGE+  L   V G    T  W++  K+I+ES   +++N++ 
Sbjct: 17251 PRISMDPK---FRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 17307

Query: 1223  GSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLS 1282
              + L +  A +   G Y L   N  GS+   VN+ V+D+P PP G    + + S   +L+
Sbjct: 17308 KALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVTGVTSEKCSLT 17367

Query: 1283  WYGSSYDGGSAVQSYSIEIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVY 1341
             W     DGGS +  Y +E  +++   W  +A+   + S  V  LL  +EY FR+ A+N Y
Sbjct: 17368 WSPPLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKY 17427

Query: 1342  GTSEPSQES 1350
             G  EP + +
Sbjct: 17428 GVGEPLESA 17436



 Score = 99.0 bits (245), Expect = 4e-20
 Identities = 98/385 (25%), Positives = 150/385 (38%), Gaps = 54/385 (14%)

Query: 302  RGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPGL 361
            R  SP +  +    P  E   E+       A     L  TSS     A ++    +AP  
Sbjct: 764  RTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSS-----AQKITKSVKAP-- 816

Query: 362  GVLSPSGEERKRPAPPRPATFP------TRQPGLGSQDVVSKAANRRIPMEGQRDSAFPK 415
              + PS E R R  P     FP      T +   G +  V K     I     R+  F  
Sbjct: 817  -TVKPS-ETRVRAEPTPLPQFPFADTPDTYKSEAGVE--VKKEVGVSITGTTVREERFEV 872

Query: 416  FESKPQSQEVKENQTVKFRCEGLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGTPVPR 475
               +    E K  +T +     + +    P+  S LK+  VIEG+   L+C + G P P 
Sbjct: 873  LHGR----EAKVTETARVPAP-VEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPT 927

Query: 476  ITWLLNGQPIQYA---RSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVH 532
            +TW      I+ +   + T ++G+A L I++A  ED G +TC A N  G VS S ++ V 
Sbjct: 928  VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ 987

Query: 533  -----EKKSSRKSEYLLP----------------------VAPSKPTAPIFLQGLSDLKV 565
                 EK+++  +E                            P +P AP F+      K+
Sbjct: 988  VSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKL 1047

Query: 566  MDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDF--HFEQRGTQHSLCIQEVFPEDTGT 623
            ++G  V    QV GNP P V W  +G  +     +   + ++  +  L I   F +D G 
Sbjct: 1048 VEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGE 1107

Query: 624  YTCEAWNSAGEVRTQAVLTVQEPHD 648
            YT    N  GE    A L  +  ++
Sbjct: 1108 YTIVVRNKHGETSASASLLEEADYE 1132



 Score = 97.4 bits (241), Expect = 1e-19
 Identities = 55/168 (32%), Positives = 92/168 (54%), Gaps = 1/168 (0%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VR G +V L     G    + +W+K    ++ESE ++   +EN   L+I  A++EH G Y
Sbjct: 21203 VRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKY 21262

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T++++N +      + +  +  P  P G     +I++ S+ LSW     +GG  +  YSI
Sbjct: 21263 TVILDNAVCRIAVPITVITLGPPSKPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSI 21322

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             E  +++   WK + ++   T+F V +L+ D EY+FRVRA N YG S+P
Sbjct: 21323 EKRETSQTNWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQP 21370



 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 56/168 (33%), Positives = 89/168 (52%), Gaps = 2/168 (1%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             V+AG +V L   V G    T +W K    ++ +E +K+    N   L + +  ++  G Y
Sbjct: 12935 VKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDY 12994

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
             T+  EN  GS+ A + L V+DKP PPA     + + S    LSW     DGGS + +Y +
Sbjct: 12995 TITAENSSGSKSATIKLKVLDKPGPPASVK-INKMYSDRAMLSWEPPLEDGGSEITNYIV 13053

Query: 1300  EIWDSANKTWKEL-ATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEP 1346
             +  +++   W ++ AT   TS +V+ L+  HEY+FR+ A N YG  +P
Sbjct: 13054 DKRETSRPNWAQVSATVPITSCSVEKLIEGHEYQFRICAENKYGVGDP 13101



 Score = 96.3 bits (238), Expect = 2e-19
 Identities = 57/211 (27%), Positives = 97/211 (45%), Gaps = 7/211 (3%)

Query: 1159  PKTPPKAAMPPQI-IQFPEDQKVRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKV 1217
             P T      PP + + F +   +R GE+  L G+ +G      +W K    + E +   +
Sbjct: 10436 PITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHI 10495

Query: 1218  ENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSS 1277
             + +     L  + A++   G Y ++VEN  GSR+    + VVD+P PP G     ++   
Sbjct: 10496 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKD 10555

Query: 1278  SLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQDLLPDHEYKFRVR 1336
              + +SW     DGGS + +Y IE  +     W  + +  + T+  V  LL   +Y FR+ 
Sbjct: 10556 YMVISWKPPLDDGGSKITNYIIEKKEVGKDVWMPVTSASAKTTCKVSKLLEGKDYIFRIH 10615

Query: 1337  AINVYGTSEPSQESELTT-----VGEKPEEP 1362
             A N+YG S+P     +       V + P++P
Sbjct: 10616 AENLYGISDPLVSDSMKAKDRFRVPDAPDQP 10646



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 158/697 (22%), Positives = 252/697 (36%), Gaps = 128/697 (18%)

Query: 21   PSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTWHRNGQPITSGGRFL 80
            P +++  P  EAP      ++  + +G+ A F  RV G P+P+  W++NG  I    R  
Sbjct: 2020 PDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIY 2079

Query: 81   LDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQLGQPVVSKTL 140
                      LVI  V  ED      +A N +G       L V+   AKQL         
Sbjct: 2080 WYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ---AKQL--------- 2127

Query: 141  GDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQ-MGRFSCKITGRPQPQVTWLKGNV 199
                                  F  +L  VV KE   M  F C+ T  P  +V W K  +
Sbjct: 2128 --------------------ITFTQELQDVVAKEKDTMATFECE-TSEPFVKVKWYKDGM 2166

Query: 200  PLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGLDSANRS 259
             +    +  +     +  L I  ++  D   Y+C++V        +A+L ++G   A   
Sbjct: 2167 EVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN-VKTTAKLIVEG---AVVE 2222

Query: 260  FVRETKATN--SDVRKEVTNVISKES-----KLDSLEAAAKSKNCSSPQRGGSPPWAANS 312
            FV+E +          E+  ++S E+       + +E  +  K   + +RG       + 
Sbjct: 2223 FVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDV 2282

Query: 313  QPQPPRE------SKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAP---GLGV 363
              +   E       K  +CK   +  P   +LQ  S     +   VQ E +       GV
Sbjct: 2283 TKEDQGEYSFVIDGKKTTCKLKMKPRP-IAILQGLSDQKVCEGDIVQLEVKVSLESVEGV 2341

Query: 364  LSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQ 423
                G+E               QP      V+ K ++  +  +  ++ A           
Sbjct: 2342 WMKDGQEV--------------QPSDRVHIVIDKQSHMLLIEDMTKEDA----------- 2376

Query: 424  EVKENQTVKFRCEGLAVMEVAPSFS----SVLKDCAVIEGQDFVLQCSVRGTPVPRITWL 479
                N +      GL+       +S    + LKD  VIEG   VL+C V    V  + W 
Sbjct: 2377 ---GNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWY 2433

Query: 480  LNGQPIQ---YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKS 536
            LN + I+     ++  +     L I      D G Y  +    +G+V  +  ++V + K 
Sbjct: 2434 LNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLI----VGRVETNCNLSVEKIK- 2488

Query: 537  SRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQE 596
                                ++GL DL   +   V   V++S +   +V+W     EI+ 
Sbjct: 2489 -------------------IIRGLRDLTCTETQNVVFEVELS-HSGIDVLWNFKDKEIKP 2528

Query: 597  SEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQPWFIS 656
            S  +  E  G  + L +  +  +D G YT      AGE  T   LTV           IS
Sbjct: 2529 SSKYKIEAHGKIYKLTVLNMMKDDEGKYTF----YAGENMTSGKLTV-------AGGAIS 2577

Query: 657  KP-RSVTASLGQSVLISCAIAGDPFPTVHWLRDGKAL 692
            KP    T +  Q  +  C +A +P     WLRDGK L
Sbjct: 2578 KPLTDQTVAESQEAVFECEVA-NPDSKGEWLRDGKHL 2613



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 69/265 (26%), Positives = 127/265 (47%), Gaps = 11/265 (4%)

Query: 1145 LGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGKVTGTQPITCTWMK 1204
            +G    + + +    K P      P I     D  V  GE + +          T +W K
Sbjct: 7994 IGVSEPSEISENVVAKDPD---CKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHK 8050

Query: 1205 FRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDP 1264
              K+++ S+ + ++N    + L +  + +   G YT+ +ENKLGS  A +N+ V+  P P
Sbjct: 8051 DGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGP 8110

Query: 1265 PAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKELATCRS-TSFNVQ 1323
                  ASDI  SS  L+W    +DGG+ +  Y +E  ++  +T+  + +  +  S+ V+
Sbjct: 8111 CKDIK-ASDITKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVK 8169

Query: 1324 DLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKD---EVEVSDDDEKEPEVDY 1380
            DL+P+ EY FRV+A+N  G  E   E +   + + P++P D   +VEV +   +   + +
Sbjct: 8170 DLIPNGEYFFRVKAVNKVGGGE-YIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITW 8228

Query: 1381 RTVTINTEQKVSDFYDIEERLGSGK 1405
            +    +   K+  +  I E++  G+
Sbjct: 8229 KPPLYDGGSKIMGY--IIEKIAKGE 8251



 Score = 95.9 bits (237), Expect = 3e-19
 Identities = 64/229 (27%), Positives = 117/229 (51%), Gaps = 20/229 (8%)

Query: 531   VHEK--KSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWL 588
             VHE+  K+S+ SE +   A  K  +       + + + +G ++ +   ++G    +V W+
Sbjct: 26649 VHEEITKTSQASEEVRTHAEIKAFS-------TQMSINEGQRLVLKANIAG--ATDVKWV 26699

Query: 589   HNGNEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHD 648
              NG E+  SE++ +   G+  +L I++    D G  TC +    G V+ Q  LT+ +   
Sbjct: 26700 LNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELS 26759

Query: 649   GTQPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVF 708
                P FIS+PRS   + GQ+VL +C I+G+P P + W ++   +   + +  + ++ +V+
Sbjct: 26760 DA-PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPI-SISSNVSISRSRNVY 26817

Query: 709   TLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPA 757
             +L ++      +G+Y I  KN  G+CS   SLM+       LP   EP+
Sbjct: 26818 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV-------LPLVEEPS 26859



 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 65/220 (29%), Positives = 111/220 (50%), Gaps = 17/220 (7%)

Query: 1180  VRAGESVELFG-KVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGC 1238
             ++AG+++ L    + G      +W K  K I+ S+  ++ ++   S LTI  A ++  G 
Sbjct: 14018 IKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGE 14077

Query: 1239  YTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYS 1298
             YT+   N  G++   V +TV+D P PP G    S++ +   TL+W     DGGS ++SY 
Sbjct: 14078 YTITATNPFGTKVEHVKVTVLDVPGPP-GPVEISNVSAEKATLTWTPPLEDGGSPIKSYI 14136

Query: 1299  IEIWDSANKTW----KELATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTT 1354
             +E  +++   W    +++ +CR  +     L+  +EY FRV A+N YG  EP Q   +  
Sbjct: 14137 LEKRETSRLLWTVVSEDIQSCRHVA---TKLIQGNEYIFRVSAVNHYGKGEPVQSEPVKM 14193

Query: 1355  VGE-KPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSD 1393
             V    P  P ++ EVS+       V   T T++ ++ V D
Sbjct: 14194 VDRFGPPGPPEKPEVSN-------VTKNTATVSWKRPVDD 14226



 Score = 95.5 bits (236), Expect = 4e-19
 Identities = 79/293 (26%), Positives = 125/293 (42%), Gaps = 29/293 (9%)

Query: 475   RITWLLNGQPIQYARS---TCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV 531
             ++TW    + ++ +     T E GVA L+++D    D GTY C   N  G+ S  A + V
Sbjct: 25227 QVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFV 25286

Query: 532   HE-------------KKSSRKSEYL-LPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQV 577
                            KK  R+++ + L   P + T P++     +     G  V   V +
Sbjct: 25287 KGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLY-----NKTAYVGENVRFGVTI 25341

Query: 578   SGNPPPEVIWLHNGNEIQESED---FHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGE 634
             + +P P V W  +G +I+  ++   + FE     + L I  V  +D   YT  A N  GE
Sbjct: 25342 TVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGE 25401

Query: 635   VRTQAVLTVQ---EPHDGT-QPWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGK 690
                +A LTV     P D T +P F     +     GQSV     ++G P PT+ W +DG+
Sbjct: 25402 DSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQ 25461

Query: 691   ALCKDTGHFEVLQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECSCQVSLMLQ 743
              L        + +  D + L ++   P   G Y +   N  G  SCQ  L ++
Sbjct: 25462 PLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 25514



 Score = 94.7 bits (234), Expect = 7e-19
 Identities = 64/231 (27%), Positives = 105/231 (45%), Gaps = 5/231 (2%)

Query: 1180  VRAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCY 1239
             VRAG S+ +F  + G      TW K    I       +EN+E+ + L I    +   G +
Sbjct: 14416 VRAGLSIRIFVPIKGRPAPEVTWTK--DNINLKNRANIENTESFTLLIIPECNRYDTGKF 14473

Query: 1240  TLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSI 1299
              + +EN  G +   VN+ V+D P P       +DI   S+TL W     DGGS + +Y +
Sbjct: 14474 VMTIENPAGKKSGFVNVRVLDTPGPVLNLR-PTDITKDSVTLHWDLPLIDGGSRITNYIV 14532

Query: 1300  EIWDSANKTWKELAT-CRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEK 1358
             E  ++  K++    T C   ++ V  L