BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|17402929 sperm associated antigen 11B isoform H preproprotein [Homo sapiens] (82 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|17402929 sperm associated antigen 11B isoform H preproprotein... 169 6e-43 gi|126032340 sperm associated antigen 11A [Homo sapiens] 154 1e-38 gi|126091042 sperm associated antigen 11B isoform G preproprotei... 154 1e-38 gi|126131097 sperm associated antigen 11B isoform D preproprotei... 146 4e-36 gi|7706551 sperm associated antigen 11B isoform A preproprotein ... 144 2e-35 gi|17402931 sperm associated antigen 11B isoform C preproprotein... 144 2e-35 gi|148612882 cat eye syndrome chromosome region, candidate 2 [Ho... 28 1.2 gi|22547197 zinc finger protein of the cerebellum 2 [Homo sapiens] 27 3.5 gi|50845384 ADAM metallopeptidase with thrombospondin type 1 mot... 26 6.0 gi|239753405 PREDICTED: hypothetical protein [Homo sapiens] 26 7.8 gi|239747975 PREDICTED: hypothetical protein XP_002346485 [Homo ... 26 7.8 gi|239741872 PREDICTED: hypothetical protein XP_002342329 [Homo ... 26 7.8 >gi|17402929 sperm associated antigen 11B isoform H preproprotein [Homo sapiens] Length = 82 Score = 169 bits (427), Expect = 6e-43 Identities = 82/82 (100%), Positives = 82/82 (100%) Query: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR Sbjct: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 Query: 61 DLLPPRTPPYQGTGQQHRQRCG 82 DLLPPRTPPYQGTGQQHRQRCG Sbjct: 61 DLLPPRTPPYQGTGQQHRQRCG 82 >gi|126032340 sperm associated antigen 11A [Homo sapiens] Length = 108 Score = 154 bits (390), Expect = 1e-38 Identities = 82/108 (75%), Positives = 82/108 (75%), Gaps = 26/108 (24%) Query: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR Sbjct: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 Query: 61 DLLPPRTPPYQ--------------------------GTGQQHRQRCG 82 DLLPPRTPPYQ GTGQQHRQRCG Sbjct: 61 DLLPPRTPPYQGDVPLGIRNTICRMQQGICRLFFCHSGTGQQHRQRCG 108 >gi|126091042 sperm associated antigen 11B isoform G preproprotein [Homo sapiens] Length = 108 Score = 154 bits (390), Expect = 1e-38 Identities = 82/108 (75%), Positives = 82/108 (75%), Gaps = 26/108 (24%) Query: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR Sbjct: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 Query: 61 DLLPPRTPPYQ--------------------------GTGQQHRQRCG 82 DLLPPRTPPYQ GTGQQHRQRCG Sbjct: 61 DLLPPRTPPYQGDVPPGIRNTICHMQQGICRLFFCHSGTGQQHRQRCG 108 >gi|126131097 sperm associated antigen 11B isoform D preproprotein [Homo sapiens] Length = 133 Score = 146 bits (368), Expect = 4e-36 Identities = 72/72 (100%), Positives = 72/72 (100%) Query: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR Sbjct: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 Query: 61 DLLPPRTPPYQG 72 DLLPPRTPPYQG Sbjct: 61 DLLPPRTPPYQG 72 >gi|7706551 sperm associated antigen 11B isoform A preproprotein [Homo sapiens] Length = 103 Score = 144 bits (362), Expect = 2e-35 Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR Sbjct: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 Query: 61 DLLPPRTPPYQ 71 DLLPPRTPPYQ Sbjct: 61 DLLPPRTPPYQ 71 >gi|17402931 sperm associated antigen 11B isoform C preproprotein [Homo sapiens] Length = 113 Score = 144 bits (362), Expect = 2e-35 Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR Sbjct: 1 MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKR 60 Query: 61 DLLPPRTPPYQ 71 DLLPPRTPPYQ Sbjct: 61 DLLPPRTPPYQ 71 >gi|148612882 cat eye syndrome chromosome region, candidate 2 [Homo sapiens] Length = 1484 Score = 28.5 bits (62), Expect = 1.2 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Query: 20 PGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQ 71 P +S+A+ + E L L E+ PG GT+ V LP TPP Q Sbjct: 961 PENSEAQEPENDQAEPLPGLEEKPPGVGTS------EGVYLTQLPHPTPPLQ 1006 >gi|22547197 zinc finger protein of the cerebellum 2 [Homo sapiens] Length = 532 Score = 26.9 bits (58), Expect = 3.5 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Query: 17 LLFPGSSQARHVNHSATEAL-GELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGTGQ 75 LLFPG + +H H + L G++R PG+ R R + PRT PY Q Sbjct: 157 LLFPGLPE-QHGPHGSQNVLNGQMRLGLPGEVFG-----RSEQYRQVASPRTDPY-SAAQ 209 Query: 76 QHRQ 79 H Q Sbjct: 210 LHNQ 213 >gi|50845384 ADAM metallopeptidase with thrombospondin type 1 motif, 1 preproprotein [Homo sapiens] Length = 967 Score = 26.2 bits (56), Expect = 6.0 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 2/56 (3%) Query: 7 PSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDL 62 P T LLL A L S + E + ERAPG GT +L HA + L Sbjct: 32 PVPTLLLLAAALLAVSDALGRPSEEDEELVVPELERAPGHGTTRLRL--HAFDQQL 85 >gi|239753405 PREDICTED: hypothetical protein [Homo sapiens] Length = 219 Score = 25.8 bits (55), Expect = 7.8 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Query: 31 SATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGTGQQHRQRCG 82 S E+ G R R PG + R A++ PPR P GT R G Sbjct: 115 SPMESEGPHRRRKPGAESP-----RRAIEAGARPPRQRPGAGTAAARASRAG 161 >gi|239747975 PREDICTED: hypothetical protein XP_002346485 [Homo sapiens] Length = 219 Score = 25.8 bits (55), Expect = 7.8 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Query: 31 SATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGTGQQHRQRCG 82 S E+ G R R PG + R A++ PPR P GT R G Sbjct: 115 SPMESEGPHRRRKPGAESP-----RRAIEAGARPPRQRPGAGTAAARASRAG 161 >gi|239741872 PREDICTED: hypothetical protein XP_002342329 [Homo sapiens] Length = 219 Score = 25.8 bits (55), Expect = 7.8 Identities = 17/52 (32%), Positives = 21/52 (40%), Gaps = 5/52 (9%) Query: 31 SATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPYQGTGQQHRQRCG 82 S E+ G R R PG + R A++ PPR P GT R G Sbjct: 115 SPMESEGPHRRRKPGAESP-----RRAIEAGARPPRQRPGAGTAAARASRAG 161 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.320 0.136 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,897,632 Number of Sequences: 37866 Number of extensions: 164582 Number of successful extensions: 392 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 384 Number of HSP's gapped (non-prelim): 12 length of query: 82 length of database: 18,247,518 effective HSP length: 54 effective length of query: 28 effective length of database: 16,202,754 effective search space: 453677112 effective search space used: 453677112 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.