BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|115527094 hypothetical protein LOC171546 [Homo sapiens] (71 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|115527094 hypothetical protein LOC171546 [Homo sapiens] 149 4e-37 gi|239747432 PREDICTED: hypothetical LOC100131965 [Homo sapiens] 106 4e-24 gi|93141042 ADMP [Homo sapiens] 71 2e-13 gi|94721239 isoleucine tRNA synthetase [Homo sapiens] 27 2.6 gi|94721241 isoleucine tRNA synthetase [Homo sapiens] 27 2.6 gi|112293285 spindlin [Homo sapiens] 27 3.5 gi|108796661 spindlin family, member 4 [Homo sapiens] 26 5.9 >gi|115527094 hypothetical protein LOC171546 [Homo sapiens] Length = 71 Score = 149 bits (377), Expect = 4e-37 Identities = 71/71 (100%), Positives = 71/71 (100%) Query: 1 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI 60 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI Sbjct: 1 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI 60 Query: 61 MAILHYFEIVQ 71 MAILHYFEIVQ Sbjct: 61 MAILHYFEIVQ 71 >gi|239747432 PREDICTED: hypothetical LOC100131965 [Homo sapiens] Length = 189 Score = 106 bits (264), Expect = 4e-24 Identities = 53/71 (74%), Positives = 56/71 (78%), Gaps = 4/71 (5%) Query: 1 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI 60 +AGM L RAWK MSWFYYQ+LLVT LYMLEP ER V NS LVSI Y GY+FM QHI Sbjct: 123 LAGMELVRAWKXMSWFYYQHLLVTMLYMLEPEERKVLNSTLVSI----XYAGYIFMTQHI 178 Query: 61 MAILHYFEIVQ 71 MAILHYFEIVQ Sbjct: 179 MAILHYFEIVQ 189 >gi|93141042 ADMP [Homo sapiens] Length = 76 Score = 71.2 bits (173), Expect = 2e-13 Identities = 29/64 (45%), Positives = 44/64 (68%) Query: 4 MALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAI 63 M L R + SW YYQY +++ +LEPWER++FN++L++I+ M +YT YVF+P HI Sbjct: 1 MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHIRLA 60 Query: 64 LHYF 67 +F Sbjct: 61 WEFF 64 >gi|94721239 isoleucine tRNA synthetase [Homo sapiens] Length = 1262 Score = 27.3 bits (59), Expect = 2.6 Identities = 13/52 (25%), Positives = 24/52 (46%) Query: 15 WFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHY 66 WFY +L TAL+ P++ + N ++++ G + P + I Y Sbjct: 567 WFYTLLVLATALFGQPPFKNVIVNGLVLASDGQKMSKRKKNYPDPVSIIQKY 618 >gi|94721241 isoleucine tRNA synthetase [Homo sapiens] Length = 1262 Score = 27.3 bits (59), Expect = 2.6 Identities = 13/52 (25%), Positives = 24/52 (46%) Query: 15 WFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHIMAILHY 66 WFY +L TAL+ P++ + N ++++ G + P + I Y Sbjct: 567 WFYTLLVLATALFGQPPFKNVIVNGLVLASDGQKMSKRKKNYPDPVSIIQKY 618 >gi|112293285 spindlin [Homo sapiens] Length = 262 Score = 26.9 bits (58), Expect = 3.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 3 GMALARAWKQMSWFYYQYLLVTALYMLE 30 GM LARA +WFY Y LYM + Sbjct: 153 GMVLARAPVMNTWFYITYEKDPVLYMYQ 180 >gi|108796661 spindlin family, member 4 [Homo sapiens] Length = 249 Score = 26.2 bits (56), Expect = 5.9 Identities = 13/26 (50%), Positives = 14/26 (53%) Query: 3 GMALARAWKQMSWFYYQYLLVTALYM 28 GM LARA +WFY Y LYM Sbjct: 139 GMVLARAPVMDTWFYITYEKDPVLYM 164 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.333 0.139 0.456 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,161,568 Number of Sequences: 37866 Number of extensions: 57677 Number of successful extensions: 229 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 221 Number of HSP's gapped (non-prelim): 7 length of query: 71 length of database: 18,247,518 effective HSP length: 44 effective length of query: 27 effective length of database: 16,581,414 effective search space: 447698178 effective search space used: 447698178 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.