BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|5730035 small inducible cytokine A27 precursor [Homo sapiens] (112 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|5730035 small inducible cytokine A27 precursor [Homo sapiens] 234 1e-62 gi|22538811 chemokine (C-C motif) ligand 28 precursor [Homo sapi... 65 9e-12 gi|22538796 small inducible cytokine A25 precursor [Homo sapiens] 33 0.064 gi|46488919 astrotactin 2 isoform c [Homo sapiens] 28 2.1 gi|46488917 astrotactin 2 isoform b [Homo sapiens] 28 2.1 gi|46488915 astrotactin 2 isoform a [Homo sapiens] 28 2.1 gi|239754662 PREDICTED: hypothetical protein [Homo sapiens] 27 3.5 gi|239749226 PREDICTED: hypothetical protein [Homo sapiens] 27 3.5 gi|239743303 PREDICTED: hypothetical protein [Homo sapiens] 27 3.5 gi|239508986 PREDICTED: hypothetical protein [Homo sapiens] 27 3.5 gi|38348310 hypothetical protein LOC341032 [Homo sapiens] 27 3.5 gi|33589814 zyg-11 homolog B (C. elegans)-like [Homo sapiens] 27 3.5 gi|166064034 PAK-interacting exchange factor beta isoform c [Hom... 26 6.0 gi|4885587 small inducible cytokine A13 precursor [Homo sapiens] 26 6.0 gi|151301213 acid phosphatase 6, lysophosphatidic [Homo sapiens] 26 6.0 gi|82546847 hypothetical protein LOC9907 [Homo sapiens] 26 6.0 gi|239750425 PREDICTED: hypothetical protein XP_002347391 [Homo ... 26 7.8 gi|155030232 proline, glutamic acid and leucine rich protein 1 [... 26 7.8 >gi|5730035 small inducible cytokine A27 precursor [Homo sapiens] Length = 112 Score = 234 bits (597), Expect = 1e-62 Identities = 112/112 (100%), Positives = 112/112 (100%) Query: 1 MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG 60 MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG Sbjct: 1 MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADG 60 Query: 61 DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG 112 DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG Sbjct: 61 DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG 112 >gi|22538811 chemokine (C-C motif) ligand 28 precursor [Homo sapiens] Length = 127 Score = 65.5 bits (158), Expect = 9e-12 Identities = 29/73 (39%), Positives = 47/73 (64%), Gaps = 1/73 (1%) Query: 26 LLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSL 85 +LP +++CCT++ +S +LL +V +Q ADGDC L A +LH+ +R IC+ P N ++ Sbjct: 23 ILPIASSCCTEVSHH-ISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTV 81 Query: 86 SQWFEHQERKLHG 98 QW + Q K +G Sbjct: 82 KQWMKVQAAKKNG 94 >gi|22538796 small inducible cytokine A25 precursor [Homo sapiens] Length = 150 Score = 32.7 bits (73), Expect = 0.064 Identities = 15/51 (29%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query: 34 CTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQ--RSICIHPQN 82 C Y P+ +LR+ +QE G C+L A + +L + R +C +P++ Sbjct: 30 CCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKS 80 >gi|46488919 astrotactin 2 isoform c [Homo sapiens] Length = 1339 Score = 27.7 bits (60), Expect = 2.1 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 3 GPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEAD 59 GPP LLLL LLL P P LL +TA ++ P K + L+E+D Sbjct: 27 GPPPLLPLLLLFLLLLPPPP---LLAGATAAASREPDSPCRLKTVTVSTLPALRESD 80 >gi|46488917 astrotactin 2 isoform b [Homo sapiens] Length = 1335 Score = 27.7 bits (60), Expect = 2.1 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 3 GPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEAD 59 GPP LLLL LLL P P LL +TA ++ P K + L+E+D Sbjct: 27 GPPPLLPLLLLFLLLLPPPP---LLAGATAAASREPDSPCRLKTVTVSTLPALRESD 80 >gi|46488915 astrotactin 2 isoform a [Homo sapiens] Length = 1288 Score = 27.7 bits (60), Expect = 2.1 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 3 GPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEAD 59 GPP LLLL LLL P P LL +TA ++ P K + L+E+D Sbjct: 27 GPPPLLPLLLLFLLLLPPPP---LLAGATAAASREPDSPCRLKTVTVSTLPALRESD 80 >gi|239754662 PREDICTED: hypothetical protein [Homo sapiens] Length = 195 Score = 26.9 bits (58), Expect = 3.5 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 65 QAFVLHLAQRSICIHPQNPSLSQWFEHQ-ERKLHGTLP 101 Q V LA+ S+C HP P + E Q E+ L+G +P Sbjct: 53 QPLVKSLARASLCTHPGLPRTREHRELQWEQTLYGVVP 90 >gi|239749226 PREDICTED: hypothetical protein [Homo sapiens] Length = 195 Score = 26.9 bits (58), Expect = 3.5 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 65 QAFVLHLAQRSICIHPQNPSLSQWFEHQ-ERKLHGTLP 101 Q V LA+ S+C HP P + E Q E+ L+G +P Sbjct: 53 QPLVKSLARASLCTHPGLPRTREHRELQWEQTLYGVVP 90 >gi|239743303 PREDICTED: hypothetical protein [Homo sapiens] Length = 195 Score = 26.9 bits (58), Expect = 3.5 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 65 QAFVLHLAQRSICIHPQNPSLSQWFEHQ-ERKLHGTLP 101 Q V LA+ S+C HP P + E Q E+ L+G +P Sbjct: 53 QPLVKSLARASLCTHPGLPRTREHRELQWEQTLYGVVP 90 >gi|239508986 PREDICTED: hypothetical protein [Homo sapiens] Length = 195 Score = 26.9 bits (58), Expect = 3.5 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Query: 65 QAFVLHLAQRSICIHPQNPSLSQWFEHQ-ERKLHGTLP 101 Q V LA+ S+C HP P + E Q E+ L+G +P Sbjct: 53 QPLVKSLARASLCTHPGLPRTREHRELQWEQTLYGVVP 90 >gi|38348310 hypothetical protein LOC341032 [Homo sapiens] Length = 236 Score = 26.9 bits (58), Expect = 3.5 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Query: 16 LLSPDPTAA---FLLPPSTACCTQL 37 L PDP +A LPPST+C +QL Sbjct: 115 LSQPDPVSADALLTLPPSTSCLSQL 139 >gi|33589814 zyg-11 homolog B (C. elegans)-like [Homo sapiens] Length = 766 Score = 26.9 bits (58), Expect = 3.5 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 6/63 (9%) Query: 38 YRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLH 97 YR S KL R+VIQV L ++++ QR+ C+ N S+ + E Q R+++ Sbjct: 426 YRSEQSVKLRRQVIQVVLN------GMESYQEVTVQRNCCLTLCNFSIPEELEFQYRRVN 479 Query: 98 GTL 100 L Sbjct: 480 ELL 482 >gi|166064034 PAK-interacting exchange factor beta isoform c [Homo sapiens] Length = 803 Score = 26.2 bits (56), Expect = 6.0 Identities = 25/106 (23%), Positives = 38/106 (35%), Gaps = 14/106 (13%) Query: 11 LLLSLLLSPDP-----TAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQ 65 L L LL P LL ST LY+ +K+L ++ + AD Sbjct: 81 LRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTAD------ 134 Query: 66 AFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKM 111 + L S+C P + + + + LH KL G R + Sbjct: 135 ---IGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSL 177 >gi|4885587 small inducible cytokine A13 precursor [Homo sapiens] Length = 98 Score = 26.2 bits (56), Expect = 6.0 Identities = 26/100 (26%), Positives = 38/100 (38%), Gaps = 9/100 (9%) Query: 1 MKGPPTFCSLLLLSLLLSPDPTAA--FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEA 58 MK LLL++ +P A L PST C T +K +L VI Sbjct: 1 MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSR--- 57 Query: 59 DGDCHLQAFVLHLAQ-RSICIHPQNPSLSQWFEHQERKLH 97 C +A + + IC P+ + + +H RK H Sbjct: 58 ---CPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAH 94 >gi|151301213 acid phosphatase 6, lysophosphatidic [Homo sapiens] Length = 428 Score = 26.2 bits (56), Expect = 6.0 Identities = 12/24 (50%), Positives = 15/24 (62%) Query: 48 RKVIQVELQEADGDCHLQAFVLHL 71 R+V ELQEADG C + +L L Sbjct: 27 RRVALAELQEADGQCPVDRSLLKL 50 >gi|82546847 hypothetical protein LOC9907 [Homo sapiens] Length = 807 Score = 26.2 bits (56), Expect = 6.0 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 4/50 (8%) Query: 12 LLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKL---LRKVIQVELQEA 58 LL+LL P A F+L PST C+ Y + + L LR V ++ +EA Sbjct: 754 LLTLLKMPS-VAQFVLTPSTEVCSPRYHRDANTALPLALRTVSRLVEREA 802 >gi|239750425 PREDICTED: hypothetical protein XP_002347391 [Homo sapiens] Length = 341 Score = 25.8 bits (55), Expect = 7.8 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Query: 15 LLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLL-RKVIQVELQE 57 ++L P P+ A +P + + +YR P S LL + V+ E QE Sbjct: 246 VVLHPIPSGALAIPVARSLSWPVYRDPASHPLLPQPVLHPEPQE 289 >gi|155030232 proline, glutamic acid and leucine rich protein 1 [Homo sapiens] Length = 1130 Score = 25.8 bits (55), Expect = 7.8 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Query: 11 LLLSLLLSPDPTAAFLLPPSTACCTQLY 38 LLL+LLL+P P PP AC Q + Sbjct: 582 LLLALLLAPSPRC----PPPLACALQAF 605 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.325 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,156,100 Number of Sequences: 37866 Number of extensions: 215905 Number of successful extensions: 632 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 625 Number of HSP's gapped (non-prelim): 19 length of query: 112 length of database: 18,247,518 effective HSP length: 82 effective length of query: 30 effective length of database: 15,142,506 effective search space: 454275180 effective search space used: 454275180 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.