BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|47080103 solute carrier family 39 (zinc transporter), member 3 isoform b [Homo sapiens] (105 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|47080103 solute carrier family 39 (zinc transporter), member ... 209 5e-55 gi|32490561 solute carrier family 39 (zinc transporter), member ... 141 1e-34 gi|21361423 solute carrier family 39 (zinc transporter), member ... 41 2e-04 gi|221219050 transducin-like enhancer protein 2 isoform 3 [Homo ... 28 1.5 gi|221219048 transducin-like enhancer protein 2 isoform 2 [Homo ... 28 1.5 gi|21361151 transducin-like enhancer protein 2 isoform 1 [Homo s... 28 1.5 gi|13994255 alanine-glyoxylate aminotransferase 2 precursor [Hom... 27 4.5 gi|21553315 phosphatidylinositol glycan anchor biosynthesis, cla... 26 7.7 gi|30410020 progestin and adipoQ receptor family member VII [Hom... 26 7.7 gi|21361959 solute carrier family 35, member F5 [Homo sapiens] 26 7.7 >gi|47080103 solute carrier family 39 (zinc transporter), member 3 isoform b [Homo sapiens] Length = 105 Score = 209 bits (531), Expect = 5e-55 Identities = 105/105 (100%), Positives = 105/105 (100%) Query: 1 MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF 60 MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF Sbjct: 1 MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF 60 Query: 61 NALLPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML 105 NALLPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML Sbjct: 61 NALLPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML 105 >gi|32490561 solute carrier family 39 (zinc transporter), member 3 isoform a [Homo sapiens] Length = 314 Score = 141 bits (355), Expect = 1e-34 Identities = 70/72 (97%), Positives = 72/72 (100%) Query: 1 MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF 60 MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF Sbjct: 1 MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF 60 Query: 61 NALLPAVREKVR 72 NALLPAVREK++ Sbjct: 61 NALLPAVREKLQ 72 >gi|21361423 solute carrier family 39 (zinc transporter), member 1 [Homo sapiens] Length = 324 Score = 40.8 bits (94), Expect = 2e-04 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Query: 5 LVAKILCMVGVFFFMLLGSLLPVKIIE---TDFEKAHRSKKILSLCNTFGGGVFLATCFN 61 L K+ +V + LL SL+P+ ++ + E + +K LSL + F GGVFLATC Sbjct: 27 LEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALSLVSCFAGGVFLATCLL 86 Query: 62 ALLP 65 LLP Sbjct: 87 DLLP 90 >gi|221219050 transducin-like enhancer protein 2 isoform 3 [Homo sapiens] Length = 621 Score = 28.1 bits (61), Expect = 1.5 Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 64 LPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKA 102 +PA R+ V +P +LA++LG+ PR + +P+S A Sbjct: 140 IPARRDLVDSPASLASSLGSPLPRAKELILNDLPASTPA 178 >gi|221219048 transducin-like enhancer protein 2 isoform 2 [Homo sapiens] Length = 706 Score = 28.1 bits (61), Expect = 1.5 Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 64 LPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKA 102 +PA R+ V +P +LA++LG+ PR + +P+S A Sbjct: 276 IPARRDLVDSPASLASSLGSPLPRAKELILNDLPASTPA 314 >gi|21361151 transducin-like enhancer protein 2 isoform 1 [Homo sapiens] Length = 743 Score = 28.1 bits (61), Expect = 1.5 Identities = 14/39 (35%), Positives = 24/39 (61%) Query: 64 LPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKA 102 +PA R+ V +P +LA++LG+ PR + +P+S A Sbjct: 262 IPARRDLVDSPASLASSLGSPLPRAKELILNDLPASTPA 300 >gi|13994255 alanine-glyoxylate aminotransferase 2 precursor [Homo sapiens] Length = 514 Score = 26.6 bits (57), Expect = 4.5 Identities = 15/50 (30%), Positives = 24/50 (48%) Query: 21 LGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREK 70 +G+ P+ + T E A K L NTFGG +A+L ++E+ Sbjct: 352 IGNGFPMAAVITTPEIAKSLAKCLQHFNTFGGNPMACAIGSAVLEVIKEE 401 >gi|21553315 phosphatidylinositol glycan anchor biosynthesis, class M [Homo sapiens] Length = 423 Score = 25.8 bits (55), Expect = 7.7 Identities = 12/23 (52%), Positives = 12/23 (52%) Query: 63 LLPAVREKVRAPWALAAALGTLW 85 LLP V VR PW A L LW Sbjct: 342 LLPLVMPLVRMPWKRAVVLLMLW 364 >gi|30410020 progestin and adipoQ receptor family member VII [Homo sapiens] Length = 346 Score = 25.8 bits (55), Expect = 7.7 Identities = 21/65 (32%), Positives = 27/65 (41%), Gaps = 6/65 (9%) Query: 47 CNTFGGG-----VFLATCFNALLPAVREKVRAPWALAAALGTLWPRD-SDAFSTLMPSSV 100 C+ FG G +FL C A L AV A + L T WP + S F + SS+ Sbjct: 268 CHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSI 327 Query: 101 KALML 105 L Sbjct: 328 LTAFL 332 >gi|21361959 solute carrier family 35, member F5 [Homo sapiens] Length = 523 Score = 25.8 bits (55), Expect = 7.7 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 6/79 (7%) Query: 3 KLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNA 62 ++ + IL F ++L ++ P + F + ILS+ GGV L + Sbjct: 266 QVAIVNILSSTSGLFTLILAAVFPSNSGDR-FTLSKLLAVILSI-----GGVVLVNLAGS 319 Query: 63 LLPAVREKVRAPWALAAAL 81 PA R+ V + W+LA A+ Sbjct: 320 EKPAGRDTVGSIWSLAGAM 338 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.330 0.140 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,392,571 Number of Sequences: 37866 Number of extensions: 121995 Number of successful extensions: 338 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 330 Number of HSP's gapped (non-prelim): 10 length of query: 105 length of database: 18,247,518 effective HSP length: 76 effective length of query: 29 effective length of database: 15,369,702 effective search space: 445721358 effective search space used: 445721358 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.