BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|12597661 mitochondrial ribosomal protein L44 [Homo sapiens] (332 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|12597661 mitochondrial ribosomal protein L44 [Homo sapiens] 661 0.0 gi|155030236 ribonuclease III, nuclear isoform 2 [Homo sapiens] 35 0.093 gi|155030234 ribonuclease III, nuclear isoform 1 [Homo sapiens] 35 0.093 gi|192807320 SWI/SNF-related matrix-associated actin-dependent r... 33 0.27 gi|192807318 SWI/SNF-related matrix-associated actin-dependent r... 33 0.27 gi|192807316 SWI/SNF-related matrix-associated actin-dependent r... 33 0.27 gi|192807314 SWI/SNF-related matrix-associated actin-dependent r... 33 0.27 gi|48255900 SWI/SNF-related matrix-associated actin-dependent re... 33 0.46 gi|48255898 SWI/SNF-related matrix-associated actin-dependent re... 33 0.46 gi|192807323 SWI/SNF-related matrix-associated actin-dependent r... 32 0.60 gi|192807312 SWI/SNF-related matrix-associated actin-dependent r... 32 0.60 gi|21071056 SWI/SNF-related matrix-associated actin-dependent re... 32 0.60 gi|116812586 leucine zipper protein 5 [Homo sapiens] 32 0.79 gi|124249396 coiled-coil domain containing 30 [Homo sapiens] 29 5.1 gi|66882532 farnesyltransferase, CAAX box, alpha isoform c [Homo... 29 6.7 gi|66882524 farnesyltransferase, CAAX box, alpha isoform b [Homo... 29 6.7 gi|4503771 farnesyltransferase, CAAX box, alpha isoform a [Homo ... 29 6.7 gi|27881506 ATP-binding cassette, sub-family F, member 2 isoform... 29 6.7 gi|10947137 ATP-binding cassette, sub-family F, member 2 isoform... 29 6.7 gi|189027048 ecto-NOX disulfide-thiol exchanger 1 [Homo sapiens] 28 8.7 gi|189027046 ecto-NOX disulfide-thiol exchanger 1 [Homo sapiens] 28 8.7 >gi|12597661 mitochondrial ribosomal protein L44 [Homo sapiens] Length = 332 Score = 661 bits (1705), Expect = 0.0 Identities = 332/332 (100%), Positives = 332/332 (100%) Query: 1 MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRR 60 MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRR Sbjct: 1 MASGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRR 60 Query: 61 SEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLK 120 SEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLK Sbjct: 61 SEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLK 120 Query: 121 SNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTL 180 SNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTL Sbjct: 121 SNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTL 180 Query: 181 SEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGL 240 SEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGL Sbjct: 181 SEEFPVPPAVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGL 240 Query: 241 LVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVA 300 LVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVA Sbjct: 241 LVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVA 300 Query: 301 LRKLYGFTENRRPWNYSKPKETLRAEKSITAS 332 LRKLYGFTENRRPWNYSKPKETLRAEKSITAS Sbjct: 301 LRKLYGFTENRRPWNYSKPKETLRAEKSITAS 332 >gi|155030236 ribonuclease III, nuclear isoform 2 [Homo sapiens] Length = 1337 Score = 35.0 bits (79), Expect = 0.093 Identities = 47/202 (23%), Positives = 73/202 (36%), Gaps = 12/202 (5%) Query: 117 LNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVE 176 L L NQ + G S Q T++L +PD + L L VA L ++ Sbjct: 1101 LTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQ 1160 Query: 177 QLTLSEEFPVPPAVLQQTFFA-----VIGALLQSSGPERTALFIRDFLITQMTGKELFEM 231 + ++ + P L+ A I AL E F+ ++ L + Sbjct: 1161 EYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQD 1220 Query: 232 WKIINPMGLLVEELKKRNVSAPESRL----TRQSGGTTALPLYFVGLYCDKKLIAEGPGE 287 W +P L + E + T Q+ G + Y V +Y + I G G Sbjct: 1221 WN--DPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGP 1278 Query: 288 TVLVAEEEAARVALRKLYGFTE 309 ++ AE AA AL K Y F + Sbjct: 1279 SIQQAEMGAAMDALEK-YNFPQ 1299 >gi|155030234 ribonuclease III, nuclear isoform 1 [Homo sapiens] Length = 1374 Score = 35.0 bits (79), Expect = 0.093 Identities = 47/202 (23%), Positives = 73/202 (36%), Gaps = 12/202 (5%) Query: 117 LNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVE 176 L L NQ + G S Q T++L +PD + L L VA L ++ Sbjct: 1138 LTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQ 1197 Query: 177 QLTLSEEFPVPPAVLQQTFFA-----VIGALLQSSGPERTALFIRDFLITQMTGKELFEM 231 + ++ + P L+ A I AL E F+ ++ L + Sbjct: 1198 EYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQD 1257 Query: 232 WKIINPMGLLVEELKKRNVSAPESRL----TRQSGGTTALPLYFVGLYCDKKLIAEGPGE 287 W +P L + E + T Q+ G + Y V +Y + I G G Sbjct: 1258 WN--DPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGP 1315 Query: 288 TVLVAEEEAARVALRKLYGFTE 309 ++ AE AA AL K Y F + Sbjct: 1316 SIQQAEMGAAMDALEK-YNFPQ 1336 >gi|192807320 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 isoform F [Homo sapiens] Length = 1613 Score = 33.5 bits (75), Expect = 0.27 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1177 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1236 Query: 123 QELSEQGTSFSQTCLTQFLEDEYPD 147 + S + +F Q L +DE D Sbjct: 1237 KSSSHERRAFLQAILEHEEQDEEED 1261 >gi|192807318 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 isoform E [Homo sapiens] Length = 1614 Score = 33.5 bits (75), Expect = 0.27 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1177 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1236 Query: 123 QELSEQGTSFSQTCLTQFLEDEYPD 147 + S + +F Q L +DE D Sbjct: 1237 KSSSHERRAFLQAILEHEEQDEEED 1261 >gi|192807316 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 isoform D [Homo sapiens] Length = 1616 Score = 33.5 bits (75), Expect = 0.27 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1177 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1236 Query: 123 QELSEQGTSFSQTCLTQFLEDEYPD 147 + S + +F Q L +DE D Sbjct: 1237 KSSSHERRAFLQAILEHEEQDEEED 1261 >gi|192807314 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 isoform C [Homo sapiens] Length = 1617 Score = 33.5 bits (75), Expect = 0.27 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1177 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1236 Query: 123 QELSEQGTSFSQTCLTQFLEDEYPD 147 + S + +F Q L +DE D Sbjct: 1237 KSSSHERRAFLQAILEHEEQDEEED 1261 >gi|48255900 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2 isoform a [Homo sapiens] Length = 1590 Score = 32.7 bits (73), Expect = 0.46 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1147 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1206 Query: 123 QELSEQGTSFSQTCLTQFLEDEYPD 147 + S + +F Q L E+E D Sbjct: 1207 KSSSHERRAFLQAILEHEEENEEED 1231 >gi|48255898 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a2 isoform b [Homo sapiens] Length = 1572 Score = 32.7 bits (73), Expect = 0.46 Identities = 20/85 (23%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1147 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1206 Query: 123 QELSEQGTSFSQTCLTQFLEDEYPD 147 + S + +F Q L E+E D Sbjct: 1207 KSSSHERRAFLQAILEHEEENEEED 1231 >gi|192807323 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 isoform A [Homo sapiens] Length = 1679 Score = 32.3 bits (72), Expect = 0.60 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1177 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1236 Query: 123 QELSEQGTSFSQTCLTQFLEDE 144 + S + +F Q L +DE Sbjct: 1237 KSSSHERRAFLQAILEHEEQDE 1258 >gi|192807312 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 isoform B [Homo sapiens] Length = 1647 Score = 32.3 bits (72), Expect = 0.60 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1177 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1236 Query: 123 QELSEQGTSFSQTCLTQFLEDE 144 + S + +F Q L +DE Sbjct: 1237 KSSSHERRAFLQAILEHEEQDE 1258 >gi|21071056 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a4 isoform B [Homo sapiens] Length = 1647 Score = 32.3 bits (72), Expect = 0.60 Identities = 19/82 (23%), Positives = 40/82 (48%), Gaps = 2/82 (2%) Query: 65 NWDYHAEIQAF--GHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSN 122 +W+ H ++QA HR+ + + +L+ VNS K A + +L ++++ + + Sbjct: 1177 DWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQ 1236 Query: 123 QELSEQGTSFSQTCLTQFLEDE 144 + S + +F Q L +DE Sbjct: 1237 KSSSHERRAFLQAILEHEEQDE 1258 >gi|116812586 leucine zipper protein 5 [Homo sapiens] Length = 1143 Score = 32.0 bits (71), Expect = 0.79 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Query: 66 WDYHAEIQAFGHRLQENFSL-DLLKTAFVNSCYIKSEEAKR 105 W H + F + L+E+ + D+L F+N YIK EE +R Sbjct: 187 WRIHQALYCFDYDLEESGEIKDMLLECFININYIKKEEGRR 227 >gi|124249396 coiled-coil domain containing 30 [Homo sapiens] Length = 783 Score = 29.3 bits (64), Expect = 5.1 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Query: 98 IKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEY 145 I+ +EA +QL EK ++KSNQELSE+ + Q + L +EY Sbjct: 442 IQQQEALLKQLENEKRKYDEHVKSNQELSEKLSKLQQE--KEALREEY 487 >gi|66882532 farnesyltransferase, CAAX box, alpha isoform c [Homo sapiens] Length = 312 Score = 28.9 bits (63), Expect = 6.7 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 8/102 (7%) Query: 83 FSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLE 142 ++L+++K N + Q G+ K LLN +L + S S L FL Sbjct: 195 YTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLN-----QLLDLQPSHSSPYLIAFLV 249 Query: 143 DEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEF 184 D Y DM N D L +C + LA E+ T+ +E+ Sbjct: 250 DIYEDMLENQCDNKEDILNKALELCEI---LAKEKDTIRKEY 288 >gi|66882524 farnesyltransferase, CAAX box, alpha isoform b [Homo sapiens] Length = 288 Score = 28.9 bits (63), Expect = 6.7 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 8/102 (7%) Query: 83 FSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLE 142 ++L+++K N + Q G+ K LLN +L + S S L FL Sbjct: 171 YTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLN-----QLLDLQPSHSSPYLIAFLV 225 Query: 143 DEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEF 184 D Y DM N D L +C + LA E+ T+ +E+ Sbjct: 226 DIYEDMLENQCDNKEDILNKALELCEI---LAKEKDTIRKEY 264 >gi|4503771 farnesyltransferase, CAAX box, alpha isoform a [Homo sapiens] Length = 379 Score = 28.9 bits (63), Expect = 6.7 Identities = 28/102 (27%), Positives = 43/102 (42%), Gaps = 8/102 (7%) Query: 83 FSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLE 142 ++L+++K N + Q G+ K LLN +L + S S L FL Sbjct: 262 YTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLN-----QLLDLQPSHSSPYLIAFLV 316 Query: 143 DEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEF 184 D Y DM N D L +C + LA E+ T+ +E+ Sbjct: 317 DIYEDMLENQCDNKEDILNKALELCEI---LAKEKDTIRKEY 355 >gi|27881506 ATP-binding cassette, sub-family F, member 2 isoform a [Homo sapiens] Length = 623 Score = 28.9 bits (63), Expect = 6.7 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 69 HAEIQAFGHRLQENFSLDLLKTAFVNSCY--IKSEEAKRQQLG 109 H +I + LQE LDL ++ CY IK +E R+ +G Sbjct: 459 HVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIG 501 >gi|10947137 ATP-binding cassette, sub-family F, member 2 isoform b [Homo sapiens] Length = 634 Score = 28.9 bits (63), Expect = 6.7 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 69 HAEIQAFGHRLQENFSLDLLKTAFVNSCY--IKSEEAKRQQLG 109 H +I + LQE LDL ++ CY IK +E R+ +G Sbjct: 459 HVKIGRYHQHLQEQLDLDLSPLEYMMKCYPEIKEKEEMRKIIG 501 >gi|189027048 ecto-NOX disulfide-thiol exchanger 1 [Homo sapiens] Length = 643 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/50 (30%), Positives = 28/50 (56%) Query: 72 IQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKS 121 ++ GH +++ +++L A VN + E + Q L EKEA+L+ + S Sbjct: 526 VETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQGLKSEKEALLIGIIS 575 >gi|189027046 ecto-NOX disulfide-thiol exchanger 1 [Homo sapiens] Length = 643 Score = 28.5 bits (62), Expect = 8.7 Identities = 15/50 (30%), Positives = 28/50 (56%) Query: 72 IQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKS 121 ++ GH +++ +++L A VN + E + Q L EKEA+L+ + S Sbjct: 526 VETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQGLKSEKEALLIGIIS 575 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.319 0.135 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,075,195 Number of Sequences: 37866 Number of extensions: 577245 Number of successful extensions: 1391 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 1382 Number of HSP's gapped (non-prelim): 21 length of query: 332 length of database: 18,247,518 effective HSP length: 103 effective length of query: 229 effective length of database: 14,347,320 effective search space: 3285536280 effective search space used: 3285536280 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 62 (28.5 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.