BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|108802621 protein tyrosine phosphatase, non-receptor type 20 isoform 10 [Homo sapiens] (64 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|108802615 protein tyrosine phosphatase, non-receptor type 20 ... 140 2e-34 gi|108802621 protein tyrosine phosphatase, non-receptor type 20 ... 140 2e-34 gi|109138575 protein tyrosine phosphatase, non-receptor type 20A... 140 2e-34 gi|109138569 protein tyrosine phosphatase, non-receptor type 20A... 140 2e-34 gi|109138571 protein tyrosine phosphatase, non-receptor type 20A... 75 1e-14 gi|109138567 protein tyrosine phosphatase, non-receptor type 20A... 75 1e-14 gi|109138559 protein tyrosine phosphatase, non-receptor type 20A... 75 1e-14 gi|108802619 protein tyrosine phosphatase, non-receptor type 20 ... 75 1e-14 gi|108802613 protein tyrosine phosphatase, non-receptor type 20 ... 75 1e-14 gi|45243554 protein tyrosine phosphatase, non-receptor type 20 i... 75 1e-14 gi|108802609 protein tyrosine phosphatase, non-receptor type 20 ... 70 3e-13 gi|109138573 protein tyrosine phosphatase, non-receptor type 20A... 70 3e-13 gi|109138563 protein tyrosine phosphatase, non-receptor type 20A... 70 3e-13 gi|109138561 protein tyrosine phosphatase, non-receptor type 20A... 70 3e-13 gi|109138557 protein tyrosine phosphatase, non-receptor type 20A... 70 3e-13 gi|108802617 protein tyrosine phosphatase, non-receptor type 20 ... 70 3e-13 gi|108802607 protein tyrosine phosphatase, non-receptor type 20 ... 70 3e-13 gi|108802604 protein tyrosine phosphatase, non-receptor type 20 ... 70 3e-13 gi|31543980 zinc finger protein 263 [Homo sapiens] 27 3.5 gi|116734706 interferon regulatory factor 2 binding protein 2 is... 27 4.6 gi|116734704 interferon regulatory factor 2 binding protein 2 is... 27 4.6 gi|194097477 neuronal PAS domain protein 4 [Homo sapiens] 26 6.0 gi|11386181 H2.0-like homeobox [Homo sapiens] 26 7.8 gi|6912284 carbonic anhydrase XIV precursor [Homo sapiens] 26 7.8 gi|9966885 tumor endothelial marker 1 precursor [Homo sapiens] 26 7.8 gi|156627557 zinc finger protein 554 [Homo sapiens] 26 7.8 >gi|108802615 protein tyrosine phosphatase, non-receptor type 20 isoform 7 [Homo sapiens] Length = 136 Score = 140 bits (353), Expect = 2e-34 Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 60 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 132 Query: 61 RYCA 64 RYCA Sbjct: 133 RYCA 136 >gi|108802621 protein tyrosine phosphatase, non-receptor type 20 isoform 10 [Homo sapiens] Length = 64 Score = 140 bits (353), Expect = 2e-34 Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 60 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL Sbjct: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 60 Query: 61 RYCA 64 RYCA Sbjct: 61 RYCA 64 >gi|109138575 protein tyrosine phosphatase, non-receptor type 20A isoform 10 [Homo sapiens] Length = 64 Score = 140 bits (353), Expect = 2e-34 Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 60 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL Sbjct: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 60 Query: 61 RYCA 64 RYCA Sbjct: 61 RYCA 64 >gi|109138569 protein tyrosine phosphatase, non-receptor type 20A isoform 7 [Homo sapiens] Length = 136 Score = 140 bits (353), Expect = 2e-34 Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 60 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLL 132 Query: 61 RYCA 64 RYCA Sbjct: 133 RYCA 136 >gi|109138571 protein tyrosine phosphatase, non-receptor type 20A isoform 9 [Homo sapiens] Length = 145 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Query: 30 LLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 64 +L QHHGYSGPNERTTFWHGSNEGAVSLLLRYCA Sbjct: 111 ILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 145 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 >gi|109138567 protein tyrosine phosphatase, non-receptor type 20A isoform 6 [Homo sapiens] Length = 217 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Query: 30 LLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 64 +L QHHGYSGPNERTTFWHGSNEGAVSLLLRYCA Sbjct: 183 ILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 217 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 104 >gi|109138559 protein tyrosine phosphatase, non-receptor type 20A isoform 2 [Homo sapiens] Length = 226 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Query: 30 LLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 64 +L QHHGYSGPNERTTFWHGSNEGAVSLLLRYCA Sbjct: 192 ILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 226 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 82 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 113 >gi|108802619 protein tyrosine phosphatase, non-receptor type 20 isoform 9 [Homo sapiens] Length = 145 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Query: 30 LLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 64 +L QHHGYSGPNERTTFWHGSNEGAVSLLLRYCA Sbjct: 111 ILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 145 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 >gi|108802613 protein tyrosine phosphatase, non-receptor type 20 isoform 6 [Homo sapiens] Length = 217 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Query: 30 LLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 64 +L QHHGYSGPNERTTFWHGSNEGAVSLLLRYCA Sbjct: 183 ILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 217 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 104 >gi|45243554 protein tyrosine phosphatase, non-receptor type 20 isoform 2 [Homo sapiens] Length = 226 Score = 74.7 bits (182), Expect = 1e-14 Identities = 32/35 (91%), Positives = 33/35 (94%) Query: 30 LLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 64 +L QHHGYSGPNERTTFWHGSNEGAVSLLLRYCA Sbjct: 192 ILPFQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA 226 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 82 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 113 >gi|108802609 protein tyrosine phosphatase, non-receptor type 20 isoform 4 [Homo sapiens] Length = 269 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 104 >gi|109138573 protein tyrosine phosphatase, non-receptor type 20A isoform 8 [Homo sapiens] Length = 339 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 >gi|109138563 protein tyrosine phosphatase, non-receptor type 20A isoform 4 [Homo sapiens] Length = 269 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 104 >gi|109138561 protein tyrosine phosphatase, non-receptor type 20A isoform 3 [Homo sapiens] Length = 411 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 104 >gi|109138557 protein tyrosine phosphatase, non-receptor type 20A isoform 1 [Homo sapiens] Length = 420 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 82 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 113 >gi|108802617 protein tyrosine phosphatase, non-receptor type 20 isoform 8 [Homo sapiens] Length = 339 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 >gi|108802607 protein tyrosine phosphatase, non-receptor type 20 isoform 3 [Homo sapiens] Length = 411 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 73 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 104 >gi|108802604 protein tyrosine phosphatase, non-receptor type 20 isoform 1 [Homo sapiens] Length = 420 Score = 70.5 bits (171), Expect = 3e-13 Identities = 32/32 (100%), Positives = 32/32 (100%) Query: 1 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 32 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS Sbjct: 82 MWTARGPFRRDRWSSEDEEAAGPSQALSPLLS 113 >gi|31543980 zinc finger protein 263 [Homo sapiens] Length = 683 Score = 26.9 bits (58), Expect = 3.5 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 5/38 (13%) Query: 8 FRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERT 45 FRR R+ +EAAGP +ALS L + HG+ P RT Sbjct: 44 FRRFRF----QEAAGPREALSRLQEL-CHGWLRPEMRT 76 >gi|116734706 interferon regulatory factor 2 binding protein 2 isoform B [Homo sapiens] Length = 571 Score = 26.6 bits (57), Expect = 4.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 10 RDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNE 43 + R S E + P LL++ HG+SGP E Sbjct: 289 KSRGSGEQDWVNRPKTVRDTLLALHQHGHSGPFE 322 >gi|116734704 interferon regulatory factor 2 binding protein 2 isoform A [Homo sapiens] Length = 587 Score = 26.6 bits (57), Expect = 4.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 10 RDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNE 43 + R S E + P LL++ HG+SGP E Sbjct: 289 KSRGSGEQDWVNRPKTVRDTLLALHQHGHSGPFE 322 >gi|194097477 neuronal PAS domain protein 4 [Homo sapiens] Length = 802 Score = 26.2 bits (56), Expect = 6.0 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 7 PFRRDRWSSEDEEAAGPSQALSPL--LSVQHHGY 38 P + W S D EA GP A SP LS + H + Sbjct: 720 PDPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSF 753 >gi|11386181 H2.0-like homeobox [Homo sapiens] Length = 488 Score = 25.8 bits (55), Expect = 7.8 Identities = 14/33 (42%), Positives = 16/33 (48%) Query: 4 ARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHH 36 AR P R + E AG Q LSPL + HH Sbjct: 89 ARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYHH 121 >gi|6912284 carbonic anhydrase XIV precursor [Homo sapiens] Length = 337 Score = 25.8 bits (55), Expect = 7.8 Identities = 16/61 (26%), Positives = 23/61 (37%), Gaps = 11/61 (18%) Query: 2 WTARGPFRRDRWSSEDEEAAGPSQA----------LSP-LLSVQHHGYSGPNERTTFWHG 50 WT GP +D W + E +Q+ P L ++Q HGY P H Sbjct: 22 WTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHN 81 Query: 51 S 51 + Sbjct: 82 N 82 >gi|9966885 tumor endothelial marker 1 precursor [Homo sapiens] Length = 757 Score = 25.8 bits (55), Expect = 7.8 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Query: 2 WTARGP-FRRDRWSSEDEEAAGPS 24 W A GP +D W++E A GPS Sbjct: 9 WAAAGPTLGQDPWAAEPRAACGPS 32 >gi|156627557 zinc finger protein 554 [Homo sapiens] Length = 538 Score = 25.8 bits (55), Expect = 7.8 Identities = 13/41 (31%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Query: 13 WSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNE 53 W ++ P LS S+ H + P E+ T WHG E Sbjct: 186 WKQLEDSHEDPQGLLSQKASL--HVVAVPQEKATAWHGFGE 224 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.316 0.130 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,907,099 Number of Sequences: 37866 Number of extensions: 100296 Number of successful extensions: 327 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 299 Number of HSP's gapped (non-prelim): 32 length of query: 64 length of database: 18,247,518 effective HSP length: 37 effective length of query: 27 effective length of database: 16,846,476 effective search space: 454854852 effective search space used: 454854852 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.