BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239749140 PREDICTED: hypothetical protein [Homo sapiens] (95 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|169171756 PREDICTED: hypothetical protein [Homo sapiens] 197 2e-51 gi|239749140 PREDICTED: hypothetical protein [Homo sapiens] 197 2e-51 gi|169170101 PREDICTED: hypothetical protein [Homo sapiens] 197 2e-51 gi|239508844 PREDICTED: hypothetical protein [Homo sapiens] 197 2e-51 gi|195546889 RAB, member RAS oncogene family-like 5 isoform b [H... 31 0.24 gi|12232463 RAB, member RAS oncogene family-like 5 isoform a [Ho... 31 0.24 gi|134133244 killer cell immunoglobulin-like receptor, three dom... 27 2.7 gi|71743840 class IV alcohol dehydrogenase, mu or sigma subunit ... 27 4.6 gi|169211815 PREDICTED: keratin associated protein 4.6 [Homo sap... 27 4.6 >gi|169171756 PREDICTED: hypothetical protein [Homo sapiens] Length = 95 Score = 197 bits (501), Expect = 2e-51 Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR Sbjct: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 Query: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL Sbjct: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 >gi|239749140 PREDICTED: hypothetical protein [Homo sapiens] Length = 95 Score = 197 bits (501), Expect = 2e-51 Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR Sbjct: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 Query: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL Sbjct: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 >gi|169170101 PREDICTED: hypothetical protein [Homo sapiens] Length = 95 Score = 197 bits (501), Expect = 2e-51 Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR Sbjct: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 Query: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL Sbjct: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 >gi|239508844 PREDICTED: hypothetical protein [Homo sapiens] Length = 95 Score = 197 bits (501), Expect = 2e-51 Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR Sbjct: 1 METKAAKEGSALTRRLRWAPAAAPRRTKMLKAKILFVGLCESGSHCSPLQTAHSWLHLVR 60 Query: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL Sbjct: 61 GKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 >gi|195546889 RAB, member RAS oncogene family-like 5 isoform b [Homo sapiens] Length = 155 Score = 30.8 bits (68), Expect = 0.24 Identities = 14/15 (93%), Positives = 14/15 (93%) Query: 29 MLKAKILFVGLCESG 43 MLKAKILFVG CESG Sbjct: 1 MLKAKILFVGPCESG 15 >gi|12232463 RAB, member RAS oncogene family-like 5 isoform a [Homo sapiens] Length = 185 Score = 30.8 bits (68), Expect = 0.24 Identities = 14/15 (93%), Positives = 14/15 (93%) Query: 29 MLKAKILFVGLCESG 43 MLKAKILFVG CESG Sbjct: 1 MLKAKILFVGPCESG 15 >gi|134133244 killer cell immunoglobulin-like receptor, three domains, short cytoplasmic tail, 1 [Homo sapiens] Length = 382 Score = 27.3 bits (59), Expect = 2.7 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Query: 41 ESGSHCSPLQTAHSWLHLVRGKHPEMEMCVSVLSPSLQRRASGGPSRVHPNPNLL 95 + G + SP+ TAH+ + RG HP S S + +G H P+LL Sbjct: 77 QEGFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPMVIMVTGN----HRKPSLL 127 >gi|71743840 class IV alcohol dehydrogenase, mu or sigma subunit [Homo sapiens] Length = 386 Score = 26.6 bits (57), Expect = 4.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Query: 23 APRRTKMLKAKILFVGLCESGSH 45 AP +TK ++ KIL G+C + H Sbjct: 42 APPKTKEVRIKILATGICRTDDH 64 >gi|169211815 PREDICTED: keratin associated protein 4.6 [Homo sapiens] Length = 288 Score = 26.6 bits (57), Expect = 4.6 Identities = 11/15 (73%), Positives = 12/15 (80%) Query: 10 SALTRRLRWAPAAAP 24 SALTR + W PAAAP Sbjct: 88 SALTRAVAWRPAAAP 102 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.319 0.130 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 4,237,130 Number of Sequences: 37866 Number of extensions: 180390 Number of successful extensions: 490 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 481 Number of HSP's gapped (non-prelim): 9 length of query: 95 length of database: 18,247,518 effective HSP length: 66 effective length of query: 29 effective length of database: 15,748,362 effective search space: 456702498 effective search space used: 456702498 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.