BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239741861 PREDICTED: hypothetical protein XP_002342342 [Homo sapiens] (47 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239753395 PREDICTED: similar to PL-5283 protein [Homo sapiens] 97 3e-21 gi|239747966 PREDICTED: hypothetical protein XP_002346486 [Homo ... 97 3e-21 gi|239741861 PREDICTED: hypothetical protein XP_002342342 [Homo ... 97 3e-21 gi|195963435 PL-5283 protein [Homo sapiens] 94 2e-20 gi|239754565 PREDICTED: similar to PL-5283 protein [Homo sapiens] 90 3e-19 gi|239749163 PREDICTED: hypothetical protein XP_002346927 [Homo ... 90 3e-19 gi|239743160 PREDICTED: hypothetical protein XP_002342763 [Homo ... 90 3e-19 gi|239508820 PREDICTED: similar to PL-5283 protein [Homo sapiens] 90 3e-19 gi|239754094 PREDICTED: similar to PL-5283 protein [Homo sapiens] 63 6e-11 gi|239748655 PREDICTED: hypothetical protein XP_002346769 [Homo ... 63 6e-11 gi|239742680 PREDICTED: hypothetical protein XP_002342594 [Homo ... 63 6e-11 gi|239754795 PREDICTED: similar to PL-5283 protein [Homo sapiens] 49 9e-07 >gi|239753395 PREDICTED: similar to PL-5283 protein [Homo sapiens] Length = 47 Score = 97.1 bits (240), Expect = 3e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS Sbjct: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 >gi|239747966 PREDICTED: hypothetical protein XP_002346486 [Homo sapiens] Length = 47 Score = 97.1 bits (240), Expect = 3e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS Sbjct: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 >gi|239741861 PREDICTED: hypothetical protein XP_002342342 [Homo sapiens] Length = 47 Score = 97.1 bits (240), Expect = 3e-21 Identities = 47/47 (100%), Positives = 47/47 (100%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS Sbjct: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 >gi|195963435 PL-5283 protein [Homo sapiens] Length = 47 Score = 94.4 bits (233), Expect = 2e-20 Identities = 45/47 (95%), Positives = 47/47 (100%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPP++ Sbjct: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPSA 47 >gi|239754565 PREDICTED: similar to PL-5283 protein [Homo sapiens] Length = 47 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVG+YLAQNYDIPNLAKKLEEIKKDLDAKKK P+S Sbjct: 1 MLQFLLGFTLGNVVGIYLAQNYDIPNLAKKLEEIKKDLDAKKKLPSS 47 >gi|239749163 PREDICTED: hypothetical protein XP_002346927 [Homo sapiens] Length = 47 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVG+YLAQNYDIPNLAKKLEEIKKDLDAKKK P+S Sbjct: 1 MLQFLLGFTLGNVVGIYLAQNYDIPNLAKKLEEIKKDLDAKKKLPSS 47 >gi|239743160 PREDICTED: hypothetical protein XP_002342763 [Homo sapiens] Length = 47 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVG+YLAQNYDIPNLAKKLEEIKKDLDAKKK P+S Sbjct: 1 MLQFLLGFTLGNVVGIYLAQNYDIPNLAKKLEEIKKDLDAKKKLPSS 47 >gi|239508820 PREDICTED: similar to PL-5283 protein [Homo sapiens] Length = 47 Score = 90.1 bits (222), Expect = 3e-19 Identities = 44/47 (93%), Positives = 46/47 (97%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQFLLGFTLGNVVG+YLAQNYDIPNLAKKLEEIKKDLDAKKK P+S Sbjct: 1 MLQFLLGFTLGNVVGIYLAQNYDIPNLAKKLEEIKKDLDAKKKLPSS 47 >gi|239754094 PREDICTED: similar to PL-5283 protein [Homo sapiens] Length = 43 Score = 62.8 bits (151), Expect = 6e-11 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 4/47 (8%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQ LLGFTL N+VGMYLAQNYD PNLAKK K + +KKPP+S Sbjct: 1 MLQLLLGFTLANMVGMYLAQNYDAPNLAKK----KDLMPGRKKPPSS 43 >gi|239748655 PREDICTED: hypothetical protein XP_002346769 [Homo sapiens] Length = 43 Score = 62.8 bits (151), Expect = 6e-11 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 4/47 (8%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQ LLGFTL N+VGMYLAQNYD PNLAKK K + +KKPP+S Sbjct: 1 MLQLLLGFTLANMVGMYLAQNYDAPNLAKK----KDLMPGRKKPPSS 43 >gi|239742680 PREDICTED: hypothetical protein XP_002342594 [Homo sapiens] Length = 43 Score = 62.8 bits (151), Expect = 6e-11 Identities = 32/47 (68%), Positives = 36/47 (76%), Gaps = 4/47 (8%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQ LLGFTL N+VGMYLAQNYD PNLAKK K + +KKPP+S Sbjct: 1 MLQLLLGFTLANMVGMYLAQNYDAPNLAKK----KDLMPGRKKPPSS 43 >gi|239754795 PREDICTED: similar to PL-5283 protein [Homo sapiens] Length = 63 Score = 48.9 bits (115), Expect = 9e-07 Identities = 26/47 (55%), Positives = 33/47 (70%) Query: 1 MLQFLLGFTLGNVVGMYLAQNYDIPNLAKKLEEIKKDLDAKKKPPTS 47 MLQ LL F GN V ++L QN I NL+K+ +IKKDL AKK+ P+S Sbjct: 1 MLQSLLEFAPGNGVEIHLVQNDSISNLSKQFADIKKDLYAKKEAPSS 47 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.317 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,779,249 Number of Sequences: 37866 Number of extensions: 45704 Number of successful extensions: 174 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 162 Number of HSP's gapped (non-prelim): 12 length of query: 47 length of database: 18,247,518 effective HSP length: 21 effective length of query: 26 effective length of database: 17,452,332 effective search space: 453760632 effective search space used: 453760632 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.