BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|157419142 tumor necrosis factor (ligand) superfamily, member 18 [Homo sapiens] (199 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|157419142 tumor necrosis factor (ligand) superfamily, member ... 415 e-116 gi|160948610 E3 ubiquitin-protein ligase UBR3 [Homo sapiens] 32 0.47 gi|14589896 megalencephalic leukoencephalopathy with subcortical... 30 1.8 gi|21237732 megalencephalic leukoencephalopathy with subcortical... 30 1.8 gi|74271845 alpha-2-macroglobulin-like 1 [Homo sapiens] 28 3.9 gi|54112101 ectodysplasin A isoform EDA-A2 [Homo sapiens] 28 6.7 gi|4503449 ectodysplasin A isoform EDA-A1 [Homo sapiens] 27 8.8 gi|188528663 solute carrier organic anion transporter family, me... 27 8.8 >gi|157419142 tumor necrosis factor (ligand) superfamily, member 18 [Homo sapiens] Length = 199 Score = 415 bits (1067), Expect = e-116 Identities = 199/199 (100%), Positives = 199/199 (100%) Query: 1 MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFL 60 MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFL Sbjct: 1 MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFL 60 Query: 61 CSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY 120 CSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY Sbjct: 61 CSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY 120 Query: 121 GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQV 180 GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQV Sbjct: 121 GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQV 180 Query: 181 LKNNTYWGIILLANPQFIS 199 LKNNTYWGIILLANPQFIS Sbjct: 181 LKNNTYWGIILLANPQFIS 199 >gi|160948610 E3 ubiquitin-protein ligase UBR3 [Homo sapiens] Length = 1888 Score = 31.6 bits (70), Expect = 0.47 Identities = 15/74 (20%), Positives = 38/74 (51%), Gaps = 13/74 (17%) Query: 130 NDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDT-------------IDLIFNS 176 N + V+L+ N+++ + +T + ++ ++ T L++ ++ + ++ N Sbjct: 441 NRIVHISVQLFSNEELARQVTEECQLLDIMVTVLLYMMESCLIKSELQDEENSLHVVVNC 500 Query: 177 EHQVLKNNTYWGII 190 +LKNNTYW ++ Sbjct: 501 GEALLKNNTYWPLV 514 >gi|14589896 megalencephalic leukoencephalopathy with subcortical cysts 1 gene product [Homo sapiens] Length = 377 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Query: 121 GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTI 170 G ++ +AN D PF R+ K+ +++ + S + +GG L+V D++ Sbjct: 176 GSMSDSANILDEVPFPARVLKSYSVVEVIAGISAV--LGGIIALNVDDSV 223 >gi|21237732 megalencephalic leukoencephalopathy with subcortical cysts 1 gene product [Homo sapiens] Length = 377 Score = 29.6 bits (65), Expect = 1.8 Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Query: 121 GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTI 170 G ++ +AN D PF R+ K+ +++ + S + +GG L+V D++ Sbjct: 176 GSMSDSANILDEVPFPARVLKSYSVVEVIAGISAV--LGGIIALNVDDSV 223 >gi|74271845 alpha-2-macroglobulin-like 1 [Homo sapiens] Length = 1454 Score = 28.5 bits (62), Expect = 3.9 Identities = 12/46 (26%), Positives = 24/46 (52%) Query: 82 AKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNA 127 + F P+ K+ M + P N+++ W + + G+ + Q+AP A Sbjct: 146 SNFVPVNDKYSMVELQDPNSNRIAQWLEVVPEQGIVDLSFQLAPEA 191 >gi|54112101 ectodysplasin A isoform EDA-A2 [Homo sapiens] Length = 389 Score = 27.7 bits (60), Expect = 6.7 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 108 KLEILQNGLYLIYGQVAPNANYNDVAPFEV 137 +LE+L +G Y IY QV N+ D A +EV Sbjct: 292 ELEVLVDGTYFIYSQVY-YINFTDFASYEV 320 >gi|4503449 ectodysplasin A isoform EDA-A1 [Homo sapiens] Length = 391 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 108 KLEILQNGLYLIYGQV-APNANYNDVAPFEV 137 +LE+L +G Y IY QV N+ D A +EV Sbjct: 292 ELEVLVDGTYFIYSQVEVYYINFTDFASYEV 322 >gi|188528663 solute carrier organic anion transporter family, member 2A1 [Homo sapiens] Length = 643 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query: 19 ISPKMCLSHLENMPLS--HSRTQGAQRSSWKLWLFCSIVMLL 58 + ++C H +++P S HS TQ Q+ + +W + LL Sbjct: 138 LQAELCQKHWQDLPPSKCHSTTQNPQKETSSMWGLMVVAQLL 179 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.323 0.136 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 8,056,696 Number of Sequences: 37866 Number of extensions: 331368 Number of successful extensions: 776 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 774 Number of HSP's gapped (non-prelim): 8 length of query: 199 length of database: 18,247,518 effective HSP length: 97 effective length of query: 102 effective length of database: 14,574,516 effective search space: 1486600632 effective search space used: 1486600632 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 59 (27.3 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.