BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|222136632 NFKB inhibitor interacting Ras-like 2 isoform c [Homo sapiens] (97 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|222136632 NFKB inhibitor interacting Ras-like 2 isoform c [Ho... 195 7e-51 gi|222136630 NFKB inhibitor interacting Ras-like 2 isoform b [Ho... 115 1e-26 gi|222136628 NFKB inhibitor interacting Ras-like 2 isoform a [Ho... 115 1e-26 gi|19072794 NFKB inhibitor interacting Ras-like 2 isoform a [Hom... 115 1e-26 gi|47777758 NFKB inhibitor interacting Ras-like 2 isoform a [Hom... 115 1e-26 gi|9966809 kappa B-ras 1 [Homo sapiens] 91 2e-19 gi|55953120 RAS-related on chromosome 22 isoform b [Homo sapiens] 33 0.064 gi|5454030 RAS-related on chromosome 22 isoform a [Homo sapiens] 33 0.064 gi|4885581 Rho family GTPase 2 [Homo sapiens] 31 0.24 gi|38201690 RAP2B, member of RAS oncogene family [Homo sapiens] 29 0.71 gi|10518344 RAP2A, member of RAS oncogene family [Homo sapiens] 29 0.92 gi|32129209 RAP2C, member of RAS oncogene family [Homo sapiens] 29 0.92 gi|11034843 ras homolog gene family, member U [Homo sapiens] 28 1.2 gi|7657033 5',3'-nucleotidase, cytosolic [Homo sapiens] 28 1.2 gi|96975135 RAB24 gene product [Homo sapiens] 28 1.6 gi|72534833 RAB24 gene product [Homo sapiens] 28 1.6 gi|24415404 MDN1, midasin homolog [Homo sapiens] 28 1.6 gi|4885069 ras homolog gene family, member E [Homo sapiens] 28 2.1 gi|223555935 dynein, axonemal, heavy polypeptide 14 isoform 1 [H... 27 2.7 gi|4757772 DIRAS family, GTP-binding RAS-like 3 [Homo sapiens] 27 2.7 gi|28376635 RAB37, member RAS oncogene family isoform 3 [Homo sa... 27 2.7 gi|29029601 DEAH (Asp-Glu-Ala-His) box polypeptide 37 [Homo sapi... 27 2.7 gi|223671872 inhibitor of kappa light polypeptide gene enhancer ... 27 3.5 gi|74096429 RAB41, member RAS oncogene family [Homo sapiens] 27 4.6 gi|224831253 optic atrophy 1 isoform 8 [Homo sapiens] 26 6.0 gi|224831251 optic atrophy 1 isoform 7 [Homo sapiens] 26 6.0 gi|18860841 optic atrophy 1 isoform 6 [Homo sapiens] 26 6.0 gi|224831248 optic atrophy 1 isoform 5 [Homo sapiens] 26 6.0 gi|18860835 optic atrophy 1 isoform 4 [Homo sapiens] 26 6.0 gi|18860833 optic atrophy 1 isoform 3 [Homo sapiens] 26 6.0 >gi|222136632 NFKB inhibitor interacting Ras-like 2 isoform c [Homo sapiens] Length = 97 Score = 195 bits (495), Expect = 7e-51 Identities = 97/97 (100%), Positives = 97/97 (100%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQIAES 60 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQIAES Sbjct: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQIAES 60 Query: 61 LFSVWSCSRRRLTNPRTRRRSPSWSLATSVTYRSSGV 97 LFSVWSCSRRRLTNPRTRRRSPSWSLATSVTYRSSGV Sbjct: 61 LFSVWSCSRRRLTNPRTRRRSPSWSLATSVTYRSSGV 97 >gi|222136630 NFKB inhibitor interacting Ras-like 2 isoform b [Homo sapiens] Length = 135 Score = 115 bits (287), Expect = 1e-26 Identities = 56/57 (98%), Positives = 57/57 (100%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQI 57 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQ+ Sbjct: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQV 57 >gi|222136628 NFKB inhibitor interacting Ras-like 2 isoform a [Homo sapiens] Length = 191 Score = 115 bits (287), Expect = 1e-26 Identities = 56/57 (98%), Positives = 57/57 (100%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQI 57 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQ+ Sbjct: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQV 57 >gi|19072794 NFKB inhibitor interacting Ras-like 2 isoform a [Homo sapiens] Length = 191 Score = 115 bits (287), Expect = 1e-26 Identities = 56/57 (98%), Positives = 57/57 (100%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQI 57 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQ+ Sbjct: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQV 57 >gi|47777758 NFKB inhibitor interacting Ras-like 2 isoform a [Homo sapiens] Length = 191 Score = 115 bits (287), Expect = 1e-26 Identities = 56/57 (98%), Positives = 57/57 (100%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQI 57 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQ+ Sbjct: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQV 57 >gi|9966809 kappa B-ras 1 [Homo sapiens] Length = 192 Score = 91.3 bits (225), Expect = 2e-19 Identities = 41/57 (71%), Positives = 48/57 (84%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQI 57 MGK CKVVVCG SVGKT+ILEQLLYGNH +G E ET ED+Y+ S+ETDRGV+EQ+ Sbjct: 1 MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQL 57 >gi|55953120 RAS-related on chromosome 22 isoform b [Homo sapiens] Length = 115 Score = 32.7 bits (73), Expect = 0.064 Identities = 14/29 (48%), Positives = 20/29 (68%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNH 29 MG S +V V G VGKT+I+ Q L+G++ Sbjct: 1 MGGSLRVAVLGAPGVGKTAIIRQFLFGDY 29 >gi|5454030 RAS-related on chromosome 22 isoform a [Homo sapiens] Length = 203 Score = 32.7 bits (73), Expect = 0.064 Identities = 14/29 (48%), Positives = 20/29 (68%) Query: 1 MGKSCKVVVCGQASVGKTSILEQLLYGNH 29 MG S +V V G VGKT+I+ Q L+G++ Sbjct: 1 MGGSLRVAVLGAPGVGKTAIIRQFLFGDY 29 >gi|4885581 Rho family GTPase 2 [Homo sapiens] Length = 227 Score = 30.8 bits (68), Expect = 0.24 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Query: 5 CKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDR 51 CK+VV G A GKT++L+ ++ + T + Y S E D+ Sbjct: 8 CKIVVVGDAECGKTALLQ--VFAKDAYPGSYVPTVFENYTASFEIDK 52 >gi|38201690 RAP2B, member of RAS oncogene family [Homo sapiens] Length = 183 Score = 29.3 bits (64), Expect = 0.71 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Query: 6 KVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETD 50 KVVV G VGK+++ Q + G+ + + T ED Y IE D Sbjct: 5 KVVVLGSGGVGKSALTVQFVTGSFI--EKYDPTIEDFYRKEIEVD 47 >gi|10518344 RAP2A, member of RAS oncogene family [Homo sapiens] Length = 183 Score = 28.9 bits (63), Expect = 0.92 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 6 KVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETD 50 KVVV G VGK+++ Q + G + + T ED Y IE D Sbjct: 5 KVVVLGSGGVGKSALTVQFVTGTFI--EKYDPTIEDFYRKEIEVD 47 >gi|32129209 RAP2C, member of RAS oncogene family [Homo sapiens] Length = 183 Score = 28.9 bits (63), Expect = 0.92 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 6 KVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETD 50 KVVV G VGK+++ Q + G + + T ED Y IE D Sbjct: 5 KVVVLGSGGVGKSALTVQFVTGTFI--EKYDPTIEDFYRKEIEVD 47 >gi|11034843 ras homolog gene family, member U [Homo sapiens] Length = 258 Score = 28.5 bits (62), Expect = 1.2 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query: 2 GKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETD-RGVREQIAES 60 G+ K V+ G +VGKTS++ + Y + +E I T D + + D R VR Q+ ++ Sbjct: 47 GRGVKCVLVGDGAVGKTSLV--VSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDT 104 >gi|7657033 5',3'-nucleotidase, cytosolic [Homo sapiens] Length = 201 Score = 28.5 bits (62), Expect = 1.2 Identities = 16/45 (35%), Positives = 20/45 (44%) Query: 41 DIYVGSIETDRGVREQIAESLFSVWSCSRRRLTNPRTRRRSPSWS 85 D+ + +T RG E + C R L P TRRR SWS Sbjct: 140 DLLIDDKDTVRGQEETPSWEHILFTCCHNRHLVLPPTRRRLLSWS 184 >gi|96975135 RAB24 gene product [Homo sapiens] Length = 203 Score = 28.1 bits (61), Expect = 1.6 Identities = 12/27 (44%), Positives = 20/27 (74%) Query: 6 KVVVCGQASVGKTSILEQLLYGNHVVG 32 KVV+ G+ VGKTS++E+ ++ +VG Sbjct: 9 KVVMLGKEYVGKTSLVERYVHDRFLVG 35 >gi|72534833 RAB24 gene product [Homo sapiens] Length = 203 Score = 28.1 bits (61), Expect = 1.6 Identities = 12/27 (44%), Positives = 20/27 (74%) Query: 6 KVVVCGQASVGKTSILEQLLYGNHVVG 32 KVV+ G+ VGKTS++E+ ++ +VG Sbjct: 9 KVVMLGKEYVGKTSLVERYVHDRFLVG 35 >gi|24415404 MDN1, midasin homolog [Homo sapiens] Length = 5596 Score = 28.1 bits (61), Expect = 1.6 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 7/49 (14%) Query: 7 VVVCGQASVGKTSILEQL--LYGNHVV---GSEMIETQEDIYVGSIETD 50 V++ G+ SVGKTS+++ L GNH V E + QE Y+G +D Sbjct: 1080 VLIQGETSVGKTSLIQWLAAATGNHCVRINNHEHTDIQE--YIGCYTSD 1126 >gi|4885069 ras homolog gene family, member E [Homo sapiens] Length = 244 Score = 27.7 bits (60), Expect = 2.1 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 5 CKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETD 50 CK+VV G + GKT++L ++ + T + Y S E D Sbjct: 24 CKIVVVGDSQCGKTALLH--VFAKDCFPENYVPTVFENYTASFEID 67 >gi|223555935 dynein, axonemal, heavy polypeptide 14 isoform 1 [Homo sapiens] Length = 4515 Score = 27.3 bits (59), Expect = 2.7 Identities = 10/22 (45%), Positives = 17/22 (77%) Query: 4 SCKVVVCGQASVGKTSILEQLL 25 SC V++ G++ VGKT+ + Q+L Sbjct: 2329 SCPVLLTGESGVGKTAAINQML 2350 >gi|4757772 DIRAS family, GTP-binding RAS-like 3 [Homo sapiens] Length = 229 Score = 27.3 bits (59), Expect = 2.7 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Query: 6 KVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGV 53 +VVV G A VGK+++L + GN E + T E+ Y + GV Sbjct: 39 RVVVVGTAGVGKSTLLHKWASGN--FRHEYLPTIENTYCQLLGCSHGV 84 >gi|28376635 RAB37, member RAS oncogene family isoform 3 [Homo sapiens] Length = 216 Score = 27.3 bits (59), Expect = 2.7 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 6 KVVVCGQASVGKTSILEQLLYGNHVVGS 33 K ++ G + VGKTS+L Q G + GS Sbjct: 24 KTILVGDSGVGKTSLLVQFDQGKFIPGS 51 >gi|29029601 DEAH (Asp-Glu-Ala-His) box polypeptide 37 [Homo sapiens] Length = 1157 Score = 27.3 bits (59), Expect = 2.7 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 7/64 (10%) Query: 7 VVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQIAESLFSVWS 66 V+VCG+ GKT+ + Q LY E + ED +G E R +++ + + Sbjct: 271 VIVCGETGSGKTTQVPQFLY-------EAGFSSEDSIIGVTEPRRVAAVAMSQRVAKEMN 323 Query: 67 CSRR 70 S+R Sbjct: 324 LSQR 327 >gi|223671872 inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma isoform c [Homo sapiens] Length = 320 Score = 26.9 bits (58), Expect = 3.5 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Query: 26 YGNH----VVGSEMIETQEDIYVGSIETDRGVREQIAE 59 Y NH VVGSE + DIY + +R RE++AE Sbjct: 190 YDNHIKSSVVGSE--RKRADIYKADFQAERQAREKLAE 225 >gi|74096429 RAB41, member RAS oncogene family [Homo sapiens] Length = 222 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/23 (43%), Positives = 17/23 (73%) Query: 6 KVVVCGQASVGKTSILEQLLYGN 28 K++ G+ SVGKTSI+ + +Y + Sbjct: 33 KLLFLGEQSVGKTSIISRFMYNS 55 >gi|224831253 optic atrophy 1 isoform 8 [Homo sapiens] Length = 1015 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 6 KVVVCGQASVGKTSILEQL 24 +VVV G S GKTS+LE + Sbjct: 345 RVVVVGDQSAGKTSVLEMI 363 >gi|224831251 optic atrophy 1 isoform 7 [Homo sapiens] Length = 997 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 6 KVVVCGQASVGKTSILEQL 24 +VVV G S GKTS+LE + Sbjct: 327 RVVVVGDQSAGKTSVLEMI 345 >gi|18860841 optic atrophy 1 isoform 6 [Homo sapiens] Length = 979 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 6 KVVVCGQASVGKTSILEQL 24 +VVV G S GKTS+LE + Sbjct: 309 RVVVVGDQSAGKTSVLEMI 327 >gi|224831248 optic atrophy 1 isoform 5 [Homo sapiens] Length = 978 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 6 KVVVCGQASVGKTSILEQL 24 +VVV G S GKTS+LE + Sbjct: 308 RVVVVGDQSAGKTSVLEMI 326 >gi|18860835 optic atrophy 1 isoform 4 [Homo sapiens] Length = 961 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 6 KVVVCGQASVGKTSILEQL 24 +VVV G S GKTS+LE + Sbjct: 291 RVVVVGDQSAGKTSVLEMI 309 >gi|18860833 optic atrophy 1 isoform 3 [Homo sapiens] Length = 942 Score = 26.2 bits (56), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Query: 6 KVVVCGQASVGKTSILEQL 24 +VVV G S GKTS+LE + Sbjct: 272 RVVVVGDQSAGKTSVLEMI 290 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.316 0.129 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,440,657 Number of Sequences: 37866 Number of extensions: 114884 Number of successful extensions: 478 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 22 Number of HSP's that attempted gapping in prelim test: 449 Number of HSP's gapped (non-prelim): 52 length of query: 97 length of database: 18,247,518 effective HSP length: 68 effective length of query: 29 effective length of database: 15,672,630 effective search space: 454506270 effective search space used: 454506270 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.