BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|116812618 hypothetical protein LOC152940 [Homo sapiens] (186 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|116812618 hypothetical protein LOC152940 [Homo sapiens] 392 e-109 gi|221136781 S1 RNA binding domain 1 [Homo sapiens] 34 0.083 gi|38327039 heat shock 70kDa protein 4 [Homo sapiens] 31 0.54 gi|5174623 placental protein 11 precursor [Homo sapiens] 31 0.54 gi|54112403 chromodomain helicase DNA binding protein 7 [Homo sa... 28 4.6 gi|156105685 ATP-binding cassette, sub-family B, member 8 [Homo ... 28 5.9 gi|7657544 sodium channel, voltage gated, type VIII, alpha [Homo... 28 5.9 >gi|116812618 hypothetical protein LOC152940 [Homo sapiens] Length = 186 Score = 392 bits (1006), Expect = e-109 Identities = 186/186 (100%), Positives = 186/186 (100%) Query: 1 MASVSYQKPTSTTVGKQMIFTGPDYIKDYLPKIHQHTSYVGEQHLALEKTGDLRYLWRPA 60 MASVSYQKPTSTTVGKQMIFTGPDYIKDYLPKIHQHTSYVGEQHLALEKTGDLRYLWRPA Sbjct: 1 MASVSYQKPTSTTVGKQMIFTGPDYIKDYLPKIHQHTSYVGEQHLALEKTGDLRYLWRPA 60 Query: 61 SNRSLPAKYKHEYVSEIGWRIPQYNFINKSRLGSGFHIKYEELSQASLDSITHRYQNPWQ 120 SNRSLPAKYKHEYVSEIGWRIPQYNFINKSRLGSGFHIKYEELSQASLDSITHRYQNPWQ Sbjct: 61 SNRSLPAKYKHEYVSEIGWRIPQYNFINKSRLGSGFHIKYEELSQASLDSITHRYQNPWQ 120 Query: 121 PKPHVLDMQGKQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKK 180 PKPHVLDMQGKQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKK Sbjct: 121 PKPHVLDMQGKQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKK 180 Query: 181 EKKRKH 186 EKKRKH Sbjct: 181 EKKRKH 186 >gi|221136781 S1 RNA binding domain 1 [Homo sapiens] Length = 995 Score = 33.9 bits (76), Expect = 0.083 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 118 PWQPKPHVLDMQGKQSRASFAWHMSAFEDTDQRNSKW---AILVRQCKSSLPRASKPPKL 174 P + K V D+ K +SF+ SA E+ D+ +S W + R K P+ SKP ++ Sbjct: 5 PRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRSRKQPPPKESKPKRM 64 Query: 175 PKLPK 179 P++ K Sbjct: 65 PRVKK 69 >gi|38327039 heat shock 70kDa protein 4 [Homo sapiens] Length = 840 Score = 31.2 bits (69), Expect = 0.54 Identities = 32/137 (23%), Positives = 57/137 (41%), Gaps = 10/137 (7%) Query: 47 LEKTGDLRYLWRPASNRSLPAKYKHEYVSEIGWRIPQYNFINKSRLGSGFHIKYEELSQA 106 ++K +L+ L +P R ++ + + E+G +I QY I S +Y+ L A Sbjct: 672 VDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNK--EDQYDHLDAA 729 Query: 107 SLDSITHRYQNPWQPKPHVLDMQGKQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLP 166 + + + + L++Q KQS M + + +K L C P Sbjct: 730 DMTKVEKSTNEAMEWMNNKLNLQNKQSLT-----MDPVVKSKEIEAKIKELTSTCS---P 781 Query: 167 RASKPPKLPKLPKKEKK 183 SKP + PK+E+K Sbjct: 782 IISKPKPKVEPPKEEQK 798 >gi|5174623 placental protein 11 precursor [Homo sapiens] Length = 369 Score = 31.2 bits (69), Expect = 0.54 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 22/111 (19%) Query: 26 IKDYLPKIHQHTSYVGEQHLALEKTGDLRYLWRPASNRSLP----AKYKHEYVSEIGWRI 81 +K+ +H Y EQ E DL+ +W +R + ++H + E+ Sbjct: 199 MKELYSFLHHQNRYGSEQ----EFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEV---- 250 Query: 82 PQYNFINKSRLGSGFH--IK-YEELSQASLDSITHRYQNPWQPKPHVLDMQ 129 K +GFH I+ Y E + +D +H Y PW P VL MQ Sbjct: 251 -------KKGKVTGFHNWIRFYLEEKEGLVDYYSHIYDGPWDSYPDVLAMQ 294 >gi|54112403 chromodomain helicase DNA binding protein 7 [Homo sapiens] Length = 2997 Score = 28.1 bits (61), Expect = 4.6 Identities = 10/20 (50%), Positives = 15/20 (75%) Query: 166 PRASKPPKLPKLPKKEKKRK 185 P+ K PK PK+PK+ K++K Sbjct: 665 PKEPKTPKAPKIPKEPKEKK 684 >gi|156105685 ATP-binding cassette, sub-family B, member 8 [Homo sapiens] Length = 718 Score = 27.7 bits (60), Expect = 5.9 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 2/48 (4%) Query: 139 WHMSAFEDTDQRNSKWAILVRQCKSSLPRASKPPKLPKLPKKEKKRKH 186 W E+ ++ +A L+R+ PR + PP PK P+ + +H Sbjct: 671 WEAGTHEELLKKGGLYAELIRRQALDAPRTAAPP--PKKPEGPRSHQH 716 >gi|7657544 sodium channel, voltage gated, type VIII, alpha [Homo sapiens] Length = 1980 Score = 27.7 bits (60), Expect = 5.9 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Query: 39 YVGEQHLALEKTGDLRYLWRPASNRSLPAKYKHEYVSEIGWRIPQYNFINKSRLGSGF 96 + G+ H +T ++R+ +N++ K +EI W+ + NF N +G+G+ Sbjct: 1349 FAGKYHYCFNETSEIRFEIEDVNNKTECEKLMEGNNTEIRWKNVKINFDN---VGAGY 1403 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.316 0.130 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 7,935,387 Number of Sequences: 37866 Number of extensions: 336256 Number of successful extensions: 915 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 906 Number of HSP's gapped (non-prelim): 10 length of query: 186 length of database: 18,247,518 effective HSP length: 96 effective length of query: 90 effective length of database: 14,612,382 effective search space: 1315114380 effective search space used: 1315114380 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 59 (27.3 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.