BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|41406094 J domain containing protein 1 isoform b [Homo sapiens] (107 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|41406094 J domain containing protein 1 isoform b [Homo sapiens] 221 8e-59 gi|11141871 J domain containing protein 1 isoform a [Homo sapiens] 206 3e-54 gi|8922563 DnaJ (Hsp40) homolog, subfamily C, member 17 [Homo sa... 71 2e-13 gi|24308127 DnaJ (Hsp40) homolog, subfamily C, member 10 [Homo s... 62 1e-10 gi|7706495 DnaJ (Hsp40) homolog, subfamily B, member 11 precurso... 59 1e-09 gi|45504382 DnaJ (Hsp40) homolog, subfamily C, member 5 [Homo sa... 54 3e-08 gi|21553335 DnaJ (Hsp40) homolog, subfamily B, member 7 [Homo sa... 54 4e-08 gi|205360840 DnaJ (Hsp40) homolog, subfamily A, member 3 isoform... 52 8e-08 gi|205360838 DnaJ (Hsp40) homolog, subfamily A, member 3 isoform... 52 8e-08 gi|157671935 DnaJ (Hsp40) homolog, subfamily C, member 4 [Homo s... 52 1e-07 gi|29126218 DnaJ (Hsp40) homolog, subfamily C, member 5 beta [Ho... 52 1e-07 gi|6631085 DnaJ (Hsp40) homolog, subfamily B, member 4 [Homo sap... 50 3e-07 gi|56687498 DnaJ (Hsp40) homolog, subfamily C, member 16 [Homo s... 50 3e-07 gi|217035105 DnaJ (Hsp40) homolog, subfamily C, member 11 [Homo ... 50 4e-07 gi|17388799 DnaJ (Hsp40) homolog, subfamily B, member 6 isoform ... 50 4e-07 gi|4885495 DnaJ (Hsp40) homolog, subfamily B, member 6 isoform b... 50 4e-07 gi|169201730 PREDICTED: hypothetical protein [Homo sapiens] 48 1e-06 gi|239749864 PREDICTED: hypothetical protein [Homo sapiens] 48 1e-06 gi|239744166 PREDICTED: hypothetical protein [Homo sapiens] 48 1e-06 gi|201862587 DnaJ (Hsp40) homolog, subfamily B, member 5 isoform... 48 1e-06 gi|201862518 DnaJ (Hsp40) homolog, subfamily B, member 5 isoform... 48 1e-06 gi|194306642 DnaJ (Hsp40) homolog, subfamily B, member 12 [Homo ... 48 2e-06 gi|194306640 DnaJ (Hsp40) homolog, subfamily B, member 12 [Homo ... 48 2e-06 gi|56549115 DnaJ (Hsp40) homolog, subfamily B, member 5 isoform ... 48 2e-06 gi|221219053 DnaJ (Hsp40) homolog, subfamily C, member 7 isoform... 47 3e-06 gi|88501736 DnaJ (Hsp40) homolog, subfamily B, member 2 isoform ... 47 3e-06 gi|27151736 DnaJ (Hsp40) homolog, subfamily B, member 2 isoform ... 47 3e-06 gi|47777312 DnaJ (Hsp40) homolog, subfamily B, member 3 [Homo sa... 47 3e-06 gi|23503241 DnaJ homolog, subfamily B, member 8 [Homo sapiens] 47 3e-06 gi|221219056 DnaJ (Hsp40) homolog, subfamily C, member 7 isoform... 46 6e-06 >gi|41406094 J domain containing protein 1 isoform b [Homo sapiens] Length = 107 Score = 221 bits (564), Expect = 8e-59 Identities = 107/107 (100%), Positives = 107/107 (100%) Query: 1 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQ 60 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQ Sbjct: 1 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQ 60 Query: 61 KAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGAT 107 KAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGAT Sbjct: 61 KAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGAT 107 >gi|11141871 J domain containing protein 1 isoform a [Homo sapiens] Length = 198 Score = 206 bits (525), Expect = 3e-54 Identities = 99/99 (100%), Positives = 99/99 (100%) Query: 1 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQ 60 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQ Sbjct: 1 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQ 60 Query: 61 KAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKT 99 KAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKT Sbjct: 61 KAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKT 99 >gi|8922563 DnaJ (Hsp40) homolog, subfamily C, member 17 [Homo sapiens] Length = 304 Score = 70.9 bits (172), Expect = 2e-13 Identities = 34/93 (36%), Positives = 59/93 (63%), Gaps = 1/93 (1%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRA 73 D Y LLG +E ++ +++ ++ +AL CHPDK+P+NP+A E F +L +A E+LT+ +RA Sbjct: 11 DLYALLGIEEKAADKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALEVLTDAAARA 70 Query: 74 RYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGA 106 YD R+++ ++ + L++ K V L A Sbjct: 71 AYDKVRKAK-KQAAERTQKLDEKRKKVKLDLEA 102 >gi|24308127 DnaJ (Hsp40) homolog, subfamily C, member 10 [Homo sapiens] Length = 793 Score = 62.0 bits (149), Expect = 1e-10 Identities = 28/66 (42%), Positives = 43/66 (65%) Query: 13 EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESR 72 +D+Y+LLG + +S +I FK AL+ HPDK+P NP A F K+ +A E+L +E+ R Sbjct: 34 QDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLR 93 Query: 73 ARYDHW 78 +YD + Sbjct: 94 KKYDKY 99 >gi|7706495 DnaJ (Hsp40) homolog, subfamily B, member 11 precursor [Homo sapiens] Length = 358 Score = 58.5 bits (140), Expect = 1e-09 Identities = 25/63 (39%), Positives = 42/63 (66%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRA 73 D+Y +LG +S++ I ++ AL+ HPD++P++P+A E FQ L A E+L++ E R Sbjct: 25 DFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRK 84 Query: 74 RYD 76 +YD Sbjct: 85 QYD 87 >gi|45504382 DnaJ (Hsp40) homolog, subfamily C, member 5 [Homo sapiens] Length = 198 Score = 53.9 bits (128), Expect = 3e-08 Identities = 25/70 (35%), Positives = 42/70 (60%) Query: 9 SEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTN 68 S E Y +LG D+ ++ + I ++ AL+ HPDK+P+NP+A + F+++ A ILT+ Sbjct: 10 STSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTD 69 Query: 69 EESRARYDHW 78 R YD + Sbjct: 70 ATKRNIYDKY 79 >gi|21553335 DnaJ (Hsp40) homolog, subfamily B, member 7 [Homo sapiens] Length = 309 Score = 53.5 bits (127), Expect = 4e-08 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVE-TFQKLQKAKEILTNEESR 72 DYY +LG +S E I + AL+ HPDK+PEN + E F+++ +A E+L+N+E R Sbjct: 3 DYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDEKR 62 Query: 73 ARYDHW 78 YD + Sbjct: 63 DIYDKY 68 >gi|205360840 DnaJ (Hsp40) homolog, subfamily A, member 3 isoform 2 [Homo sapiens] Length = 453 Score = 52.4 bits (124), Expect = 8e-08 Identities = 25/64 (39%), Positives = 40/64 (62%) Query: 13 EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESR 72 EDYY +LG +S ++I + A + HPD + ++PKA E F +L +A E+L++E R Sbjct: 92 EDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKR 151 Query: 73 ARYD 76 +YD Sbjct: 152 KQYD 155 >gi|205360838 DnaJ (Hsp40) homolog, subfamily A, member 3 isoform 1 [Homo sapiens] Length = 480 Score = 52.4 bits (124), Expect = 8e-08 Identities = 25/64 (39%), Positives = 40/64 (62%) Query: 13 EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESR 72 EDYY +LG +S ++I + A + HPD + ++PKA E F +L +A E+L++E R Sbjct: 92 EDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKR 151 Query: 73 ARYD 76 +YD Sbjct: 152 KQYD 155 >gi|157671935 DnaJ (Hsp40) homolog, subfamily C, member 4 [Homo sapiens] Length = 241 Score = 52.0 bits (123), Expect = 1e-07 Identities = 26/67 (38%), Positives = 37/67 (55%) Query: 15 YYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRAR 74 YY LLG +S E++ F ++ E HPD+ P NP F +L +A +L+ E+SR Sbjct: 35 YYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRS 94 Query: 75 YDHWRRS 81 YD RS Sbjct: 95 YDDQLRS 101 >gi|29126218 DnaJ (Hsp40) homolog, subfamily C, member 5 beta [Homo sapiens] Length = 199 Score = 51.6 bits (122), Expect = 1e-07 Identities = 25/66 (37%), Positives = 41/66 (62%) Query: 13 EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESR 72 E Y +LG + +S E+I ++ AL+ HPDK+P++P A E F+++ A ILT+ R Sbjct: 18 EALYEILGLHKGASNEEIKKTYRKLALKHHPDKNPDDPAATEKFKEINNAHAILTDISKR 77 Query: 73 ARYDHW 78 + YD + Sbjct: 78 SIYDKY 83 >gi|6631085 DnaJ (Hsp40) homolog, subfamily B, member 4 [Homo sapiens] Length = 337 Score = 50.4 bits (119), Expect = 3e-07 Identities = 24/66 (36%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Query: 13 EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESR 72 +DYY +LG ++ +S E I ++ +AL+ HPDK+ ++P+A E F+++ +A E+L++ + R Sbjct: 3 KDYYCILGIEKGASDEDIKKAYRKQALKFHPDKN-KSPQAEEKFKEVAEAYEVLSDPKKR 61 Query: 73 ARYDHW 78 YD + Sbjct: 62 EIYDQF 67 >gi|56687498 DnaJ (Hsp40) homolog, subfamily C, member 16 [Homo sapiens] Length = 782 Score = 50.4 bits (119), Expect = 3e-07 Identities = 28/76 (36%), Positives = 44/76 (57%), Gaps = 1/76 (1%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRA 73 D Y +LG +S I +K A E HPDK+ ++P A + F ++ KA EIL+NEE R+ Sbjct: 29 DPYRVLGVSRTASQADIKKAYKKLAREWHPDKN-KDPGAEDKFIQISKAYEILSNEEKRS 87 Query: 74 RYDHWRRSQMSMPFQQ 89 YD + + + +Q+ Sbjct: 88 NYDQYGDAGENQGYQK 103 >gi|217035105 DnaJ (Hsp40) homolog, subfamily C, member 11 [Homo sapiens] Length = 559 Score = 50.1 bits (118), Expect = 4e-07 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 5/96 (5%) Query: 1 MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKH--PE-NPKAVETFQ 57 M L+ D EDYY+LL +S E++ A ++ + HPDKH PE +A F Sbjct: 1 MATALSEEELDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFN 60 Query: 58 KLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEAL 93 + +A E+L++ ++RA YD + + + M + WE + Sbjct: 61 LVHQAYEVLSDPQTRAIYDIYGKRGLEM--EGWEVV 94 >gi|17388799 DnaJ (Hsp40) homolog, subfamily B, member 6 isoform a [Homo sapiens] Length = 326 Score = 50.1 bits (118), Expect = 4e-07 Identities = 25/72 (34%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVE-TFQKLQKAKEILTNEESR 72 DYY +LG +S E I ++ AL+ HPDK+PEN + E F+++ +A E+L++ + R Sbjct: 3 DYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKR 62 Query: 73 ARYDHWRRSQMS 84 YD + + ++ Sbjct: 63 DIYDKYGKEGLN 74 >gi|4885495 DnaJ (Hsp40) homolog, subfamily B, member 6 isoform b [Homo sapiens] Length = 241 Score = 50.1 bits (118), Expect = 4e-07 Identities = 25/72 (34%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVE-TFQKLQKAKEILTNEESR 72 DYY +LG +S E I ++ AL+ HPDK+PEN + E F+++ +A E+L++ + R Sbjct: 3 DYYEVLGVQRHASPEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKR 62 Query: 73 ARYDHWRRSQMS 84 YD + + ++ Sbjct: 63 DIYDKYGKEGLN 74 >gi|169201730 PREDICTED: hypothetical protein [Homo sapiens] Length = 208 Score = 48.1 bits (113), Expect = 1e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Query: 43 PDKHPENPKAVETFQKLQKAKEILTNEESRARYDH 77 P + EN KA+ET QK QKAKEILTNEES A Y H Sbjct: 3 PQQASENSKAMETVQKPQKAKEILTNEESCAHYHH 37 >gi|239749864 PREDICTED: hypothetical protein [Homo sapiens] Length = 208 Score = 48.1 bits (113), Expect = 1e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Query: 43 PDKHPENPKAVETFQKLQKAKEILTNEESRARYDH 77 P + EN KA+ET QK QKAKEILTNEES A Y H Sbjct: 3 PQQASENSKAMETVQKPQKAKEILTNEESCAHYHH 37 >gi|239744166 PREDICTED: hypothetical protein [Homo sapiens] Length = 208 Score = 48.1 bits (113), Expect = 1e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Query: 43 PDKHPENPKAVETFQKLQKAKEILTNEESRARYDH 77 P + EN KA+ET QK QKAKEILTNEES A Y H Sbjct: 3 PQQASENSKAMETVQKPQKAKEILTNEESCAHYHH 37 >gi|201862587 DnaJ (Hsp40) homolog, subfamily B, member 5 isoform 1 [Homo sapiens] Length = 420 Score = 48.1 bits (113), Expect = 1e-06 Identities = 24/87 (27%), Positives = 51/87 (58%), Gaps = 10/87 (11%) Query: 1 MDAILNYRSEDT---------EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPK 51 ++ + +R+++T +DYY +LG ++ ++I ++ AL+ HPDK+ E P Sbjct: 54 LNGFVKFRNKETSAGPVAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-PN 112 Query: 52 AVETFQKLQKAKEILTNEESRARYDHW 78 A E F+++ +A ++L++ + R YD + Sbjct: 113 AEEKFKEIAEAYDVLSDPKKRGLYDQY 139 >gi|201862518 DnaJ (Hsp40) homolog, subfamily B, member 5 isoform 2 [Homo sapiens] Length = 382 Score = 48.1 bits (113), Expect = 1e-06 Identities = 24/87 (27%), Positives = 51/87 (58%), Gaps = 10/87 (11%) Query: 1 MDAILNYRSEDT---------EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPK 51 ++ + +R+++T +DYY +LG ++ ++I ++ AL+ HPDK+ E P Sbjct: 16 LNGFVKFRNKETSAGPVAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-PN 74 Query: 52 AVETFQKLQKAKEILTNEESRARYDHW 78 A E F+++ +A ++L++ + R YD + Sbjct: 75 AEEKFKEIAEAYDVLSDPKKRGLYDQY 101 >gi|194306642 DnaJ (Hsp40) homolog, subfamily B, member 12 [Homo sapiens] Length = 409 Score = 47.8 bits (112), Expect = 2e-06 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Query: 8 RSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILT 67 R + +DYY +LG +S E + ++ AL+ HPDK+ P A E F+ + A +L+ Sbjct: 138 RVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKN-HAPGATEAFKAIGTAYAVLS 196 Query: 68 NEESRARYDHW 78 N E R +YD + Sbjct: 197 NPEKRKQYDQF 207 >gi|194306640 DnaJ (Hsp40) homolog, subfamily B, member 12 [Homo sapiens] Length = 409 Score = 47.8 bits (112), Expect = 2e-06 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%) Query: 8 RSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILT 67 R + +DYY +LG +S E + ++ AL+ HPDK+ P A E F+ + A +L+ Sbjct: 138 RVKQCKDYYEILGVSRGASDEDLKKAYRRLALKFHPDKN-HAPGATEAFKAIGTAYAVLS 196 Query: 68 NEESRARYDHW 78 N E R +YD + Sbjct: 197 NPEKRKQYDQF 207 >gi|56549115 DnaJ (Hsp40) homolog, subfamily B, member 5 isoform 3 [Homo sapiens] Length = 348 Score = 47.8 bits (112), Expect = 2e-06 Identities = 22/66 (33%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Query: 13 EDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESR 72 +DYY +LG ++ ++I ++ AL+ HPDK+ E P A E F+++ +A ++L++ + R Sbjct: 3 KDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKE-PNAEEKFKEIAEAYDVLSDPKKR 61 Query: 73 ARYDHW 78 YD + Sbjct: 62 GLYDQY 67 >gi|221219053 DnaJ (Hsp40) homolog, subfamily C, member 7 isoform 1 [Homo sapiens] Length = 494 Score = 47.4 bits (111), Expect = 3e-06 Identities = 26/80 (32%), Positives = 45/80 (56%), Gaps = 5/80 (6%) Query: 2 DAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVE-----TF 56 +A L R +DYY +LG D+ +S ++I ++ RAL HPD+H V+ F Sbjct: 369 NAQLELRKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKF 428 Query: 57 QKLQKAKEILTNEESRARYD 76 +++ +A IL++ + + RYD Sbjct: 429 KEVGEAFTILSDPKKKTRYD 448 >gi|88501736 DnaJ (Hsp40) homolog, subfamily B, member 2 isoform a [Homo sapiens] Length = 277 Score = 47.4 bits (111), Expect = 3e-06 Identities = 22/71 (30%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Query: 15 YYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPK-AVETFQKLQKAKEILTNEESRA 73 YY +L +S + I ++ +AL+ HPDK+P+N + A + F+++ +A E+L+++ R Sbjct: 4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKRE 63 Query: 74 RYDHWRRSQMS 84 YD + R ++ Sbjct: 64 IYDRYGREGLT 74 >gi|27151736 DnaJ (Hsp40) homolog, subfamily B, member 2 isoform b [Homo sapiens] Length = 324 Score = 47.4 bits (111), Expect = 3e-06 Identities = 22/71 (30%), Positives = 44/71 (61%), Gaps = 1/71 (1%) Query: 15 YYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPK-AVETFQKLQKAKEILTNEESRA 73 YY +L +S + I ++ +AL+ HPDK+P+N + A + F+++ +A E+L+++ R Sbjct: 4 YYEILDVPRSASADDIKKAYRRKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKRE 63 Query: 74 RYDHWRRSQMS 84 YD + R ++ Sbjct: 64 IYDRYGREGLT 74 >gi|47777312 DnaJ (Hsp40) homolog, subfamily B, member 3 [Homo sapiens] Length = 145 Score = 47.0 bits (110), Expect = 3e-06 Identities = 24/66 (36%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVE-TFQKLQKAKEILTNEESR 72 DYY +L +S E I ++ AL+ HPDK+PEN + E F+++ +A E+L++ + R Sbjct: 3 DYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKR 62 Query: 73 ARYDHW 78 YD + Sbjct: 63 DIYDRY 68 >gi|23503241 DnaJ homolog, subfamily B, member 8 [Homo sapiens] Length = 232 Score = 47.0 bits (110), Expect = 3e-06 Identities = 23/64 (35%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Query: 14 DYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVE-TFQKLQKAKEILTNEESR 72 +YY +LG +S E I ++ AL HPDK+P+N + E F+ + +A E+L++ + R Sbjct: 3 NYYEVLGVQASASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKLVSEAYEVLSDSKKR 62 Query: 73 ARYD 76 + YD Sbjct: 63 SLYD 66 >gi|221219056 DnaJ (Hsp40) homolog, subfamily C, member 7 isoform 2 [Homo sapiens] Length = 438 Score = 46.2 bits (108), Expect = 6e-06 Identities = 25/80 (31%), Positives = 45/80 (56%), Gaps = 5/80 (6%) Query: 2 DAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVE-----TF 56 +A L + +DYY +LG D+ +S ++I ++ RAL HPD+H V+ F Sbjct: 313 NAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKF 372 Query: 57 QKLQKAKEILTNEESRARYD 76 +++ +A IL++ + + RYD Sbjct: 373 KEVGEAFTILSDPKKKTRYD 392 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.315 0.129 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,713,959 Number of Sequences: 37866 Number of extensions: 129194 Number of successful extensions: 656 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 25 Number of HSP's that attempted gapping in prelim test: 575 Number of HSP's gapped (non-prelim): 80 length of query: 107 length of database: 18,247,518 effective HSP length: 77 effective length of query: 30 effective length of database: 15,331,836 effective search space: 459955080 effective search space used: 459955080 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.