BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239746943 PREDICTED: hypothetical protein XP_002343887 [Homo sapiens] (99 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239746943 PREDICTED: hypothetical protein XP_002343887 [Homo ... 213 3e-56 gi|239752425 PREDICTED: hypothetical protein XP_002348263 [Homo ... 209 3e-55 gi|239757914 PREDICTED: similar to hCG1818060 [Homo sapiens] 208 8e-55 gi|83367077 mucin 16 [Homo sapiens] 29 0.70 gi|4506267 parathyroid hormone preproprotein [Homo sapiens] 28 2.0 gi|205277447 dual specificity phosphatase 11 [Homo sapiens] 28 2.0 gi|49355778 inter-alpha trypsin inhibitor heavy chain precursor ... 27 2.7 gi|153945780 inter-alpha trypsin inhibitor heavy chain precursor... 27 2.7 gi|153945711 inter-alpha trypsin inhibitor heavy chain precursor... 27 2.7 gi|7706741 vestigial like 1 [Homo sapiens] 27 3.5 gi|117938768 GNAS complex locus alex [Homo sapiens] 26 6.0 gi|226958625 hypothetical protein LOC414236 [Homo sapiens] 26 6.0 gi|111118976 collagen, type II, alpha 1 isoform 1 precursor [Hom... 26 7.8 gi|111118974 collagen, type II, alpha 1 isoform 2 precursor [Hom... 26 7.8 gi|239743313 PREDICTED: hypothetical protein XP_002342790 [Homo ... 26 7.8 gi|239743305 PREDICTED: hypothetical protein XP_002342789 [Homo ... 26 7.8 gi|239743129 PREDICTED: hypothetical protein XP_002342758 [Homo ... 26 7.8 gi|169170602 PREDICTED: hypothetical protein [Homo sapiens] 26 7.8 gi|239508988 PREDICTED: similar to HSPC047 protein [Homo sapiens] 26 7.8 gi|239508786 PREDICTED: similar to HSPC047 protein [Homo sapiens] 26 7.8 gi|46048439 N-acetyltransferase 6 [Homo sapiens] 26 7.8 gi|32698936 B-cell CLL/lymphoma 9-like [Homo sapiens] 26 7.8 >gi|239746943 PREDICTED: hypothetical protein XP_002343887 [Homo sapiens] Length = 99 Score = 213 bits (541), Expect = 3e-56 Identities = 99/99 (100%), Positives = 99/99 (100%) Query: 1 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLWTLK 60 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLWTLK Sbjct: 1 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLWTLK 60 Query: 61 QAIPGWTWPLPTRHTINPPLPPGEDGKSKKMVWINKSFP 99 QAIPGWTWPLPTRHTINPPLPPGEDGKSKKMVWINKSFP Sbjct: 61 QAIPGWTWPLPTRHTINPPLPPGEDGKSKKMVWINKSFP 99 >gi|239752425 PREDICTED: hypothetical protein XP_002348263 [Homo sapiens] Length = 99 Score = 209 bits (533), Expect = 3e-55 Identities = 98/99 (98%), Positives = 98/99 (98%) Query: 1 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLWTLK 60 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLWTLK Sbjct: 1 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLWTLK 60 Query: 61 QAIPGWTWPLPTRHTINPPLPPGEDGKSKKMVWINKSFP 99 QAIPGWTWPLPTRHTINPPLPPGED KSKKMVWINKSFP Sbjct: 61 QAIPGWTWPLPTRHTINPPLPPGEDRKSKKMVWINKSFP 99 >gi|239757914 PREDICTED: similar to hCG1818060 [Homo sapiens] Length = 99 Score = 208 bits (529), Expect = 8e-55 Identities = 97/99 (97%), Positives = 97/99 (97%) Query: 1 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLWTLK 60 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRND DLTEWLWTLK Sbjct: 1 MAQGHSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDVDLTEWLWTLK 60 Query: 61 QAIPGWTWPLPTRHTINPPLPPGEDGKSKKMVWINKSFP 99 QAIPGWTWPLPTRHTINPPLPPGED KSKKMVWINKSFP Sbjct: 61 QAIPGWTWPLPTRHTINPPLPPGEDRKSKKMVWINKSFP 99 >gi|83367077 mucin 16 [Homo sapiens] Length = 14507 Score = 29.3 bits (64), Expect = 0.70 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Query: 52 LTEWLWTLKQAIPGWTWPLPTRHTINPPLPPGEDGKS 88 +T WLW L ++P TWP +++ L G G S Sbjct: 2048 ITSWLWDLTTSLPTTTWP---STSLSEALSSGHSGVS 2081 >gi|4506267 parathyroid hormone preproprotein [Homo sapiens] Length = 115 Score = 27.7 bits (60), Expect = 2.0 Identities = 16/62 (25%), Positives = 25/62 (40%), Gaps = 7/62 (11%) Query: 28 SLASKSVLSVLLSRQLGNHRNDADLTEWLWTLKQAIPGWTWPLPTRHTINPPLPPGEDGK 87 S+ +SV + L LG H N + EWL Q + + + PL P + G Sbjct: 27 SVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFV-------ALGAPLAPRDAGS 79 Query: 88 SK 89 + Sbjct: 80 QR 81 >gi|205277447 dual specificity phosphatase 11 [Homo sapiens] Length = 377 Score = 27.7 bits (60), Expect = 2.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 73 RHTINPPLPPGEDGKSKKMVW 93 RH + PP PPGED ++ W Sbjct: 323 RHHLPPPGPPGEDYSHRRYSW 343 >gi|49355778 inter-alpha trypsin inhibitor heavy chain precursor 5 isoform 3 [Homo sapiens] Length = 702 Score = 27.3 bits (59), Expect = 2.7 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 5/65 (7%) Query: 5 HSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLW---TLKQ 61 H EV S S I K D +RP A K V R G+ D + E LW T K+ Sbjct: 527 HVEVTASNSKKFIILKTDVPVRPQKAGKDVTG--SPRPGGDGEGDTNHIERLWSYLTTKE 584 Query: 62 AIPGW 66 + W Sbjct: 585 LLSSW 589 >gi|153945780 inter-alpha trypsin inhibitor heavy chain precursor 5 isoform 1 [Homo sapiens] Length = 956 Score = 27.3 bits (59), Expect = 2.7 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 5/65 (7%) Query: 5 HSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLW---TLKQ 61 H EV S S I K D +RP A K V R G+ D + E LW T K+ Sbjct: 527 HVEVTASNSKKFIILKTDVPVRPQKAGKDVTG--SPRPGGDGEGDTNHIERLWSYLTTKE 584 Query: 62 AIPGW 66 + W Sbjct: 585 LLSSW 589 >gi|153945711 inter-alpha trypsin inhibitor heavy chain precursor 5 isoform 2 [Homo sapiens] Length = 742 Score = 27.3 bits (59), Expect = 2.7 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 5/65 (7%) Query: 5 HSEVGPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSRQLGNHRNDADLTEWLW---TLKQ 61 H EV S S I K D +RP A K V R G+ D + E LW T K+ Sbjct: 313 HVEVTASNSKKFIILKTDVPVRPQKAGKDVTG--SPRPGGDGEGDTNHIERLWSYLTTKE 370 Query: 62 AIPGW 66 + W Sbjct: 371 LLSSW 375 >gi|7706741 vestigial like 1 [Homo sapiens] Length = 258 Score = 26.9 bits (58), Expect = 3.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Query: 64 PGWTWPLPTRHTINPPLPPGE 84 PG++ P P RH + P P G+ Sbjct: 144 PGYSHPFPARHLVPEPQPDGK 164 >gi|117938768 GNAS complex locus alex [Homo sapiens] Length = 626 Score = 26.2 bits (56), Expect = 6.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 52 LTEWLWTLKQAIPGWTWPLPTRHTINPPL 80 L++ L T + A PGW P P PPL Sbjct: 226 LSDLLLTSRAAAPGWRSPDPRSRLAAPPL 254 >gi|226958625 hypothetical protein LOC414236 [Homo sapiens] Length = 151 Score = 26.2 bits (56), Expect = 6.0 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 17/95 (17%) Query: 9 GPSTSAWSIRRKVDEYLRPSLASKSVLSVLLSR-QLGNH-----RNDADLTEWLWTLKQA 62 GP K+ +P+L S S L++ +S Q+ +H RN +++ + Sbjct: 45 GPMLQGLQGEGKLAPIPKPTLPSPSRLTLFVSSSQMEDHGFPARRNGLTQASFIYQMPAG 104 Query: 63 --IPGWTW----PLPTRHTINPPLPP-----GEDG 86 PG + P+PT + PPLPP GE G Sbjct: 105 WGSPGGLFLPCQPVPTPVVLKPPLPPCPISWGESG 139 >gi|111118976 collagen, type II, alpha 1 isoform 1 precursor [Homo sapiens] Length = 1487 Score = 25.8 bits (55), Expect = 7.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 64 PGWTWPLPTRHTINPPLPPGEDGKSKK 90 PG + P+ R PP PG+DG++ K Sbjct: 233 PGVSGPMGPRGPPGPPGKPGDDGEAGK 259 >gi|111118974 collagen, type II, alpha 1 isoform 2 precursor [Homo sapiens] Length = 1418 Score = 25.8 bits (55), Expect = 7.8 Identities = 11/27 (40%), Positives = 16/27 (59%) Query: 64 PGWTWPLPTRHTINPPLPPGEDGKSKK 90 PG + P+ R PP PG+DG++ K Sbjct: 164 PGVSGPMGPRGPPGPPGKPGDDGEAGK 190 >gi|239743313 PREDICTED: hypothetical protein XP_002342790 [Homo sapiens] Length = 172 Score = 25.8 bits (55), Expect = 7.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 66 WTWPLPTRHTINPPLPPG 83 +TWP PTR + N L PG Sbjct: 62 YTWPGPTRDSPNASLQPG 79 >gi|239743305 PREDICTED: hypothetical protein XP_002342789 [Homo sapiens] Length = 172 Score = 25.8 bits (55), Expect = 7.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 66 WTWPLPTRHTINPPLPPG 83 +TWP PTR + N L PG Sbjct: 62 YTWPGPTRDSPNASLQPG 79 >gi|239743129 PREDICTED: hypothetical protein XP_002342758 [Homo sapiens] Length = 182 Score = 25.8 bits (55), Expect = 7.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 66 WTWPLPTRHTINPPLPPG 83 +TWP PTR + N L PG Sbjct: 72 YTWPGPTRDSPNASLQPG 89 >gi|169170602 PREDICTED: hypothetical protein [Homo sapiens] Length = 172 Score = 25.8 bits (55), Expect = 7.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 66 WTWPLPTRHTINPPLPPG 83 +TWP PTR + N L PG Sbjct: 62 YTWPGPTRDSPNASLQPG 79 >gi|239508988 PREDICTED: similar to HSPC047 protein [Homo sapiens] Length = 172 Score = 25.8 bits (55), Expect = 7.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 66 WTWPLPTRHTINPPLPPG 83 +TWP PTR + N L PG Sbjct: 62 YTWPGPTRDSPNASLQPG 79 >gi|239508786 PREDICTED: similar to HSPC047 protein [Homo sapiens] Length = 182 Score = 25.8 bits (55), Expect = 7.8 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 66 WTWPLPTRHTINPPLPPG 83 +TWP PTR + N L PG Sbjct: 72 YTWPGPTRDSPNASLQPG 89 >gi|46048439 N-acetyltransferase 6 [Homo sapiens] Length = 308 Score = 25.8 bits (55), Expect = 7.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 69 PLPTRHTINPPLPPGEDGKS 88 PLP TI+PP+P G KS Sbjct: 268 PLPECLTISPPVPSGPPSKS 287 >gi|32698936 B-cell CLL/lymphoma 9-like [Homo sapiens] Length = 1499 Score = 25.8 bits (55), Expect = 7.8 Identities = 14/25 (56%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Query: 65 GWTWP-LPTRHTINPPLPPGEDGKS 88 G T P PT T N PLPPG D S Sbjct: 349 GGTHPNTPTATTANNPLPPGGDPSS 373 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.315 0.131 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,626,396 Number of Sequences: 37866 Number of extensions: 189001 Number of successful extensions: 455 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 435 Number of HSP's gapped (non-prelim): 25 length of query: 99 length of database: 18,247,518 effective HSP length: 70 effective length of query: 29 effective length of database: 15,596,898 effective search space: 452310042 effective search space used: 452310042 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.