BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|169208304 PREDICTED: hypothetical protein [Homo sapiens] (49 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|169208304 PREDICTED: hypothetical protein [Homo sapiens] 110 3e-25 gi|169208488 PREDICTED: hypothetical protein [Homo sapiens] 110 3e-25 >gi|169208304 PREDICTED: hypothetical protein [Homo sapiens] Length = 49 Score = 110 bits (274), Expect = 3e-25 Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MLQWSVSCGGGSWFLWKIEANNFSLALNPHTDILLSPLAGGARKHQPCA 49 MLQWSVSCGGGSWFLWKIEANNFSLALNPHTDILLSPLAGGARKHQPCA Sbjct: 1 MLQWSVSCGGGSWFLWKIEANNFSLALNPHTDILLSPLAGGARKHQPCA 49 >gi|169208488 PREDICTED: hypothetical protein [Homo sapiens] Length = 150 Score = 110 bits (274), Expect = 3e-25 Identities = 49/49 (100%), Positives = 49/49 (100%) Query: 1 MLQWSVSCGGGSWFLWKIEANNFSLALNPHTDILLSPLAGGARKHQPCA 49 MLQWSVSCGGGSWFLWKIEANNFSLALNPHTDILLSPLAGGARKHQPCA Sbjct: 102 MLQWSVSCGGGSWFLWKIEANNFSLALNPHTDILLSPLAGGARKHQPCA 150 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.322 0.136 0.480 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,340,149 Number of Sequences: 37866 Number of extensions: 66344 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 104 Number of HSP's gapped (non-prelim): 2 length of query: 49 length of database: 18,247,518 effective HSP length: 23 effective length of query: 26 effective length of database: 17,376,600 effective search space: 451791600 effective search space used: 451791600 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.