BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|45827704 melanocortin 2 receptor accessory protein isoform beta [Homo sapiens] (102 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|45827704 melanocortin 2 receptor accessory protein isoform be... 206 2e-54 gi|30520312 melanocortin 2 receptor accessory protein isoform al... 140 2e-34 gi|156523251 melanocortin 2 receptor accessory protein 2 [Homo s... 57 4e-09 gi|73760401 thymopoietin isoform gamma [Homo sapiens] 27 3.5 gi|73760405 thymopoietin isoform beta [Homo sapiens] 27 3.5 gi|4503365 dolichyl-phosphate mannosyltransferase 2 [Homo sapiens] 27 4.5 gi|38202224 discs large-associated protein 2 [Homo sapiens] 27 4.5 gi|89242141 colon cancer-associated protein Mic1 [Homo sapiens] 27 4.5 gi|83367077 mucin 16 [Homo sapiens] 26 7.7 >gi|45827704 melanocortin 2 receptor accessory protein isoform beta [Homo sapiens] Length = 102 Score = 206 bits (525), Expect = 2e-54 Identities = 102/102 (100%), Positives = 102/102 (100%) Query: 1 MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM 60 MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM Sbjct: 1 MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM 60 Query: 61 SWSASPQMSFNTDESLLHSEVLPQTRAISCDELQAPREEGAA 102 SWSASPQMSFNTDESLLHSEVLPQTRAISCDELQAPREEGAA Sbjct: 61 SWSASPQMSFNTDESLLHSEVLPQTRAISCDELQAPREEGAA 102 >gi|30520312 melanocortin 2 receptor accessory protein isoform alpha [Homo sapiens] Length = 172 Score = 140 bits (353), Expect = 2e-34 Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM 60 MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM Sbjct: 1 MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM 60 Query: 61 SWSASPQM 68 SWSASPQM Sbjct: 61 SWSASPQM 68 >gi|156523251 melanocortin 2 receptor accessory protein 2 [Homo sapiens] Length = 205 Score = 56.6 bits (135), Expect = 4e-09 Identities = 27/61 (44%), Positives = 42/61 (68%), Gaps = 2/61 (3%) Query: 6 NASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYMSWSAS 65 +AS Y++EY +Y ++ PV + LKAHK+SIVI FWV LA FV+ +F +L ++ + + Sbjct: 15 SASNSDYTWEY--EYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFMFFVLTLLTKTGA 72 Query: 66 P 66 P Sbjct: 73 P 73 >gi|73760401 thymopoietin isoform gamma [Homo sapiens] Length = 345 Score = 26.9 bits (58), Expect = 3.5 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Query: 12 YSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVL-LFLILLYMSWSASPQMSF 70 +S +Y Y+ L V +K K + I W+ + FVV+ +FL L+Y + + F Sbjct: 277 FSSKYVPKYVPLADVKSEKTKKGRS---IPVWIKILLFVVVAVFLFLVYQAMETNQVNPF 333 Query: 71 N 71 + Sbjct: 334 S 334 >gi|73760405 thymopoietin isoform beta [Homo sapiens] Length = 454 Score = 26.9 bits (58), Expect = 3.5 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Query: 12 YSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVL-LFLILLYMSWSASPQMSF 70 +S +Y Y+ L V +K K + I W+ + FVV+ +FL L+Y + + F Sbjct: 386 FSSKYVPKYVPLADVKSEKTKKGRS---IPVWIKILLFVVVAVFLFLVYQAMETNQVNPF 442 Query: 71 N 71 + Sbjct: 443 S 443 >gi|4503365 dolichyl-phosphate mannosyltransferase 2 [Homo sapiens] Length = 84 Score = 26.6 bits (57), Expect = 4.5 Identities = 15/51 (29%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Query: 14 YEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVS--LAAFVVLLFLILLYMSW 62 + YY ++ L+P + + HK+ + A+ V+ LAA ++LL + L++S+ Sbjct: 21 FTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISY 71 >gi|38202224 discs large-associated protein 2 [Homo sapiens] Length = 975 Score = 26.6 bits (57), Expect = 4.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Query: 69 SFNTDESLLHSEVLPQTRAISCDELQAPREE 99 S N D+ LLH + P R C LQ P++E Sbjct: 307 SLNLDKPLLHQDAKPALR--PCHYLQVPQDE 335 >gi|89242141 colon cancer-associated protein Mic1 [Homo sapiens] Length = 657 Score = 26.6 bits (57), Expect = 4.5 Identities = 10/32 (31%), Positives = 21/32 (65%) Query: 57 LLYMSWSASPQMSFNTDESLLHSEVLPQTRAI 88 +L W++S ++ F TD+ + +VLP+ R++ Sbjct: 113 ILGFCWTSSTEIVFITDQGIEFYQVLPEKRSL 144 >gi|83367077 mucin 16 [Homo sapiens] Length = 14507 Score = 25.8 bits (55), Expect = 7.7 Identities = 13/38 (34%), Positives = 20/38 (52%) Query: 63 SASPQMSFNTDESLLHSEVLPQTRAISCDELQAPREEG 100 ++ P M+ +DESL S+ +T AI E A + G Sbjct: 8907 TSPPSMNITSDESLATSKATMETEAIQLSENTAVTQMG 8944 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.320 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,940,914 Number of Sequences: 37866 Number of extensions: 136581 Number of successful extensions: 391 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 384 Number of HSP's gapped (non-prelim): 11 length of query: 102 length of database: 18,247,518 effective HSP length: 73 effective length of query: 29 effective length of database: 15,483,300 effective search space: 449015700 effective search space used: 449015700 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.