BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239753482 PREDICTED: similar to HSPC300 [Homo sapiens] (85 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239753482 PREDICTED: similar to HSPC300 [Homo sapiens] 172 5e-44 gi|27544939 chromosome 3 open reading frame 10 [Homo sapiens] 137 2e-33 gi|171906559 peripheral benzodiazepine receptor-associated prote... 30 0.41 gi|51479152 ATP synthase, H+ transporting, mitochondrial F0 comp... 28 1.2 gi|5453559 ATP synthase, H+ transporting, mitochondrial F0 compl... 28 1.2 gi|13775238 plasmalemma vesicle associated protein [Homo sapiens] 28 2.0 gi|10835133 Fc fragment of IgG, high affinity Ia, receptor (CD64... 27 4.5 gi|63055063 Fc fragment of IgG, high affinity Ib, receptor (CD64... 27 4.5 gi|14249704 RAS-like, estrogen-regulated, growth inhibitor [Homo... 26 5.9 >gi|239753482 PREDICTED: similar to HSPC300 [Homo sapiens] Length = 85 Score = 172 bits (436), Expect = 5e-44 Identities = 85/85 (100%), Positives = 85/85 (100%) Query: 1 MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR 60 MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR Sbjct: 1 MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR 60 Query: 61 IEYIEARVSLMGKGIPERMHISTYC 85 IEYIEARVSLMGKGIPERMHISTYC Sbjct: 61 IEYIEARVSLMGKGIPERMHISTYC 85 >gi|27544939 chromosome 3 open reading frame 10 [Homo sapiens] Length = 75 Score = 137 bits (344), Expect = 2e-33 Identities = 68/69 (98%), Positives = 69/69 (100%) Query: 1 MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR 60 MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR Sbjct: 1 MAGQEDPVQREIHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR 60 Query: 61 IEYIEARVS 69 IEYIEARV+ Sbjct: 61 IEYIEARVT 69 >gi|171906559 peripheral benzodiazepine receptor-associated protein 1 isoform a [Homo sapiens] Length = 1857 Score = 30.0 bits (66), Expect = 0.41 Identities = 12/40 (30%), Positives = 26/40 (65%) Query: 45 SRLATLNEKLTALERRIEYIEARVSLMGKGIPERMHISTY 84 S L ++++ AL+R ++AR++L+GK P+ +H+ + Sbjct: 222 SALLAKDKQIAALQRECRELQARLTLVGKEGPQWLHVRDF 261 >gi|51479152 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d isoform b [Homo sapiens] Length = 137 Score = 28.5 bits (62), Expect = 1.2 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 15 DWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVSLMG 72 DW + EII + K IA L S++ + SRLA L E A++ Y +A V+ G Sbjct: 12 DWV--AFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAID--WAYYKANVAKAG 65 >gi|5453559 ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d isoform a [Homo sapiens] Length = 161 Score = 28.5 bits (62), Expect = 1.2 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 15 DWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVSLMG 72 DW + EII + K IA L S++ + SRLA L E A++ Y +A V+ G Sbjct: 12 DWV--AFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAID--WAYYKANVAKAG 65 >gi|13775238 plasmalemma vesicle associated protein [Homo sapiens] Length = 442 Score = 27.7 bits (60), Expect = 2.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Query: 18 NREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRI 61 N+ Y+ I S K+ D + SC + L LN+K+ LE I Sbjct: 129 NQRYMAAIILSEKQCRDQFKDMNKSCDALLFMLNQKVKTLEVEI 172 >gi|10835133 Fc fragment of IgG, high affinity Ia, receptor (CD64) [Homo sapiens] Length = 374 Score = 26.6 bits (57), Expect = 4.5 Identities = 8/16 (50%), Positives = 13/16 (81%) Query: 1 MAGQEDPVQREIHQDW 16 ++G+ DP+Q EIH+ W Sbjct: 89 LSGRSDPIQLEIHRGW 104 >gi|63055063 Fc fragment of IgG, high affinity Ib, receptor (CD64) isoform a [Homo sapiens] Length = 280 Score = 26.6 bits (57), Expect = 4.5 Identities = 8/16 (50%), Positives = 13/16 (81%) Query: 1 MAGQEDPVQREIHQDW 16 ++G+ DP+Q EIH+ W Sbjct: 89 LSGRSDPIQLEIHRGW 104 >gi|14249704 RAS-like, estrogen-regulated, growth inhibitor [Homo sapiens] Length = 199 Score = 26.2 bits (56), Expect = 5.9 Identities = 10/15 (66%), Positives = 11/15 (73%) Query: 2 AGQEDPVQREIHQDW 16 AGQED +QRE H W Sbjct: 62 AGQEDTIQREGHMRW 76 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.321 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,781,621 Number of Sequences: 37866 Number of extensions: 80527 Number of successful extensions: 362 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 353 Number of HSP's gapped (non-prelim): 9 length of query: 85 length of database: 18,247,518 effective HSP length: 57 effective length of query: 28 effective length of database: 16,089,156 effective search space: 450496368 effective search space used: 450496368 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.