Guide to the Human Genome
Home | Table of Contents | Search text | Search genes | Search sequences | Purchase | FAQ | Blog | Help

Search of human proteins with 110349721

BLASTP 2.2.11 [Jun-05-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= gi|110349721 titin isoform novex-3 [Homo sapiens]
         (5604 letters)

Database: hs.faa 
           37,866 sequences; 18,247,518 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|110349721 titin isoform novex-3 [Homo sapiens]                    1.110e+04   0.0  
gi|110349719 titin isoform N2-A [Homo sapiens]                       6808   0.0  
gi|110349715 titin isoform N2-B [Homo sapiens]                       6527   0.0  
gi|110349713 titin isoform novex-1 [Homo sapiens]                    6492   0.0  
gi|110349717 titin isoform novex-2 [Homo sapiens]                    6472   0.0  
gi|58331253 obscurin, cytoskeletal calmodulin and titin-interact...   446   e-124
gi|148833506 obscurin, cytoskeletal calmodulin and titin-interac...   446   e-124
gi|144226847 obscurin-like 1 [Homo sapiens]                           291   1e-77
gi|93102361 palladin [Homo sapiens]                                   270   2e-71
gi|118572606 hemicentin 1 [Homo sapiens]                              227   2e-58
gi|153792294 myopalladin [Homo sapiens]                               223   4e-57
gi|169178458 PREDICTED: hemicentin 2 [Homo sapiens]                   218   2e-55
gi|239749684 PREDICTED: hemicentin 2 [Homo sapiens]                   216   7e-55
gi|169177000 PREDICTED: hemicentin 2 [Homo sapiens]                   211   2e-53
gi|253970427 immunoglobulin superfamily, member 22 [Homo sapiens]     201   1e-50
gi|157785645 SPEG complex locus [Homo sapiens]                        148   1e-34
gi|46049110 myosin binding protein C, slow type isoform 4 [Homo ...   139   8e-32
gi|46049119 myosin binding protein C, slow type isoform 3 [Homo ...   139   8e-32
gi|46049125 myosin binding protein C, slow type isoform 2 [Homo ...   139   8e-32
gi|45976288 myosin binding protein C, slow type isoform 1 [Homo ...   139   8e-32
gi|209693444 myotilin isoform b [Homo sapiens]                        127   2e-28
gi|5803106 myotilin isoform a [Homo sapiens]                          127   2e-28
gi|133908641 myosin binding protein C, fast type [Homo sapiens]       124   3e-27
gi|148596957 myosin binding protein C, cardiac [Homo sapiens]         118   2e-25
gi|116008194 myosin light chain kinase isoform 3A [Homo sapiens]      118   2e-25
gi|116008192 myosin light chain kinase isoform 1 [Homo sapiens]       118   2e-25
gi|116008190 myosin light chain kinase isoform 3B [Homo sapiens]      118   2e-25
gi|116008188 myosin light chain kinase isoform 2 [Homo sapiens]       118   2e-25
gi|193083163 roundabout, axon guidance receptor, homolog 2 isofo...   109   7e-23
gi|61888896 roundabout, axon guidance receptor, homolog 2 isofor...   109   7e-23

>gi|110349721 titin isoform novex-3 [Homo sapiens]
          Length = 5604

 Score = 1.110e+04 bits (28794), Expect = 0.0
 Identities = 5604/5604 (100%), Positives = 5604/5604 (100%)

Query: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD 60
            MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
Sbjct: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD 60

Query: 61   GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120
            GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
Sbjct: 61   GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120

Query: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
            VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
Sbjct: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180

Query: 181  SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV 240
            SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
Sbjct: 181  SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV 240

Query: 241  IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT 300
            IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
Sbjct: 241  IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT 300

Query: 301  PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR 360
            PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR
Sbjct: 301  PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR 360

Query: 361  ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA 420
            ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA
Sbjct: 361  ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA 420

Query: 421  DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV 480
            DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV
Sbjct: 421  DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV 480

Query: 481  VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS 540
            VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS
Sbjct: 481  VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS 540

Query: 541  EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK 600
            EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK
Sbjct: 541  EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK 600

Query: 601  IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA 660
            IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA
Sbjct: 601  IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA 660

Query: 661  VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP 720
            VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP
Sbjct: 661  VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP 720

Query: 721  GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT 780
            GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT
Sbjct: 721  GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT 780

Query: 781  DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA 840
            DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA
Sbjct: 781  DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA 840

Query: 841  TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK 900
            TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK
Sbjct: 841  TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK 900

Query: 901  EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV 960
            EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV
Sbjct: 901  EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV 960

Query: 961  TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE 1020
            TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE
Sbjct: 961  TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE 1020

Query: 1021 AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA 1080
            AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA
Sbjct: 1021 AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA 1080

Query: 1081 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1140
            APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK
Sbjct: 1081 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1140

Query: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP 1200
            LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP
Sbjct: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP 1200

Query: 1201 KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY 1260
            KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY
Sbjct: 1201 KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY 1260

Query: 1261 RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP 1320
            RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP
Sbjct: 1261 RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP 1320

Query: 1321 KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY 1380
            KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY
Sbjct: 1321 KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY 1380

Query: 1381 VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG 1440
            VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG
Sbjct: 1381 VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG 1440

Query: 1441 RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND 1500
            RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND
Sbjct: 1441 RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND 1500

Query: 1501 YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1560
            YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE
Sbjct: 1501 YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1560

Query: 1561 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST 1620
            KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST
Sbjct: 1561 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST 1620

Query: 1621 VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL 1680
            VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL
Sbjct: 1621 VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL 1680

Query: 1681 HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH 1740
            HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH
Sbjct: 1681 HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH 1740

Query: 1741 DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL 1800
            DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL
Sbjct: 1741 DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL 1800

Query: 1801 VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF 1860
            VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF
Sbjct: 1801 VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF 1860

Query: 1861 RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV 1920
            RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV
Sbjct: 1861 RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV 1920

Query: 1921 IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK 1980
            IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK
Sbjct: 1921 IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK 1980

Query: 1981 RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH 2040
            RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH
Sbjct: 1981 RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH 2040

Query: 2041 WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR 2100
            WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR
Sbjct: 2041 WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR 2100

Query: 2101 VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET 2160
            VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET
Sbjct: 2101 VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET 2160

Query: 2161 SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY 2220
            SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY
Sbjct: 2161 SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY 2220

Query: 2221 RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE 2280
            RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE
Sbjct: 2221 RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE 2280

Query: 2281 SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2340
            SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI
Sbjct: 2281 SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2340

Query: 2341 DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR 2400
            DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR
Sbjct: 2341 DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR 2400

Query: 2401 VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT 2460
            VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT
Sbjct: 2401 VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT 2460

Query: 2461 KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2520
            KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG
Sbjct: 2461 KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2520

Query: 2521 RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2580
            RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI
Sbjct: 2521 RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2580

Query: 2581 EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE 2640
            EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE
Sbjct: 2581 EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE 2640

Query: 2641 CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA 2700
            CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA
Sbjct: 2641 CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA 2700

Query: 2701 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT 2760
            KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT
Sbjct: 2701 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT 2760

Query: 2761 IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH 2820
            IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH
Sbjct: 2761 IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH 2820

Query: 2821 DTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE 2880
            DTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE
Sbjct: 2821 DTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE 2880

Query: 2881 TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII 2940
            TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII
Sbjct: 2881 TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII 2940

Query: 2941 MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK 3000
            MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK
Sbjct: 2941 MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK 3000

Query: 3001 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3060
            WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF
Sbjct: 3001 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3060

Query: 3061 RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3120
            RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR
Sbjct: 3061 RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3120

Query: 3121 MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY 3180
            MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY
Sbjct: 3121 MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY 3180

Query: 3181 KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ 3240
            KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ
Sbjct: 3181 KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ 3240

Query: 3241 VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE 3300
            VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE
Sbjct: 3241 VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE 3300

Query: 3301 AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ 3360
            AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ
Sbjct: 3301 AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ 3360

Query: 3361 PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN 3420
            PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN
Sbjct: 3361 PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN 3420

Query: 3421 AVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDH 3480
            AVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDH
Sbjct: 3421 AVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDH 3480

Query: 3481 KSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHN 3540
            KSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHN
Sbjct: 3481 KSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHN 3540

Query: 3541 NRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQK 3600
            NRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQK
Sbjct: 3541 NRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQK 3600

Query: 3601 GQDEKYLEFLKRAERTHENVEALVERGEDRIKVDLRFTGSPFNKKQDVEQKGMMRTIHFK 3660
            GQDEKYLEFLKRAERTHENVEALVERGEDRIKVDLRFTGSPFNKKQDVEQKGMMRTIHFK
Sbjct: 3601 GQDEKYLEFLKRAERTHENVEALVERGEDRIKVDLRFTGSPFNKKQDVEQKGMMRTIHFK 3660

Query: 3661 TMSSAKKTDYMYDEEYLESKSDIRGWLNVGESFLDKETKVKLQRLREARKTLMEKKKLSL 3720
            TMSSAKKTDYMYDEEYLESKSDIRGWLNVGESFLDKETKVKLQRLREARKTLMEKKKLSL
Sbjct: 3661 TMSSAKKTDYMYDEEYLESKSDIRGWLNVGESFLDKETKVKLQRLREARKTLMEKKKLSL 3720

Query: 3721 LDTSSEISSRTLRSEASDKDILFSREDMKIRSMSDLAESYKVDHSAESIVQNPHALSNQM 3780
            LDTSSEISSRTLRSEASDKDILFSREDMKIRSMSDLAESYKVDHSAESIVQNPHALSNQM
Sbjct: 3721 LDTSSEISSRTLRSEASDKDILFSREDMKIRSMSDLAESYKVDHSAESIVQNPHALSNQM 3780

Query: 3781 DQNIESEELPTSFQTIVDEEIFQTEIRMSQEALVKESLPKDHLYGEILVNENTQARGQLE 3840
            DQNIESEELPTSFQTIVDEEIFQTEIRMSQEALVKESLPKDHLYGEILVNENTQARGQLE
Sbjct: 3781 DQNIESEELPTSFQTIVDEEIFQTEIRMSQEALVKESLPKDHLYGEILVNENTQARGQLE 3840

Query: 3841 EIMANTTIGESSTYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASERI 3900
            EIMANTTIGESSTYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASERI
Sbjct: 3841 EIMANTTIGESSTYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASERI 3900

Query: 3901 KKDDLRELQLSASTRIDEFKTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDS 3960
            KKDDLRELQLSASTRIDEFKTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDS
Sbjct: 3901 KKDDLRELQLSASTRIDEFKTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDS 3960

Query: 3961 CNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFN 4020
            CNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFN
Sbjct: 3961 CNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFN 4020

Query: 4021 QYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTN 4080
            QYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTN
Sbjct: 4021 QYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTN 4080

Query: 4081 LHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESKEVFQTEELEPKAMPQDQVT 4140
            LHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESKEVFQTEELEPKAMPQDQVT
Sbjct: 4081 LHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESKEVFQTEELEPKAMPQDQVT 4140

Query: 4141 QSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLK 4200
            QSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLK
Sbjct: 4141 QSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLK 4200

Query: 4201 QNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPVTYRENSQFE 4260
            QNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPVTYRENSQFE
Sbjct: 4201 QNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPVTYRENSQFE 4260

Query: 4261 NIGEIYGKYSRDQQLQDQGESVRAHFYDYPAGPFTPWTNVKEYSVRDYFQSLETIEQIDQ 4320
            NIGEIYGKYSRDQQLQDQGESVRAHFYDYPAGPFTPWTNVKEYSVRDYFQSLETIEQIDQ
Sbjct: 4261 NIGEIYGKYSRDQQLQDQGESVRAHFYDYPAGPFTPWTNVKEYSVRDYFQSLETIEQIDQ 4320

Query: 4321 KEQVRCIPSREKIPRFVHGASRTIKISKPIRAEFIQCQAEGKERHVSEKSKLHQAEGTVY 4380
            KEQVRCIPSREKIPRFVHGASRTIKISKPIRAEFIQCQAEGKERHVSEKSKLHQAEGTVY
Sbjct: 4321 KEQVRCIPSREKIPRFVHGASRTIKISKPIRAEFIQCQAEGKERHVSEKSKLHQAEGTVY 4380

Query: 4381 PFVDDFSDVTIKKEIRNNFGKLGRSEKENVQECAQSDYLPNIHSERISDSYNTKDSSAIV 4440
            PFVDDFSDVTIKKEIRNNFGKLGRSEKENVQECAQSDYLPNIHSERISDSYNTKDSSAIV
Sbjct: 4381 PFVDDFSDVTIKKEIRNNFGKLGRSEKENVQECAQSDYLPNIHSERISDSYNTKDSSAIV 4440

Query: 4441 YEESLGEEIHYPGKKVKHRIIEFEKLHVEKGVLEKRPTRTSIVNPPQKKIDDKAFSLKQR 4500
            YEESLGEEIHYPGKKVKHRIIEFEKLHVEKGVLEKRPTRTSIVNPPQKKIDDKAFSLKQR
Sbjct: 4441 YEESLGEEIHYPGKKVKHRIIEFEKLHVEKGVLEKRPTRTSIVNPPQKKIDDKAFSLKQR 4500

Query: 4501 ESRSSNLNANMYQAEKMSPNTESDSSNIAINLKLLSSQTHKEFDAQEREQQEKISLIDKP 4560
            ESRSSNLNANMYQAEKMSPNTESDSSNIAINLKLLSSQTHKEFDAQEREQQEKISLIDKP
Sbjct: 4501 ESRSSNLNANMYQAEKMSPNTESDSSNIAINLKLLSSQTHKEFDAQEREQQEKISLIDKP 4560

Query: 4561 AISKRAEHESPITFDLKQFHTQIKHTDVKFQELDSGQPEEAYFKIQHPADTENIVFDLKQ 4620
            AISKRAEHESPITFDLKQFHTQIKHTDVKFQELDSGQPEEAYFKIQHPADTENIVFDLKQ
Sbjct: 4561 AISKRAEHESPITFDLKQFHTQIKHTDVKFQELDSGQPEEAYFKIQHPADTENIVFDLKQ 4620

Query: 4621 MYSHIGDPALEFQGQETREQQEIHYKEKIPSPETLQPDTHNISKSVQNNVFASQEISSSQ 4680
            MYSHIGDPALEFQGQETREQQEIHYKEKIPSPETLQPDTHNISKSVQNNVFASQEISSSQ
Sbjct: 4621 MYSHIGDPALEFQGQETREQQEIHYKEKIPSPETLQPDTHNISKSVQNNVFASQEISSSQ 4680

Query: 4681 ELSNRTMVEKSSIDENSISLEKEVRHVQEQNLDILKTDLSLKSFSEEIYSESCALLPTSS 4740
            ELSNRTMVEKSSIDENSISLEKEVRHVQEQNLDILKTDLSLKSFSEEIYSESCALLPTSS
Sbjct: 4681 ELSNRTMVEKSSIDENSISLEKEVRHVQEQNLDILKTDLSLKSFSEEIYSESCALLPTSS 4740

Query: 4741 ADIEETDLSEKSCPLENGGRSSISHLKKAASEEKPLGVGEMEEECTLEPELAAFPKQDGG 4800
            ADIEETDLSEKSCPLENGGRSSISHLKKAASEEKPLGVGEMEEECTLEPELAAFPKQDGG
Sbjct: 4741 ADIEETDLSEKSCPLENGGRSSISHLKKAASEEKPLGVGEMEEECTLEPELAAFPKQDGG 4800

Query: 4801 TQEYTDATLEDHRGDVQEADTLHRQLSLSQCFPLLMTEEQQNPGEQISTNIHASGEEKCY 4860
            TQEYTDATLEDHRGDVQEADTLHRQLSLSQCFPLLMTEEQQNPGEQISTNIHASGEEKCY
Sbjct: 4801 TQEYTDATLEDHRGDVQEADTLHRQLSLSQCFPLLMTEEQQNPGEQISTNIHASGEEKCY 4860

Query: 4861 EEVQVQNEASFSTLEGEMIETSFSQNIPKLDEAHTTEAAESETSLTQYLLAAGKREVPET 4920
            EEVQVQNEASFSTLEGEMIETSFSQNIPKLDEAHTTEAAESETSLTQYLLAAGKREVPET
Sbjct: 4861 EEVQVQNEASFSTLEGEMIETSFSQNIPKLDEAHTTEAAESETSLTQYLLAAGKREVPET 4920

Query: 4921 KDTRDQAKLVQSESITSMEVEEVTFNTVYEYYNQKQESLGRPLSPESDISIGVGSTTSEE 4980
            KDTRDQAKLVQSESITSMEVEEVTFNTVYEYYNQKQESLGRPLSPESDISIGVGSTTSEE
Sbjct: 4921 KDTRDQAKLVQSESITSMEVEEVTFNTVYEYYNQKQESLGRPLSPESDISIGVGSTTSEE 4980

Query: 4981 ISELDQFYTPPSSVEYFESPKSPDLYFNPSDITKQSSIHSGGETVERYSTPLGEVAERYS 5040
            ISELDQFYTPPSSVEYFESPKSPDLYFNPSDITKQSSIHSGGETVERYSTPLGEVAERYS
Sbjct: 4981 ISELDQFYTPPSSVEYFESPKSPDLYFNPSDITKQSSIHSGGETVERYSTPLGEVAERYS 5040

Query: 5041 TPSEGEVGERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPG 5100
            TPSEGEVGERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPG
Sbjct: 5041 TPSEGEVGERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPG 5100

Query: 5101 ETLERYSTPPGEALERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEHFYTPTEERGSAYE 5160
            ETLERYSTPPGEALERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEHFYTPTEERGSAYE
Sbjct: 5101 ETLERYSTPPGEALERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEHFYTPTEERGSAYE 5160

Query: 5161 IWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNK 5220
            IWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNK
Sbjct: 5161 IWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNK 5220

Query: 5221 SLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVV 5280
            SLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVV
Sbjct: 5221 SLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVV 5280

Query: 5281 ALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDH 5340
            ALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDH
Sbjct: 5281 ALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDH 5340

Query: 5341 KSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFK 5400
            KSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFK
Sbjct: 5341 KSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFK 5400

Query: 5401 CSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVG 5460
            CSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVG
Sbjct: 5401 CSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVG 5460

Query: 5461 EAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGI 5520
            EAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGI
Sbjct: 5461 EAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGI 5520

Query: 5521 SDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSD 5580
            SDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSD
Sbjct: 5521 SDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSD 5580

Query: 5581 EGEYRCVATNKSGMAESFAALTLT 5604
            EGEYRCVATNKSGMAESFAALTLT
Sbjct: 5581 EGEYRCVATNKSGMAESFAALTLT 5604


>gi|110349719 titin isoform N2-A [Homo sapiens]
          Length = 33423

 Score = 6808 bits (17663), Expect = 0.0
 Identities = 3484/3599 (96%), Positives = 3494/3599 (97%), Gaps = 52/3599 (1%)

Query: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD 60
            MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
Sbjct: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD 60

Query: 61   GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120
            GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
Sbjct: 61   GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120

Query: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
            VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
Sbjct: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180

Query: 181  SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV 240
            SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
Sbjct: 181  SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV 240

Query: 241  IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT 300
            IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
Sbjct: 241  IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT 300

Query: 301  PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR 360
            PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR
Sbjct: 301  PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR 360

Query: 361  ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA 420
            ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA
Sbjct: 361  ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA 420

Query: 421  DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV 480
            DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV
Sbjct: 421  DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV 480

Query: 481  VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS 540
            VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS
Sbjct: 481  VAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQETRIS 540

Query: 541  EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK 600
            EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK
Sbjct: 541  EEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEK 600

Query: 601  IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA 660
            IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA
Sbjct: 601  IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIA 660

Query: 661  VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP 720
            VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP
Sbjct: 661  VATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREP 720

Query: 721  GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT 780
            GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT
Sbjct: 721  GHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTT 780

Query: 781  DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA 840
            DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA
Sbjct: 781  DQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIA 840

Query: 841  TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK 900
            TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK
Sbjct: 841  TLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKK 900

Query: 901  EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV 960
            EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV
Sbjct: 901  EVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESV 960

Query: 961  TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE 1020
            TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE
Sbjct: 961  TLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNE 1020

Query: 1021 AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA 1080
            AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA
Sbjct: 1021 AGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAGPGEPA 1080

Query: 1081 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1140
            APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK
Sbjct: 1081 APYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECK 1140

Query: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP 1200
            LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP
Sbjct: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP 1200

Query: 1201 KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY 1260
            KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY
Sbjct: 1201 KVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEY 1260

Query: 1261 RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP 1320
            RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP
Sbjct: 1261 RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP 1320

Query: 1321 KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY 1380
            KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY
Sbjct: 1321 KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY 1380

Query: 1381 VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG 1440
            VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG
Sbjct: 1381 VEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPG 1440

Query: 1441 RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND 1500
            RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND
Sbjct: 1441 RRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND 1500

Query: 1501 YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1560
            YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE
Sbjct: 1501 YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVE 1560

Query: 1561 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST 1620
            KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST
Sbjct: 1561 KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST 1620

Query: 1621 VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL 1680
            VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL
Sbjct: 1621 VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL 1680

Query: 1681 HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH 1740
            HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH
Sbjct: 1681 HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH 1740

Query: 1741 DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL 1800
            DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL
Sbjct: 1741 DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL 1800

Query: 1801 VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF 1860
            VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF
Sbjct: 1801 VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF 1860

Query: 1861 RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV 1920
            RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV
Sbjct: 1861 RCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGV 1920

Query: 1921 IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK 1980
            IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK
Sbjct: 1921 IEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK 1980

Query: 1981 RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH 2040
            RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH
Sbjct: 1981 RAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLH 2040

Query: 2041 WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR 2100
            WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR
Sbjct: 2041 WTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR 2100

Query: 2101 VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET 2160
            VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET
Sbjct: 2101 VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET 2160

Query: 2161 SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY 2220
            SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY
Sbjct: 2161 SSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKY 2220

Query: 2221 RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE 2280
            RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE
Sbjct: 2221 RMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPE 2280

Query: 2281 SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2340
            SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI
Sbjct: 2281 SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2340

Query: 2341 DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR 2400
            DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR
Sbjct: 2341 DGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR 2400

Query: 2401 VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT 2460
            VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT
Sbjct: 2401 VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGT 2460

Query: 2461 KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2520
            KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG
Sbjct: 2461 KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2520

Query: 2521 RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2580
            RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI
Sbjct: 2521 RVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2580

Query: 2581 EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE 2640
            EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE
Sbjct: 2581 EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFE 2640

Query: 2641 CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA 2700
            CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA
Sbjct: 2641 CEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSA 2700

Query: 2701 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT 2760
            KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT
Sbjct: 2701 KLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT 2760

Query: 2761 IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH 2820
            IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH
Sbjct: 2761 IYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSH 2820

Query: 2821 DTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE 2880
            DTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE
Sbjct: 2821 DTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE 2880

Query: 2881 TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII 2940
            TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII
Sbjct: 2881 TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLII 2940

Query: 2941 MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK 3000
            MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK
Sbjct: 2941 MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYK 3000

Query: 3001 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3060
            WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF
Sbjct: 3001 WLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEF 3060

Query: 3061 RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3120
            RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR
Sbjct: 3061 RKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTR 3120

Query: 3121 MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY 3180
            MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY
Sbjct: 3121 MSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWY 3180

Query: 3181 KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ 3240
            KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ
Sbjct: 3181 KDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQ 3240

Query: 3241 VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE 3300
            VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE
Sbjct: 3241 VLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE 3300

Query: 3301 AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ 3360
            AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ
Sbjct: 3301 AFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQ 3360

Query: 3361 PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN 3420
            PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN
Sbjct: 3361 PARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASN 3420

Query: 3421 AVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDH 3480
            AVGQVSSTANLSLEAPESILHERIEQEIEMEMK                           
Sbjct: 3421 AVGQVSSTANLSLEAPESILHERIEQEIEMEMKA-------------------------- 3454

Query: 3481 KSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHN 3540
                                   P   +K+    V  G    FTC + + P     WF  
Sbjct: 3455 ----------------------APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKA 3492

Query: 3541 NRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQ 3599
             R I    +  I++      + SSLEI R Q  D G Y   A N  GS   TA+L V +
Sbjct: 3493 GREIYESDKCSIRSSK----YISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTE 3547



 Score =  634 bits (1634), Expect = e-180
 Identities = 604/2355 (25%), Positives = 1012/2355 (42%), Gaps = 263/2355 (11%)

Query: 1451 LERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED 1510
            +E   KP+FV K  +    EG      ++  G P P+  W  +   IV     K+ I+  
Sbjct: 1550 VEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGT 1609

Query: 1511 GTQSLIIVPATPSDSGEW-TVVAQNRAGRSSISVILTVEAV------------------- 1550
              ++ + + +T S    W T  A N+AGR +    + VE                     
Sbjct: 1610 KGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRA 1669

Query: 1551 ----------------------------EHQVKPMFVEKLKNVNIKEGSRLEMKVRAT-- 1580
                                        E Q KP F +KL ++ +K       + R T  
Sbjct: 1670 KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPI 1729

Query: 1581 GNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDT 1640
            G+P   + WL +   +      ++R+    G  +L      S+DS   T  A NK G D 
Sbjct: 1730 GDPTMVVEWLHDGKPLEAAN--RLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDH 1787

Query: 1641 TRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQ 1700
            T   + V+ E +  E  +   +P G    + I   ELE    R   E    G   D++++
Sbjct: 1788 TSATLIVKDEKSLVEESQ---LPEGRKGLQRIE--ELE----RMAHEGALTGVTTDQKEK 1838

Query: 1701 QKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYC 1760
            QKP        +R+     A F CR+T  G P   V W  +G+ +  + R R+  + G  
Sbjct: 1839 QKPDIVLYPEPVRVLEGETARFRCRVT--GYPQPKVNWYLNGQLIRKSKRFRVRYD-GIH 1895

Query: 1761 SLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELE 1820
             LD     S D+G +   A N  G         V + K  +E  Q  + R  L+R  E  
Sbjct: 1896 YLDIVDCKSYDTGEVKVTAENPEG---------VIEHKVKLEIQQREDFRSVLRRAPEPR 1946

Query: 1821 RMAHEGALTGVTTDQKEKQKP-DIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQ 1879
               H      +  + ++  +P D     E V++   E      R+T    P+ +  L  +
Sbjct: 1947 PEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAE------RITHEKVPEESEELRSK 2000

Query: 1880 LIRKSKRFRVRYDGIHYLDIVDCKSYDTGE-------------VKVTAENPEGVIEHKVK 1926
              R+++     Y+ I  +++   K  ++ E              K   E  +  +  + K
Sbjct: 2001 FKRRTEEGY--YEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGK 2058

Query: 1927 LEIQQREDFRSVLRRAPEPRPEFH------VHEPGKLQFEVQKVDRPVDTTET-KEVVKL 1979
            + I   +  +  L  + E    F       V +     F V+ V +P    E  K  VK+
Sbjct: 2059 ITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKI 2118

Query: 1980 KRAERI-------------THEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKK-DE 2025
            +R++RI               +   E+S  +  K      E    A   V+ K      +
Sbjct: 2119 ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQ 2178

Query: 2026 SYEELLRKTKDEL-------------LHWTK---ELTEEEKKALAEEGKI------TIPT 2063
              ++++ K KD +             + W K   E+ E +K  +  + K+      TI T
Sbjct: 2179 ELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDT 2238

Query: 2064 ----------FKPDKIELSPSM----EAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPEC 2109
                       + + ++ +  +       +  + +Q   V +         +V   + E 
Sbjct: 2239 SDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC-IVSPENIEG 2297

Query: 2110 EWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ 2169
            +WY N V+++ + + Y          L ++DVT ED       +  I G+ ++    L  
Sbjct: 2298 KWYHNDVELKSNGK-YTITSRRGRQNLTVKDVTKEDQGEY---SFVIDGKKTTCK--LKM 2351

Query: 2170 AKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVH 2229
              + I   Q L D    E D +   E + S   V+  W KDG EV   D+  +  D++ H
Sbjct: 2352 KPRPIAILQGLSDQKVCEGD-IVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSH 2410

Query: 2230 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2289
             L I  +   DA +YS   +    + T+ ++ V    V+ +  L+D+ V E     LEC 
Sbjct: 2411 MLLIEDMTKEDAGNYSFT-IPALGLSTSGRVSVYS--VDVITPLKDVNVIEGTKAVLECK 2467

Query: 2290 VS-PENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCK 2348
            VS P+    KWY ND ++K + +     +  +Q L +      D+G Y  ++   +T C 
Sbjct: 2468 VSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCN 2527

Query: 2349 LKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQ 2408
            L ++   I I++GL D    E   V  EV++S   ++ +W    +E++PS +  I    +
Sbjct: 2528 LSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGK 2585

Query: 2409 SHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKV 2468
             + L + +M K+D G Y+F   A    TSG+++V    +  PL D  V E  +AV EC+V
Sbjct: 2586 IYKLTVLNMMKDDEGKYTFY--AGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEV 2643

Query: 2469 SVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNL 2528
            + PD +  +W  + + +   + +++   G K+RL+I  T   D G Y   V   +T+  L
Sbjct: 2644 ANPD-SKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKL 2702

Query: 2529 SVEKIKIIRGLRDLTCTETQNVVFEVELSHSGID-VLWNFKDKEIKPSSKYKIEAHGKIY 2587
             VE +KI + L++LT TETQ+ VF VEL+H  +  V W      ++ + KY I   G IY
Sbjct: 2703 KVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIY 2762

Query: 2588 KLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPD 2647
             L + N    DE  Y F  G    S +L V    I K   D T  E+    FE  V++  
Sbjct: 2763 SLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDT 2822

Query: 2648 SKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAV 2707
               +W      +  ++  R  S+    +L++      D GEYT  V   +  AKL VE +
Sbjct: 2823 VPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETL 2882

Query: 2708 KIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIK 2767
             I KT+KN+ V ET+ A F  E++H NV  + W+KNGV +E +EK+ I V+G ++ L I 
Sbjct: 2883 HITKTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIM 2941

Query: 2768 NCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKW 2827
            N +  D + Y F  G    SA L V  + I    KD+ A E  T+ FEV+V+++ +  KW
Sbjct: 2942 NTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKW 3001

Query: 2828 FHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHIT-- 2885
                VEIK +DK ++ +++  H L ++N+   DA +YT V G+    A L+VE  HI   
Sbjct: 3002 LKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFR 3061

Query: 2886 KTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTST 2945
            K +K+I+V E K A FECEVS  ++   W+K+  E++++++ KI  +  +H+L+I +T  
Sbjct: 3062 KHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRM 3121

Query: 2946 EDSAEYTFVCGNDQVSATLTVT--PIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLK 3003
             D+ +YT V G +  +A L V    + I S+ K++   EK     E  VN + +   W K
Sbjct: 3122 SDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYK 3181

Query: 3004 NGVEI--KSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHI-EF 3060
            +G+EI  +  ++ +   ++  H + I      DA +YTFVAG+  S+ TLYV A    + 
Sbjct: 3182 DGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQV 3241

Query: 3061 RKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPST 3119
             + ++ + V   K A F   +S  P   + W K++Q L    + K   +   + LL+   
Sbjct: 3242 LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEA 3301

Query: 3120 RMSDAGKYTVVA----GGNVSTAKLFVEGRDV------------RIRSIKKEVQVIEKQR 3163
               DA  YT  A    G   ++A L VE  +V             I +  ++    E Q 
Sbjct: 3302 FPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQP 3361

Query: 3164 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA- 3222
            A  +  V+  D+   WY    +I  +     +       +++ I+E    D G YTFVA 
Sbjct: 3362 ARFQCRVSGTDLKVSWYSKDKKI--KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVAS 3419

Query: 3223 ---GRNRSSVTLYVNAPEP-----------------PQVLQELQPVTVQSGKPARFCAVI 3262
               G+  S+  L + APE                  P + ++++P+ V  G  A+F   I
Sbjct: 3420 NAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEI 3479

Query: 3263 SGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATT 3322
               P  +  W+K  + +    KC         +L ++     D   YTC+A N+YG  + 
Sbjct: 3480 QSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSC 3539

Query: 3323 SASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKD 3381
            +A+L+V              YPP  ++  +   T  G+ A+F C V+GT  ++  W    
Sbjct: 3540 TATLTVT-----------EAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDG 3588

Query: 3382 KKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANL---------- 3431
              + PS  +R++  E+ + LE++    +D G Y+  ASN  G     A L          
Sbjct: 3589 AALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIK 3648

Query: 3432 SLEAPESILHERIEQEIEMEMKELFS-----EGESEHSERDTRDAFSDS----------- 3475
             LE  +S +++++  E +++     +     +G+     +D +  F D            
Sbjct: 3649 ELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKL 3708

Query: 3476 EDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYV-LEGEPVVFTCRLIACPTPE 3534
            +D       A   A   S +++      PSF +K+   Y+ L GE     C+L   P  +
Sbjct: 3709 KDSGTYVCTASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQ 3768

Query: 3535 MTWFHNNRPIP-TGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTA 3593
            +TWF NN+ +  +   R+    S+     + L+I  V+  DSGSY   A+N  GS   + 
Sbjct: 3769 VTWFKNNKELSESNTVRMYFVNSE-----AILDITDVKVEDSGSYSCEAVNDVGSDSCST 3823

Query: 3594 SLLVIQKGQDEKYLE 3608
             +++ +     K LE
Sbjct: 3824 EIVIKEPPSFIKTLE 3838



 Score =  493 bits (1269), Expect = e-138
 Identities = 490/2041 (24%), Positives = 848/2041 (41%), Gaps = 203/2041 (9%)

Query: 1480  VVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGT---------QSLIIVPATPSDSGEWTV 1530
             V G+P+  +   +  + +V     K+V+++ G          ++L I  A  +D+G +TV
Sbjct: 11225 VKGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTV 11284

Query: 1531  VAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIK-EGSRLEMKVRATGNPNPDIVW 1589
               +N       S +  VE +    +   V+ +++ ++K +G+ +     A   PN  I W
Sbjct: 11285 TVENANNLECSSCVKVVEVI----RDWLVKPIRDQHVKPKGTAIFACDIAKDTPN--IKW 11338

Query: 1590  LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649
              K  D I      K  I        LKI + + +D A Y      K        +   ++
Sbjct: 11339 FKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGK--------RYPAKL 11390

Query: 1650  EFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKL 1709
                E E E    I   T   KE A+ + E        +   +G+L       +P    ++
Sbjct: 11391 TLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQWKLKGELL------RPSPTCEI 11444

Query: 1710  TSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRL-RMINEFGYCSLDYGVAY 1768
              +   KRF   H + +L   G+              +A N +   I       LD+ V  
Sbjct: 11445 KAEGGKRFLTLH-KVKLDQAGEVL-----------YQALNAITTAILTVKEIELDFAVPL 11492

Query: 1769  ------SRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERM 1822
                    R      C  T +     +    I+K          + +G+K +  I +  + 
Sbjct: 11493 KDVTVPERRQARFECVLTREANVIWSKGPDIIKSSDKF---DIIADGKKHILVIND-SQF 11548

Query: 1823  AHEGALTGVTTDQKEKQKPDIVLYPEPVR-----------VLEGETARFRCRVTGYPQPK 1871
               EG    V T + E +K    L+   +R           V EGETA F C ++ + +  
Sbjct: 11549 DDEG----VYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELS-HEKMH 11603

Query: 1872  VNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQ 1930
             V W+ N   +  S+   +  +G  H L++ +    D  ++K   +      + KV     
Sbjct: 11604 VVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVL---- 11659

Query: 1931  QREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKV 1990
                          E  P F V    K   E  ++    + ++   V   K  E I    V
Sbjct: 11660 -------------EADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEI----V 11702

Query: 1991  PEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEK 2050
             P     +++   RR             LK +K D          KD+  +     T++ K
Sbjct: 11703 PSPKYSIKADGLRRI------------LKIKKAD---------LKDKGEYVCDCGTDKTK 11741

Query: 2051  KALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECE 2110
               +  E ++                   K+ + +    V  G  AHF +  + +PD   +
Sbjct: 11742 ANVTVEARLI------------------KVEKPLYGVEVFVGETAHFEIE-LSEPDVHGQ 11782

Query: 2111  WYKNGVKIERSDRIYWYWPEDNVCE------LVIRDVTAEDSASIMVKAINIAGETSSHA 2164
             W   G  +  S       P+  + E      L++ +     +  +  +A N      S A
Sbjct: 11783 WKLKGQPLTAS-------PDCEIIEDGKKHILILHNCQLGMTGEVSFQAAN----AKSAA 11831

Query: 2165  FLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHS 2224
              L V+   LI F   L DV   EKD  A FECE S      +W K   E+   D++ +  
Sbjct: 11832 NLKVKELPLI-FITPLSDVKVFEKDE-AKFECEVSREPKTFRWLKGTQEITGDDRFELIK 11889

Query: 2225  DRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSG 2284
             D   H    + I ++  ED +  + E E+  T+ KLI+EG  ++F+  L+D+   E  S 
Sbjct: 11890 DGTKH---SMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESA 11946

Query: 2285  ELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKK 2344
                  +S +NI  KW+ ND  L +    ++       ++T KD++ +D  +      G  
Sbjct: 11947 VFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMS 12006

Query: 2345  TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIV 2404
             +  KL +          L D    E D V L+ ++S       W KDG+E++PS    I 
Sbjct: 12007 SEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNAVIK 12066

Query: 2405  IDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSV--YSVDVITPLKDVNVIEGTKA 2462
              D +  ML+++   K D G Y  T       TSG++ +    + ++ PL  V V+E   A
Sbjct: 12067 ADGKKRMLILKKALKSDIGQY--TCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETA 12124

Query: 2463  VLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRV 2522
               E ++S  D+    W L  E +      +   +G    LV++       G        V
Sbjct: 12125 RFETEISEDDI-HANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANV 12183

Query: 2523  ETNCNLSVEK--IKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKI 2580
             +++ +L V+   I ++R L+D+T T  +   F+ ELS+  I V W  K K+++PS K   
Sbjct: 12184 KSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVP 12243

Query: 2581  EAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAI--SKPLTDQTVAESQEAV 2638
              + GK++ LT+ ++  +D G+    A +  T   L V    +  +KPL DQTV E   AV
Sbjct: 12244 RSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAV 12303

Query: 2639  FECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKT 2698
              ECEV+  ++K +W ++G  +  +      +DG  R+L+I     +DI  YT      KT
Sbjct: 12304 LECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKT 12363

Query: 2699  SAKLKV--EAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAIS 2756
             S  L V    V+  + L +L V E + A F  EL+  N K V+W K+G  ++  +KY I 
Sbjct: 12364 SCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAK-VKWFKDGAEIKKGKKYDII 12422

Query: 2757  VKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHV--ETVKIIKKPKDVTALENATVAF 2814
              KG +  L I  C + DE+ Y   +     S  L V  E     K   ++   E  T+  
Sbjct: 12423 SKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKL 12482

Query: 2815  EVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECK 2874
                VS     V W+    EI  + ++ +++E +   L++QN    DAG Y   +      
Sbjct: 12483 VCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTD 12542

Query: 2875  AKLFVETL--HITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQ 2932
              K+ V  L        +N+E+ E + A F C +S  + P  W ++   +E  +K+ ++  
Sbjct: 12543 GKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVIAD 12602

Query: 2933  GKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV-TPIMITSMLKDINAEEKDTITFEVT 2991
             GK   L++ + + +D   Y  + G  + +A LTV   + I   LKD   +E+  + F   
Sbjct: 12603 GKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEVVFNCE 12662

Query: 2992  VNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFV-----AGKAT 3046
             VN EG   KW +N   I  + K  +  K L ++L IR+ H  D A+Y             
Sbjct: 12663 VNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVK 12722

Query: 3047  STATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQ 3106
             S A L VE   +   + +KDI+ +EKK   F C+V+  ++T++W K+ +E+   +R+  +
Sbjct: 12723 SAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVSYR 12782

Query: 3107  KEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVV 3166
              +KY H L I      D G+Y V AG + S A+L +           ++  V E   AV 
Sbjct: 12783 VDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDAVF 12842

Query: 3167  EFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNR 3226
               +++ +  +  WY++G EI  +  +++K+  +  IHR+ I + R  D  EY       +
Sbjct: 12843 SCQLSREKANVKWYRNGREI--KEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRK 12900

Query: 3227  SSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3286
             S   L+V    P ++++  Q +    G    F A ++ + + ++ W +   ++  G K +
Sbjct: 12901 SRARLFVE-EIPVEIIRPPQDILEAPGADVVFLAELN-KDKVEVQWLRNNMVVVQGDKHQ 12958

Query: 3287  FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPA 3346
              + +G+ + L + +  P D   Y   AK+    A    + +   P++ + DQ++ V    
Sbjct: 12959 MMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAA---PKIKTADQDLVV---D 13012

Query: 3347  IITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEA 3406
             +  PL   V  +  P            +  W+ +++ +        T  E T    I EA
Sbjct: 13013 VGKPLTMVVPYDAYP----------KAEAEWFKENEPLSTKTI--DTTAEQT-SFRILEA 13059

Query: 3407  YPEDEGTYTFVASNAVGQVSSTANLS-LEAPESI----LHERIEQEIEMEMKELFSEGES 3461
                D+G Y  V  N  G+     NL  ++ P  +    + E  + E+ +  +E  ++G S
Sbjct: 13060 KKGDKGRYKIVLQNKHGKAEGFINLKVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGS 13119

Query: 3462  E 3462
             +
Sbjct: 13120 K 13120



 Score =  479 bits (1232), Expect = e-134
 Identities = 411/1565 (26%), Positives = 678/1565 (43%), Gaps = 97/1565 (6%)

Query: 2079  KIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVI 2138
             K    ++ QTV +G  A F V  +        W+KN  K+  S R      E    +L +
Sbjct: 11575 KFMSPLEDQTVKEGETATF-VCELSHEKMHVVWFKNDAKLHTS-RTVLISSEGKTHKLEM 11632

Query: 2139  RDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECET 2198
             ++VT +D + I  +      E SS A L V       FT +L D  A EKD + T +CE 
Sbjct: 11633 KEVTLDDISQIKAQV----KELSSTAQLKVLEADPY-FTVKLHDKTAVEKDEI-TLKCEV 11686

Query: 2199  SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTA 2258
             S+  V VKW+KDG E+    KY + +D     L I   D  D  +Y C    D   KT A
Sbjct: 11687 SKD-VPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTD---KTKA 11742

Query: 2259  KLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRR 2318
              + VE  +++  K L  +EV    +   E  +S  ++ G+W      L ++    I    
Sbjct: 11743 NVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDG 11802

Query: 2319  GRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVK 2378
              +  L + +      GE SF     K+   LK+K  P+  +  LSD KV E D  + E +
Sbjct: 11803 KKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECE 11862

Query: 2379  VSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSG 2438
             VS E     W+K  QE+   DR  ++ D   H ++I+    ED   Y F   A    TSG
Sbjct: 11863 VSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFE--AEDKHTSG 11920

Query: 2439  RVSVYSVDV--ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVK 2496
             ++ +  + +  +TPLKDV   E   AV   ++S  ++  VKW+ ND+++     V    +
Sbjct: 11921 KLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIR-VKWFKNDQRLHTTRSVSMQDE 11979

Query: 2497  GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRG-------LRDLTCTETQN 2549
             G    +        D         RVE     S  K+ ++ G       L+D T  E   
Sbjct: 11980 GKTHSITFKDLSIDDTSQI-----RVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDE 12034

Query: 2550  VVFEVELSHSGIDVLWNFKD-KEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGE 2608
             V+ + E+S +   V W FKD KEIKPS    I+A GK   L +   +K D G+YT   G 
Sbjct: 12035 VILQCEISKADAPVKW-FKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGT 12093

Query: 2609  NMTSGKLTVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIR 2666
             + TSGKL +    I   +PL    V E++ A FE E++  D    W   G+ L  T +  
Sbjct: 12094 DKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCE 12153

Query: 2667  SESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVE--AVKIKKTLKNLTVTETQDA 2724
              + +G    L++   +LD  G   ++ A  K+SA L+V+   + + + LK++TVT  + A
Sbjct: 12154 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETA 12213

Query: 2725  VFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRL 2784
              F  EL++ ++  V+W   G  LE ++K     +G +++L +++  + D           
Sbjct: 12214 TFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDF 12272

Query: 2785  GASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRL 2842
                A L V+   V+  K  +D T  E AT   E  VS +   VKWF    EI  S K+ +
Sbjct: 12273 KTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEI 12332

Query: 2843  VSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHIT--KTMKNIEVPETKTAS 2900
             V++ +V KL++ + +P D   YT      +    L V   H+   + + +++V E + A 
Sbjct: 12333 VADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMAR 12392

Query: 2901  FECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQV 2960
             FECE+S  N    W K+G EI+  +K+ I+ +G +  L+I     +D AEY+      + 
Sbjct: 12393 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 12452

Query: 2961  SATLTVTP--IMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRT 3018
             S  LTV     + T  L +I   E DTI     V+  G    W K   EI  T + ++ T
Sbjct: 12453 SGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILT 12512

Query: 3019  KKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFE 3078
             +     L I+N H  DA +Y      + +   + V     EF    +++++LE ++A F 
Sbjct: 12513 EGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFV 12572

Query: 3079  CEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTA 3138
             C +S+    VQW +DD+ L+  D+  +  +     L++    + D G Y V+ G   + A
Sbjct: 12573 CSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAA 12632

Query: 3139  KLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVV 3198
              L V  + +RI    K+ +V E+Q  V   EVN +   A W+++       + +  KY++
Sbjct: 12633 HLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRN----EEAIFDSSKYII 12687

Query: 3199  ERR--IHRMFISETRQSDAGEY----TFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQS 3252
              ++  ++ + I +    D   Y    T   G N  S    +   E  ++++ L+ +    
Sbjct: 12688 LQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETME 12747

Query: 3253  GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCE 3312
              K   F   ++ R    + W K  + +    +  +  D  ++ L + +    D   Y   
Sbjct: 12748 KKSVTFWCKVN-RLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVT 12806

Query: 3313  AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3372
             A  D  VA     L +E P                +  L+D   +E   A F C++S   
Sbjct: 12807 AGQDKSVAEL---LIIEAPT-------------EFVEHLEDQTVTEFDDAVFSCQLSREK 12850

Query: 3373  LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYT------------FVASN 3420
               V WY   ++IK  + ++  +    ++L I +   +DE  Y             FV   
Sbjct: 12851 ANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEI 12910

Query: 3421  AVGQVSSTANLSLEAPES---ILHERIEQEIEMEMKE---LFSEGESEHSERDTRDAFSD 3474
              V  +    ++ LEAP +    L E  + ++E++      +  +G+      + +     
Sbjct: 12911 PVEIIRPPQDI-LEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQ 12969

Query: 3475  SEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLE-GEPVVFTCRLIACPTP 3533
               DI  +     R+ ++     +  E       +      V++ G+P+       A P  
Sbjct: 12970 ICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKA 13029

Query: 3534  EMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTA 3593
             E  WF  N P+ T          D     +S  I   +  D G Y+++  N  G AE   
Sbjct: 13030 EAEWFKENEPLST-------KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFI 13082

Query: 3594  SLLVI 3598
             +L VI
Sbjct: 13083 NLKVI 13087



 Score =  463 bits (1191), Expect = e-129
 Identities = 625/2856 (21%), Positives = 1102/2856 (38%), Gaps = 426/2856 (14%)

Query: 942  PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM 1001
            P  ++   + + V  G+  TLE  ++G P     WY++   + +S  ++I+F++ +A+L 
Sbjct: 4016 PAKIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLK 4075

Query: 1002 IREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRD 1061
               A   DSG++T    NE G  S+SC            ETT     FT      V  RD
Sbjct: 4076 FYSAELHDSGQYTFEISNEVG--SSSC------------ETT-----FT------VLDRD 4110

Query: 1062 VVMTDTSLTEEQAGPGEPAAPYFITKPVVQ-KLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1120
            +                  AP+F TKP+     V  G+    C++ G+    V W K G 
Sbjct: 4111 I------------------APFF-TKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGK 4151

Query: 1121 PLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1180
             +    RY++++ +  G   L I     +DAG +T    N  G   +S +L+        
Sbjct: 4152 EIAASDRYRIAFVE--GTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALI-------- 4201

Query: 1181 MKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDT--VVVRT 1238
                            VQEP      P FV     K+     A+  K   + +  + +R 
Sbjct: 4202 ----------------VQEP------PSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRW 4239

Query: 1239 YVEDQEFHISSF----EERLIKEIEYRIIKTTLE-----ELLEEDGEEKMAVDISESEAV 1289
            +  ++E          +E L   +E  ++KT+       ++    G  + + ++   E  
Sbjct: 4240 FKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPA 4299

Query: 1290 ESGFDSRIKNYRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRAS 1348
               F  +++  ++L+ G      CK++G P  KI W+ + + IK   +++M F++   A 
Sbjct: 4300 T--FVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVES-TAV 4356

Query: 1349 LRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRS---- 1404
            LR+  V  ED G Y   A N  G+  CS  + V+ +     P +    +P+  ++     
Sbjct: 4357 LRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKES-----PYFTKEFKPIEVLKEYDVM 4411

Query: 1405 LSPRSVSRSPIRMSPARMSPARMSPARMSP---------------ARMSPGRRLEETDE- 1448
            L        P  ++  + +    S  +                  A  +   +   T+E 
Sbjct: 4412 LLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEV 4471

Query: 1449 ------SQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYT 1502
                  +++     P F+ K  S   L G TA F   + G       W  D  +I  D  
Sbjct: 4472 GSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDN 4531

Query: 1503 HKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKL 1562
             ++   E+   SL +        G++   A+N AG    S +L+V+           E+ 
Sbjct: 4532 IRMTF-ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE-----PATITEEA 4585

Query: 1563 KNVNIKEGSRLEMKVRATGNPNPDIVWLKNS-DIIVPHKYPKIRIEGTKGEAALKIDSTV 1621
             ++++ +G    ++V+ +G       W K+  ++ +  KY   +I  T   + LKI ST 
Sbjct: 4586 VSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKY---KISVTDTVSILKIISTE 4642

Query: 1622 SQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLH 1681
             +DS  YT    N  GR + + ++NV            LIIP                  
Sbjct: 4643 KKDSGEYTFEVQNDVGRSSCKARINV----------LDLIIP------------------ 4674

Query: 1682 LRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHD 1741
                                 P F KKL  +   +      EC +   G   + ++W  D
Sbjct: 4675 ---------------------PSFTKKLKKMDSIKGSFIDLECIVA--GSHPISIQWFKD 4711

Query: 1742 GKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLV 1801
             + + A+ + +         L+       DSG  TC ATNK G +  S  L VK+    V
Sbjct: 4712 DQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFV 4771

Query: 1802 EESQL----PEGRKGLQRIE-----------ELERMAHEGALTGVTTDQKE--------- 1837
            E+ Q     P  R  L+ +            +  +  H GA   V  D            
Sbjct: 4772 EKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAK 4831

Query: 1838 --------------------------KQKPDIVLYPEPVRVLE-GETARFRCRVTGYPQP 1870
                                      K+ P  +  P PV VL  G++  F C++TG P+ 
Sbjct: 4832 ATDSGTYICQLSNDVGTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKI 4891

Query: 1871 KVNWYLNGQLIRKSKRFRVRY-DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEI 1929
            +V+WYL+G  I   ++  + + DG+    I   +  ++G     A N  G     ++L++
Sbjct: 4892 RVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDAGTASCSIELKV 4951

Query: 1930 QQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEK 1989
            ++   F   L+                +++   +++  V  T   EV  LK         
Sbjct: 4952 KEPPTFIRELKPVEV------------VKYSDVELECEVTGTPPFEVTWLKN-------- 4991

Query: 1990 VPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEE 2049
                + E+RS  K    +     ++   L   K D S                 +  E +
Sbjct: 4992 ----NREIRSSKKYTLTD----RVSVFNLHITKCDPS-----------------DTGEYQ 5026

Query: 2050 KKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPEC 2109
                 E G  +  T    ++ L    E P   ++I++ T    S A F+  V G P    
Sbjct: 5027 CIVSNEGGSCSCST----RVALK---EPPSFIKKIENTTTVLKSSATFQSTVAGSPPISI 5079

Query: 2110 EWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ 2169
             W K+   ++  D +Y  +  D+V  L IR V    S     +A N +G    +AFLLVQ
Sbjct: 5080 TWLKDDQILDEDDNVYISFV-DSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQ 5138

Query: 2170 AKQLITFTQELQDVVAKEKDTMATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKV 2228
                I   ++ + V   EKD M T EC  +  P +KVKW KDG ++     + M  +  V
Sbjct: 5139 EPAQIV--EKAKSVDVTEKDPM-TLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNV 5195

Query: 2229 HFLSILTIDTSDAEDYSCVLVED---ENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGE 2285
                I ++   D+  Y+  +  D    +     +++ +     F K+L  ++     S  
Sbjct: 5196 ASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIH 5255

Query: 2286 LECIVSPE-NIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKK 2344
            +EC VS    I  +W+ +  E+ ++ KY +       +L V ++  ED   Y+  +    
Sbjct: 5256 MECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVA 5315

Query: 2345 --TTCK--LKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDR 2400
                C   L +K  P  +++    Q + +  +    +       +  W KD  E+    +
Sbjct: 5316 GDDACSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPK 5375

Query: 2401 VHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVIT-PLKDVNVIEG 2459
              I ++  +  L +  +     G Y+  +     +  G  S  ++ ++T P K V  +E 
Sbjct: 5376 CFIGLEGSTSFLNLYSVDASKTGQYTCHVT----NDVGSDSCTTMLLVTEPPKFVKKLEA 5431

Query: 2460 TKAV-------LECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDE 2512
            +K V       LECK++      V W+ N+ ++   D+ +     +   + +N     D 
Sbjct: 5432 SKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDS 5491

Query: 2513 GPY----KLIVGRVETNCNLSVEKIKIIRGLRDLTCT-ETQNVVFEVELSHSG-IDVLWN 2566
            G +    +   G    +  + V++  +      +  T +   V  E ELS +   +V+W 
Sbjct: 5492 GDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWY 5551

Query: 2567 FKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSG------KLTVAGG 2620
               ++++ S KYKI +      + +LN+   D G+Y   A   + S       KL     
Sbjct: 5552 KDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPR 5611

Query: 2621 AISKPLTDQTVAESQEAVFECEVANPDSKG-EWLRDGKH-LPLTNNIRSESDGHKRRLII 2678
             +SK L   TV   + A  +  +        +WL++ +  +  + NIR     +   L  
Sbjct: 5612 FVSK-LNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATLQF 5670

Query: 2679 AATKLDDIGEYTYKVATS-----KTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHP 2733
            A  +  + G+Y  ++          +  + +E   I +    +TVT  +      ++   
Sbjct: 5671 AKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVGETCTLECKVAGT 5730

Query: 2734 NVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRL----GRLGASAR 2789
                V+W K+G +L S++K+  S    I SLRI +    D   Y F++    G+   +A 
Sbjct: 5731 PELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGKSSCTAV 5790

Query: 2790 LHVETVKI----IKKPKDVTALENATVAFEVSVSHDT-VPVKWFHKSVEIKPSDKHRLVS 2844
            + V    +     ++ K+   +  A+   E  V+  + + V WFH+  +I    K++   
Sbjct: 5791 VDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTF 5850

Query: 2845 ERKVHKLMLQNISPSDAGEYTAVV----GQLECKAKLFV-ETLHITKTMKNIEVPETKTA 2899
               V  L L ++  SD G YT V     G  EC+A L V E     K  + +EV   K  
Sbjct: 5851 SDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFVKEPEPLEVLPGKNV 5910

Query: 2900 SFECEVSH---FNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCG 2956
            +F   +     F V   W +   E+   ++  I  +  + +L + N     S EYT V  
Sbjct: 5911 TFTSVIRGTPPFKVN--WFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVS 5968

Query: 2957 NDQVSATLTVT-----PIMITSMLKDINAEEKDTITFEVTVNYEG---ISYKWLKNGVEI 3008
            N+   A+ T       P      L D + E   +I  E T  Y G   IS  W K+G  I
Sbjct: 5969 NNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILEST--YTGTLPISVTWKKDGFNI 6026

Query: 3009 KSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIK 3068
             +++KC + T + T  L I N    DA  Y+                  +E    + +++
Sbjct: 6027 TTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPYFVTELE 6086

Query: 3069 VLEKK---RAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDA 3124
             LE         +C+V+  P+ITV W K D +L+ T   +      V  L+     ++D+
Sbjct: 6087 PLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDS 6146

Query: 3125 GKYTVVAGGNVSTAK----LFVEGRDVR---IRSIKKEVQVIEKQRAVVEFEVNEDDVDA 3177
            G+YT  A  ++ TA       ++ R +     R +K   Q +     +         +  
Sbjct: 6147 GEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQV 6206

Query: 3178 HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYV 3233
             WY+DG+ +      +  +V    +  + I +T  S +G+Y+  A    G   SS  L  
Sbjct: 6207 CWYRDGVLLRDDENLQTSFV--DNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTA 6264

Query: 3234 NAPEPPQVLQELQPVTVQ--SGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDG 3291
              P+      +++PV++   +G+ A F   ++G    +I+W K+ + +  G        G
Sbjct: 6265 REPKKSPFF-DIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVG 6323

Query: 3292 QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPL 3351
                L +++    D+  YTC+A ND G    SA LSV+ P             P  +  L
Sbjct: 6324 NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEP-------------PKFVKKL 6370

Query: 3352 QDT-VTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPE 3409
            + + V  +G+  + +C++SG+ ++KVSW+  D ++  S  + M+       L I EA  E
Sbjct: 6371 EASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAE 6430

Query: 3410 DEGTYTFVASNAVGQVSSTANLSLEAP----------------ESILHERIEQEIEMEMK 3453
            D G Y   A N VG  S +  L+++AP                + IL   I      E+ 
Sbjct: 6431 DSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVV 6490

Query: 3454 ELFSEGESEHSER--------DTRDAFSDSEDIDHKSMAAKRYASRISSTSSWPEYFK-- 3503
             +    +  +S++        DT     + E  D      K      S T S    FK  
Sbjct: 6491 WVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEP 6550

Query: 3504 PSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSS 3563
            P F +KL+    L G+ V     +       + W  +   +   +R           + +
Sbjct: 6551 PRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEV---IRESENTRISFIDNIA 6607

Query: 3564 SLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQ 3599
            +L++   +  +SG Y     N  G  E +A L V++
Sbjct: 6608 TLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLE 6643



 Score =  449 bits (1155), Expect = e-125
 Identities = 620/2808 (22%), Positives = 1047/2808 (37%), Gaps = 419/2808 (14%)

Query: 942  PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM 1001
            PP+    LKN   + G S  LEC ++G    +V W+ E  +I S   +Q TF   +  L 
Sbjct: 5799 PPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQ 5858

Query: 1002 IREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRD 1061
            +    + D G +TC A N AG+      L VQ                            
Sbjct: 5859 LNSLDSSDMGNYTCVAANVAGSDECRAVLTVQ---------------------------- 5890

Query: 1062 VVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVP 1121
                            EP  P F+ +P   +++ G +V F   + G P   V W +    
Sbjct: 5891 ----------------EP--PSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARE 5932

Query: 1122 LTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLM 1181
            L  G R  + +     E +L         +GEYT VV N  G+ S +  L          
Sbjct: 5933 LVKGDRCNIYFEDTVAELELF--NIDISQSGEYTCVVSNNAGQASCTTRL---------- 5980

Query: 1182 KSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVE 1241
                          FV+EP        F+    +   E  +++I +     T+ +    +
Sbjct: 5981 --------------FVKEPAA------FLKRLSDHSVEPGKSIILESTYTGTLPISVTWK 6020

Query: 1242 DQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKN-Y 1300
               F+I++ E+  I   E   I   L     + G+    ++      V     S ++  Y
Sbjct: 6021 KDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALVSTLEPPY 6080

Query: 1301 RILE--------GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIP 1352
             + E        G  V+  C+++G P   ++WYK   +++    Y+  F  +  A+L   
Sbjct: 6081 FVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNV-ATLVFN 6139

Query: 1353 VVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSR 1412
             V   D G YT  A N  G A  S K           P++   L+ + +   L      R
Sbjct: 6140 KVNINDSGEYTCKAENSIGTA--SSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCR 6197

Query: 1413 ----SPIRMSPARMSPARMSPARMSPARMSPGRRLE--ETDESQL--------------- 1451
                +PI++   R          +  + +     L+  +TD S                 
Sbjct: 6198 LNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTAS 6257

Query: 1452 --------ERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIV--NDY 1501
                    E    P F +KPVS   + G++A F+  V G       W  D ++I    +Y
Sbjct: 6258 SSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNY 6317

Query: 1502 THKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEK 1561
            T   V     T  L I+     DSG++T  A N  G+   S  L+V+       P FV+K
Sbjct: 6318 TITCV---GNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE-----PPKFVKK 6369

Query: 1562 LKNVNI-KEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDST 1620
            L+   + K+G  ++++ + +G+P   + W +N   +  H+  K  +      A L I+  
Sbjct: 6370 LEASKVAKQGESIQLECKISGSPEIKVSWFRNDSEL--HESWKYNMSFINSVALLTINEA 6427

Query: 1621 VSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPL 1680
             ++DS  Y   A N  G  +    + V+                         AP     
Sbjct: 6428 SAEDSGDYICEAHNGVGDASCSTALTVK-------------------------AP----- 6457

Query: 1681 HLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH 1740
                                  P F +K + +   +      +C ++  G P   V W+ 
Sbjct: 6458 ----------------------PVFTQKPSPVGALKGSDVILQCEIS--GTPPFEVVWVK 6493

Query: 1741 DGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSL 1800
            D K +  + + ++ ++    SL      + D G   C+ATN+ G+D  S ++        
Sbjct: 6494 DRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSV-------- 6545

Query: 1801 VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARF 1860
                                               K K+ P  V        L G+    
Sbjct: 6546 -----------------------------------KFKEPPRFVKKLSDTSTLIGDAVEL 6570

Query: 1861 RCRVTGYPQPKVNWYLN-GQLIRKSKRFRVRY-DGIHYLDIVDCKSYDTGEVKVTAENPE 1918
            R  V G+    V W  + G++IR+S+  R+ + D I  L +   ++ ++G+     +N  
Sbjct: 6571 RAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDA 6630

Query: 1919 GVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVK 1978
            G+ E    L                       V EP ++      +++P   T T     
Sbjct: 6631 GMRECSAVLT----------------------VLEPARI------IEKPEPMTVTT---- 6658

Query: 1979 LKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDEL 2038
                     E V   + EL +K+ +   E    A +   +    K  S +    +  D  
Sbjct: 6659 ---GNPFALECVVTGTPELSAKWFKDGRE--LSADSKHHITFINKVASLKIPCAEMSD-- 6711

Query: 2039 LHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFR 2098
                K L   E K    +   T+     D+I        P    +++      G+     
Sbjct: 6712 ----KGLYSFEVKNSVGKSNCTVSVHVSDRIV------PPSFIRKLKDVNAILGASVVLE 6761

Query: 2099 VRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2158
             RV G       W+++G +I    +    + E NVC L +  +   D+      A N+AG
Sbjct: 6762 CRVSGSAPISVGWFQDGNEIVSGPKCQSSFSE-NVCTLNLSLLEPSDTGIYTCVAANVAG 6820

Query: 2159 ETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGD 2218
                 A L VQ       T +  +V+     T  T     + PF KVKW+K   E+  G+
Sbjct: 6821 SDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTF-TSVIRGTPPF-KVKWFKGSRELVPGE 6878

Query: 2219 KYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEV 2278
               +  +  V  L +  +   ++ DYSC++  D    +    +       FVK L D  V
Sbjct: 6879 SCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSV 6938

Query: 2279 PESYSGELECIVS-PENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYS 2337
                   LE   +    I   W  ++  +  + + +IT       L + + T ED  +YS
Sbjct: 6939 ETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYS 6998

Query: 2338 FVIDGK--KTTCKLKMKP-RPIAILQGLSDQKVCEGDIVQLEVKVS-LESVEGVWMKDGQ 2393
             +I+ +  +  C+  +    P   ++ L   +   G+   L+ KV     +   W K+  
Sbjct: 6999 CLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHT 7058

Query: 2394 EVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIP-ALGLSTSGRVSVYSVDVITP-- 2450
            +++ +    +        L+I  +   D G YS     ++G   S  V V     + P  
Sbjct: 7059 KLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFF 7118

Query: 2451 ---LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRT 2507
               LKDV+   G     EC+++  +   V WY +   +K D  +Q         L I +T
Sbjct: 7119 ARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQT 7178

Query: 2508 HASDEGPY---------------KLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVF 2552
              S  G Y               KLI+   E      ++ + +     DL   E+     
Sbjct: 7179 DQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSV-----DLALGESGTFKC 7233

Query: 2553 EVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA----GE 2608
             V    + I + W   ++EI+P   YK+        LTVL + K D G+YT YA    G+
Sbjct: 7234 HVT-GTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGK 7292

Query: 2609 NMTSGKLTVAGGA--ISKPLTDQTVAESQEAVFECEVA-NPDSKGEWLRDGKHLPLTNNI 2665
            +  S +L V      I K    + V + +   +EC++  +P+ K  W +D   +  ++  
Sbjct: 7293 DSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKF 7352

Query: 2666 RSESDGHKRRLIIAATKLDDIGEYTYKV------ATSKTSAKLKVEAVKIKKTLKNLTVT 2719
            R         L +    ++D G+YT +       A+S TS K+K   +  KK    +   
Sbjct: 7353 RMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKP-HPIETL 7411

Query: 2720 ETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGF 2779
            +  D     EL       V W K+   L S +KY I  +  + S+ I N    D   Y  
Sbjct: 7412 KGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQC 7471

Query: 2780 RLGR-LGASARLHVETVK----IIKKPKDVTALENATVAFEVSVSH-DTVPVKWFHKSVE 2833
            +    +G+   +    +K     +KK  D++ +    V  + ++   + + V WF    E
Sbjct: 7472 KATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGE 7531

Query: 2834 I-KPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVV----GQLECKAKLFV-ETLHITKT 2887
            I + SD   +     +  L    + P++AG+YT  +    G  EC A L V E   I + 
Sbjct: 7532 IVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEK 7591

Query: 2888 MKNIEVPETKTASFECEVSHF-NVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTE 2946
             ++I+V    T + EC V+    + + W K+G E+    K+KI    K+  L I+N +  
Sbjct: 7592 PESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPS 7651

Query: 2947 DSAEYTFVC----GNDQVSATLTVT----PIMITSMLKDINAEEKDTITFEVTV-NYEGI 2997
            DS  Y+F      G D  +A+L V+    P   T  LK+ N     ++  E  V     I
Sbjct: 7652 DSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPI 7711

Query: 2998 SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA----GKATSTATLYV 3053
            S  W   G EI S  K Q      T +L +  +   D+ DYT +A    G    +A L V
Sbjct: 7712 SVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTV 7771

Query: 3054 EARHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVH 3112
                  F +    + VL      F   V   P  +V W K   EL   DR  +  E  V 
Sbjct: 7772 REPP-SFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVA 7830

Query: 3113 RLLIPSTRMSDAGKYTVV----AGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVV-- 3166
             L +     S +G+YT +    AG    T  L+++     ++ +      IEK + ++  
Sbjct: 7831 ELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLND--YSIEKGKPLILE 7888

Query: 3167 EFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA--GR 3224
                    +   W K+GI  N    +R       +   + I  +   DAG+Y        
Sbjct: 7889 GTFTGTPPISVTWKKNGI--NVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENAS 7946

Query: 3225 NRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFK 3284
             + S +  +   EPP  +++L+PV V  G  A     ++G P+  +SWYK +  L     
Sbjct: 7947 GKDSCSAQILILEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTT 8006

Query: 3285 CKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3344
             K        TL+  +    D+  Y C+A+N  G  + S  L+V+  ++          P
Sbjct: 8007 YKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKL----------P 8056

Query: 3345 PAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403
            P+    L+D   + G P  F C +SG++ + VSWY   K +K S   + +  ++T  L I
Sbjct: 8057 PSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNI 8116

Query: 3404 AEAYPEDEGTYTFVASNAVGQVSSTANLSLE------------AP-ESILHERIEQEIEM 3450
             +      G Y+  A+N +G  SS+A L L             AP ++++ E  + E  +
Sbjct: 8117 FKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHV 8176

Query: 3451 ------------EMKELFSEGESEHSERDTRDAFS----DSEDIDHKSMAAKRYASRISS 3494
                        + +E+ S G+ + S  +     +    D  D    +  A     + S 
Sbjct: 8177 TGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSC 8236

Query: 3495 TSSW---PEYFKPSFTQKLTFKY-VLEGEPVVFTCRLIACPTPEMTWFHNNRPI-PTGLR 3549
            T+          PSFT++L+      EG       R+       + W+ NN  I PT   
Sbjct: 8237 TAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTS-- 8294

Query: 3550 RIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLV 3597
                 E    +++  L++++    D+G Y     N  GSA  T+S+++
Sbjct: 8295 ---NCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVI 8339



 Score =  437 bits (1124), Expect = e-121
 Identities = 657/2953 (22%), Positives = 1105/2953 (37%), Gaps = 431/2953 (14%)

Query: 906  ITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECH 965
            I+G  V      V   R    T +  +   V+    PPT +  LK V V++   V LEC 
Sbjct: 4921 ISGARVENSGTYVCEARNDAGTASCSIELKVK---EPPTFIRELKPVEVVKYSDVELECE 4977

Query: 966  ISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVS 1025
            ++G P   VTW + + +I SS  + +T +  +  L I +    D+G + C   NE G+ S
Sbjct: 4978 VTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEGGSCS 5037

Query: 1026 TSCYLAVQVSEEFEKE---TTAVTEKFTTEEKRFVESRDVVMT----DTSLTEE------ 1072
             S  +A++    F K+   TT V +   T +     S  + +T    D  L E+      
Sbjct: 5038 CSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYIS 5097

Query: 1073 ---------------------------QAGPGEPAAPYFITKP--VVQK-----LVEGGS 1098
                                       ++G     A   + +P  +V+K     + E   
Sbjct: 5098 FVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQIVEKAKSVDVTEKDP 5157

Query: 1099 VVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVV 1158
            +   C V G P+  V W K G  +     + +S+       +  I      D+G+YT  V
Sbjct: 5158 MTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFR--IQSVMKQDSGQYTFKV 5215

Query: 1159 RNKHGETSASASLLEEADYELLMKSQQEMLYQTQV--TAFVQEPKVGETAPGFVYSEYEK 1216
             N  G +S  A  L   D  +     +++    +V  ++   E KV  + P         
Sbjct: 5216 ENDFGSSSCDA-YLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLP--------- 5265

Query: 1217 EYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLE---ELLEE 1273
                    I  +  KD   + T     ++ +   E  +  E+    ++ T     ++   
Sbjct: 5266 --------ISAQWFKDGKEIST---SAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNV 5314

Query: 1274 DGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKH 1333
             G++  +  ++  E     F  +    + +    V F   + G P  KI W+KD   +  
Sbjct: 5315 AGDDACSGILTVKEP--PSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVS 5372

Query: 1334 GERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV-EPAAPLGAPTY 1392
            G +  +  L+   + L +  V     G YT   +N  G+  C+  L V EP      P +
Sbjct: 5373 GPKCFIG-LEGSTSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEP------PKF 5425

Query: 1393 IPTLEPVSRIRSLSPRSVSRSPIRMSPA---------RMSPA----RM----SPARMSPA 1435
            +  LE  S+I      S     I  SP             PA    RM    S A +   
Sbjct: 5426 VKKLE-ASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMN 5484

Query: 1436 RMSPGRRLEETDESQ---------LERLYK--PVFVLKPVSFKCLEGQTARFDLKVVGRP 1484
             +S     +   E+Q          + + K  PVF   P   + L+      + ++ G P
Sbjct: 5485 NLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLECELSGTP 5544

Query: 1485 MPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVI 1544
              E  W+ D +Q+ +   +K+  K   T S+ I+    SD GE+   AQN  G  S + +
Sbjct: 5545 PFEVVWYKDKRQLRSSKKYKIASKNFHT-SIHILNVDTSDIGEYHCKAQNEVG--SDTCV 5601

Query: 1545 LTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKI 1604
             TV+  E    P FV KL ++ +  G   E++    G     + WLK  + ++  +   I
Sbjct: 5602 CTVKLKE---PPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVI-RESENI 5657

Query: 1605 RIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPR 1664
            RI   +  A L+       ++  Y     N  G       + V       E    + +  
Sbjct: 5658 RITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTV 5717

Query: 1665 G---TYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRL------- 1714
            G   T   K    PEL         E +++G L    ++ K  F  K++SLR+       
Sbjct: 5718 GETCTLECKVAGTPELSV-------EWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQD 5770

Query: 1715 ------------------------KRFGPAHF-----------------ECRLTPIGDPT 1733
                                     R  P  F                 EC++   G   
Sbjct: 5771 AGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVA--GSSP 5828

Query: 1734 MVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLI 1793
            + V W H+   + +  + +       C+L      S D G  TC A N  G+D   A L 
Sbjct: 5829 ISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT 5888

Query: 1794 VKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVL 1853
            V++  S V+E                                           PEP+ VL
Sbjct: 5889 VQEPPSFVKE-------------------------------------------PEPLEVL 5905

Query: 1854 EGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY-DGIHYLDIVDCKSYDTGEVKV 1912
             G+   F   + G P  KVNW+   + + K  R  + + D +  L++ +     +GE   
Sbjct: 5906 PGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTC 5965

Query: 1913 TAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGK--LQFEVQKVDRPVDT 1970
               N  G      +L +++   F   L+R  +     H  EPGK  +         P+  
Sbjct: 5966 VVSNNAGQASCTTRLFVKEPAAF---LKRLSD-----HSVEPGKSIILESTYTGTLPISV 6017

Query: 1971 TETKEVVKLKRAER---ITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESY 2027
            T  K+   +  +E+   +T EK                                      
Sbjct: 6018 TWKKDGFNITTSEKCNIVTTEKT-----------------------------------CI 6042

Query: 2028 EELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQ 2087
             E+L  TK +   ++ E+  E  + +                 L  ++E P     ++  
Sbjct: 6043 LEILNSTKRDAGQYSCEIENEAGRDVCGA--------------LVSTLEPPYFVTELEPL 6088

Query: 2088 TVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSA 2147
                G     + +V G P+    WYK   K+  +     Y+  +NV  LV   V   DS 
Sbjct: 6089 EAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYF-TNNVATLVFNKVNINDSG 6147

Query: 2148 SIMVKAINIAGETSSHAFLLVQAKQL-ITFTQELQDVVAKEKDTMATFECET--SEPFVK 2204
                KA N  G  SS     +Q +QL  +F ++L+D + +      T  C    S P ++
Sbjct: 6148 EYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKD-IEQTVGLPVTLTCRLNGSAP-IQ 6205

Query: 2205 VKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSC-----VLVEDENVKTTAK 2259
            V WY+DG+ + + +  +      V  L IL  D S +  YSC     +     + + TA+
Sbjct: 6206 VCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAR 6265

Query: 2260 LIVEGAVVEFVKELQDIEVPESYSGELEC-IVSPENIEGKWYHNDVELKSNGKYTITSRR 2318
               +    + +K +  I+V    S + EC +   + +   W  ++ E++  G YTIT   
Sbjct: 6266 EPKKSPFFD-IKPV-SIDVIAGESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVG 6323

Query: 2319 GRQNLTVKDVTKEDQGEYS--FVIDGKKTTCKLKMKPR-PIAILQGLSDQKVC-EGDIVQ 2374
               +L +  V K D G+Y+     D  K  C  ++  + P   ++ L   KV  +G+ +Q
Sbjct: 6324 NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAKQGESIQ 6383

Query: 2375 LEVKVS-LESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFT----I 2429
            LE K+S    ++  W ++  E+  S + ++       +L I + + ED+G+Y       +
Sbjct: 6384 LECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGV 6443

Query: 2430 PALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDD 2489
                 ST+  V    V    P   V  ++G+  +L+C++S      V W  + +Q++   
Sbjct: 6444 GDASCSTALTVKAPPVFTQKP-SPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSK 6502

Query: 2490 RVQAIVKGTKQRLVINRTHASDEGPY--KLIVGRVETNCNLSVEKIKIIRGLRDLTCTET 2547
            + +   K     L I    ASD G Y  K         C+ SV+  +  R ++ L+ T T
Sbjct: 6503 KFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTST 6562

Query: 2548 QNVVFEVEL-----SHSGIDVLWNFKDK--EIKPSSKYKIEAHGKIYKLTVLNMMKDDEG 2600
              +   VEL         I V+W  KD+   I+ S   +I     I  L + +    + G
Sbjct: 6563 L-IGDAVELRAIVEGFQPISVVW-LKDRGEVIRESENTRISFIDNIATLQLGSPEASNSG 6620

Query: 2601 KYTFY----AGENMTSGKLTVAGGA--ISKPLTDQTVAESQEAVFECEV-ANPDSKGEWL 2653
            KY       AG    S  LTV   A  I KP    TV        EC V   P+   +W 
Sbjct: 6621 KYICQIKNDAGMRECSAVLTVLEPARIIEKP-EPMTVTTGNPFALECVVTGTPELSAKWF 6679

Query: 2654 RDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATS--KTSAKLKVEA----- 2706
            +DG+ L   +            L I   ++ D G Y+++V  S  K++  + V       
Sbjct: 6680 KDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIV 6739

Query: 2707 -VKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLR 2765
                 + LK++        V    ++      V W ++G  + S  K   S    + +L 
Sbjct: 6740 PPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLN 6799

Query: 2766 IKNCAIVDESVYGFRLGRLGASARLHV-----ETVKIIKKPKDVTALENATVAFEVSVSH 2820
            +      D  +Y      +  S          E     + P  V  L   ++ F  SV  
Sbjct: 6800 LSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTF-TSVIR 6858

Query: 2821 DTVP--VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVV----GQLECK 2874
             T P  VKWF  S E+ P +   +  E  V +L L  + P ++G+Y+ +V    G   C 
Sbjct: 6859 GTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCT 6918

Query: 2875 AKLFV-ETLHITKTMKNIEVPETKTASFECEVSHFNVPSM---WLKNGVEIEMSEKFKIV 2930
              LFV E     K + +  V ET  +    E ++   P +   W+K+   I  SE+  I 
Sbjct: 6919 THLFVKEPATFVKRLADFSV-ET-GSPIVLEATYTGTPPISVSWIKDEYLISQSERCSIT 6976

Query: 2931 VQGKLHQLIIMNTSTEDSAEYTFV----CGNDQVSATLTV-TPIMITSMLKDINAEEKDT 2985
            +  K   L I+ ++ ED A+Y+ +     G D   A ++V  P      L+ + A   + 
Sbjct: 6977 MTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEP 7036

Query: 2986 ITFEVTVN-YEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA-- 3042
             T +  V+    I   W K   +++S    +M+ K    SL I  V   D  +Y+  A  
Sbjct: 7037 ATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADN 7096

Query: 3043 --GKATSTATLYVEARHIE--FRKHIKDIKVLEKKRAMFECEV--SEPDITVQWMKDDQE 3096
              G   S+A L ++AR +   F + +KD+         FEC +  SEP + V W KD   
Sbjct: 7097 SVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEP-LQVSWYKDGVL 7155

Query: 3097 LQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKLFVEGRDVRIRSI 3152
            L+    ++      V  L I  T  S  G+Y   A    G   S+AKL +   +V     
Sbjct: 7156 LKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFD 7215

Query: 3153 KKEVQV---IEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISE 3209
             K V V   + +             +   W KD  EI  +    +K  +      + + +
Sbjct: 7216 LKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREI--RPGGNYKMTLVENTATLTVLK 7273

Query: 3210 TRQSDAGEYTFVAGR--NRSSVTLYVNAPEPPQVLQELQPV-TVQSGKPARFCAVISGRP 3266
              + DAG+YT  A     + S +  +   EPP+ +++L+P   V+  +  R+   I G P
Sbjct: 7274 VGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSP 7333

Query: 3267 QPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASL 3326
            + K+ WYK+E  +    K +         L +     ED+  YTCEA N  G A++S SL
Sbjct: 7334 EIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSL 7393

Query: 3327 SVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKIK 3385
             V+ P +                P++   T +G     +C + GT    VSWY   ++++
Sbjct: 7394 KVKEPPIFRKKPH----------PIE---TLKGADVHLECELQGTPPFHVSWYKDKRELR 7440

Query: 3386 PSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAP--------- 3436
              + +++        + I      D G Y   A+N VG  +   +++L+AP         
Sbjct: 7441 SGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSD 7500

Query: 3437 -ESILHERIEQEIEMEMKELFS----EGESEHSERDTRDAFSDSEDIDHKSMA------A 3485
              +++ + ++ +  +E  E  S    + + E          S SE+I     +      A
Sbjct: 7501 ISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANA 7560

Query: 3486 KRYASRISSTSSWPEYF-------KPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWF 3538
             +Y  +I + +   E F         +  +K     V  G+     C +   P     WF
Sbjct: 7561 GKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWF 7620

Query: 3539 HNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVI 3598
             + + + +      K +    +  S L+I  V   DSG Y     N  G    TASL V 
Sbjct: 7621 KDGKELTSD----NKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVS 7676

Query: 3599 QKGQDEKYLEFLK 3611
             +     +   LK
Sbjct: 7677 DRTVPPSFTRKLK 7689



 Score =  436 bits (1120), Expect = e-121
 Identities = 346/1293 (26%), Positives = 583/1293 (45%), Gaps = 65/1293 (5%)

Query: 2174  ITFTQELQDVVAKEKD---TMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF 2230
             + F +E++D++  E +   + A FEC  S       W KDG  + E  K+R  +D K   
Sbjct: 11115 LKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRK 11174

Query: 2231  LSILTIDTSDAEDYSCVLVEDENVKT-TAKLIVEGAVVEFVKEL-QDIEVPESYSGELEC 2288
             L I+ +  SDA +Y+CVL      KT TAKL+VE   V FVK L +++ V +     L C
Sbjct: 11175 LHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSC 11234

Query: 2289  IVSPENIEGKWYHNDVELKSNGKYTITSRRGR---------QNLTVKDVTKEDQGEYSFV 2339
              ++ E         DV  + +GK  +  + GR         + LT+ D    D G Y+  
Sbjct: 11235 ELNKE--------RDVVWRKDGK-IVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVT 11285

Query: 2340  IDGKK----TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEV 2395
             ++       ++C   ++     +++ + DQ V           ++ ++    W K   E+
Sbjct: 11286 VENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEI 11345

Query: 2396  --QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKD 2453
               +P+D+  I+ D     L I++   ED   Y+  I          +    V+++ P++D
Sbjct: 11346 PAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLTLGEREVELLKPIED 11405

Query: 2454  VNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEG 2513
             V + E   A  + ++S  D+   +W L  E ++P    +   +G K+ L +++      G
Sbjct: 11406 VTIYEKESASFDAEISEADIPG-QWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQAG 11464

Query: 2514  PYKLIVGRVETNCNLSVEKIKI--IRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKE 2571
                       T   L+V++I++     L+D+T  E +   FE  L+    +V+W+     
Sbjct: 11465 EVLYQALNAITTAILTVKEIELDFAVPLKDVTVPERRQARFECVLTREA-NVIWSKGPDI 11523

Query: 2572  IKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPLTDQ 2629
             IK S K+ I A GK + L + +   DDEG YT       TS +L V G  +    PL DQ
Sbjct: 11524 IKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQ 11583

Query: 2630  TVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEY 2689
             TV E + A F CE+++      W ++   L  +  +   S+G   +L +    LDDI + 
Sbjct: 11584 TVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQI 11643

Query: 2690  TYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLES 2749
               +V    ++A+LKV       T+K    T  +    T++        V+W K+G  +  
Sbjct: 11644 KAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVP 11703

Query: 2750  NEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVET--VKIIKKPKDVTAL 2807
             + KY+I   G    L+IK   + D+  Y    G     A + VE   +K+ K    V   
Sbjct: 11704 SPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVF 11763

Query: 2808  ENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAV 2867
                T  FE+ +S   V  +W  K   +  S    ++ + K H L+L N      GE +  
Sbjct: 11764 VGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQ 11823

Query: 2868  VGQLECKAKLFVETLHI--TKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSE 2925
                 +  A L V+ L +     + +++V E   A FECEVS       WLK   EI   +
Sbjct: 11824 AANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDD 11883

Query: 2926  KFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSM--LKDINAEEK 2983
             +F+++  G  H ++I + + ED A+Y F   +   S  L +  I +  +  LKD+ A+EK
Sbjct: 11884 RFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEK 11943

Query: 2984  DTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAG 3043
             ++  F V ++++ I  KW KN   + +T    M+ +  THS+  +++   D +     A 
Sbjct: 11944 ESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAM 12003

Query: 3044  KATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRI 3103
               +S A L V      F   ++D   +EK   + +CE+S+ D  V+W KD +E++ +   
Sbjct: 12004 GMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKNA 12063

Query: 3104  KIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3163
              I+ +     L++     SD G+YT   G + ++ KL +E R++++      V+V+E + 
Sbjct: 12064 VIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETET 12123

Query: 3164  AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3223
             A  E E++EDD+ A+W   G E   Q  +  +   E +IH + +   R    G   F A 
Sbjct: 12124 ARFETEISEDDIHANWKLKG-EALLQTPD-CEIKEEGKIHSLVLHNCRLDQTGGVDFQAA 12181

Query: 3224  RNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3283
               +SS  L V  P    +L+ L+ VTV +G+ A F   +S    P + WY + + L    
Sbjct: 12182 NVKSSAHLRVK-PRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSD 12239

Query: 3284  KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVY 3343
             K     +G+ +TL L +   EDA      AK+      T A+L V+ P            
Sbjct: 12240 KVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD----FKTHANLFVKEP------------ 12283

Query: 3344  PPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403
             P     PL+D    EG  A  +C VS  + KV W+    +I  S+ + +       +L I
Sbjct: 12284 PVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVI 12343

Query: 3404  AEAYPEDEGTYTFVASNAVGQVSSTANLSLEAP 3436
              +  PED  TYT  A +      ++ NL++  P
Sbjct: 12344 HDCTPEDIKTYTCDAKD----FKTSCNLNVVPP 12372



 Score =  434 bits (1116), Expect = e-120
 Identities = 600/2810 (21%), Positives = 1033/2810 (36%), Gaps = 400/2810 (14%)

Query: 942  PPTLVSGLKNVTVIE-GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 1000
            PP  V  L+   +++ G+S  LEC I+G P   V W+R ++++ +S  +++TF   +A +
Sbjct: 5422 PPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVI 5481

Query: 1001 MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1060
             +     EDSG F C A N AG  STSC   V V E                        
Sbjct: 5482 QMNNLSTEDSGDFICEAQNPAG--STSCSTKVIVKEP----------------------- 5516

Query: 1061 DVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1120
                                 P F + P + + ++   V   C++ G P   V W K   
Sbjct: 5517 ---------------------PVFSSFPPIVETLKNAEVSLECELSGTPPFEVVWYKDKR 5555

Query: 1121 PLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELL 1180
             L +  +YK++   +     + I      D GEY    +N+ G  +   ++  +     +
Sbjct: 5556 QLRSSKKYKIA--SKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLKEPPRFV 5613

Query: 1181 MKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYV 1240
             K          +T    EP           +E +   E  Q +  + + +   V+R   
Sbjct: 5614 SKLNS-------LTVVAGEP-----------AELQASIEGAQPIFVQWLKEKEEVIRESE 5655

Query: 1241 EDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDG-EEKMAVDISESEAVESGFDSRIKN 1299
              +   + +       + E       + ++  + G  E MA  +    AV      +   
Sbjct: 5656 NIRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAV---IVEKAGP 5712

Query: 1300 YRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDE 1359
              +  G   T  CK++G P   + WYKDGK +   ++++  F     +SLRI  V  +D 
Sbjct: 5713 MTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNK-ISSLRILSVERQDA 5771

Query: 1360 GIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRS----LSPRSVSRSPI 1415
            G YT    N  G + C+  + V   A    P++   L+    +      L  +    SPI
Sbjct: 5772 GTYTFQVQNNVGKSSCTAVVDVSDRAV--PPSFTRRLKNTGGVLGASCILECKVAGSSPI 5829

Query: 1416 RMSPARMSPARMSPARMSPARMSP--GRRLEETDESQLERLY------------------ 1455
             ++        +S A+            +L   D S +                      
Sbjct: 5830 SVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTV 5889

Query: 1456 --KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ 1513
               P FV +P   + L G+   F   + G P  +  WF   +++V      +   ED   
Sbjct: 5890 QEPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYF-EDTVA 5948

Query: 1514 SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRL 1573
             L +     S SGE+T V  N AG++S +  L V+         F+++L + +++ G  +
Sbjct: 5949 ELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKE-----PAAFLKRLSDHSVEPGKSI 6003

Query: 1574 EMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAI 1633
             ++   TG     + W K+   I   +  K  I  T+    L+I ++  +D+  Y+    
Sbjct: 6004 ILESTYTGTLPISVTWKKDGFNITTSE--KCNIVTTEKTCILEILNSTKRDAGQYSCEIE 6061

Query: 1634 NKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGD 1693
            N+AGRD     V+                              LEP              
Sbjct: 6062 NEAGRDVCGALVST-----------------------------LEP-------------- 6078

Query: 1694 LYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRM 1753
                     P+F  +L  L          +C++   G P + V W      L      R 
Sbjct: 6079 ---------PYFVTELEPLEAAVGDSVSLQCQVA--GTPEITVSWYKGDTKLRPTPEYRT 6127

Query: 1754 INEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGL 1813
                   +L +      DSG  TC+A N  GT  +            ++E QLP      
Sbjct: 6128 YFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVF-------RIQERQLP------ 6174

Query: 1814 QRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVN 1873
                                       P      + +    G      CR+ G    +V 
Sbjct: 6175 ---------------------------PSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVC 6207

Query: 1874 WYLNGQLIRKSKRFRVRY-DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQR 1932
            WY +G L+R  +  +  + D +  L I+      +G+   +A NP G      +L     
Sbjct: 6208 WYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTA--- 6264

Query: 1933 EDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPE 1992
                    R P+  P F +              +PV      +V+  + A+   H    +
Sbjct: 6265 --------REPKKSPFFDI--------------KPVSI----DVIAGESADFECHVTGAQ 6298

Query: 1993 ESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKA 2052
                  SK  +    G    IT V       +  +  +L+  K +   +T + T +  K 
Sbjct: 6299 PMRITWSKDNKEIRPGGNYTITCVG------NTPHLRILKVGKGDSGQYTCQATNDVGKD 6352

Query: 2053 LAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVG-QGSDAHFRVRVVGKPDPECEW 2111
            +                +LS   E PK  +++++  V  QG       ++ G P+ +  W
Sbjct: 6353 MCSA-------------QLSVK-EPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSW 6398

Query: 2112 YKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2171
            ++N  ++  S +    +  ++V  L I + +AEDS   + +A N  G+ S    L V+A 
Sbjct: 6399 FRNDSELHESWKYNMSFI-NSVALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKAP 6457

Query: 2172 QLITFTQELQDVVA-KEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHF 2230
             +  FTQ+   V A K  D +   E   + PF +V W KD  +V    K+++ S      
Sbjct: 6458 PV--FTQKPSPVGALKGSDVILQCEISGTPPF-EVVWVKDRKQVRNSKKFKITSKHFDTS 6514

Query: 2231 LSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIV 2290
            L IL ++ SD  +Y C    +    T +  +       FVK+L D       + EL  IV
Sbjct: 6515 LHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRAIV 6574

Query: 2291 SPENIEGKWYHNDVELKSNGKYTITSRRGR-------QNLTVKDVTKEDQGEYSFVID-- 2341
                 EG    + V LK  G+    S   R         L +      + G+Y   I   
Sbjct: 6575 -----EGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKND 6629

Query: 2342 -GKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVS-LESVEGVWMKDGQEVQPSD 2399
             G +    +     P  I++      V  G+   LE  V+    +   W KDG+E+    
Sbjct: 6630 AGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADS 6689

Query: 2400 RVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITP------LKD 2453
            + HI    +   L I      D G YSF +      ++  VSV+  D I P      LKD
Sbjct: 6690 KHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKD 6749

Query: 2454 VNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEG 2513
            VN I G   VLEC+VS     SV W+ +  +I    + Q+        L ++    SD G
Sbjct: 6750 VNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTG 6809

Query: 2514 PYKLIVGRV----ETNCNLSVEK----------IKIIRGLRDLTCTETQNVVFEVELSHS 2559
             Y  +   V    E +  L+V++          ++++ G+  LT T        V     
Sbjct: 6810 IYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGM-SLTFTS-------VIRGTP 6861

Query: 2560 GIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTV-- 2617
               V W    +E+ P     I     + +L +  +   + G Y+     +  S   T   
Sbjct: 6862 PFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHL 6921

Query: 2618 ---AGGAISKPLTDQTVAESQEAVFECE-VANPDSKGEWLRDGKHLPLTNNIRSESDGHK 2673
                     K L D +V      V E      P     W++D   +  +           
Sbjct: 6922 FVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKS 6981

Query: 2674 RRLIIAATKLDDIGEYTYKVATSK----TSAKLKV-EAVKIKKTLKNLTVTETQDAVFTV 2728
              L I  + ++D  +Y+  +          A + V E     + L+++     + A    
Sbjct: 6982 TILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQC 7041

Query: 2729 ELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFR----LGRL 2784
            ++       + W K    L S   Y +  K  + SL I      D   Y  +    +G +
Sbjct: 7042 KVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAV 7101

Query: 2785 GASARLHVETVKI----IKKPKDVTALENATVAFEVSVS-HDTVPVKWFHKSVEIKPSDK 2839
             +SA L ++  K+     +K KDV       VAFE  ++  + + V W+   V +K    
Sbjct: 7102 ASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDAN 7161

Query: 2840 HRLVSERKVHKLMLQNISPSDAGEYTAV----VGQLECKAKLFVETLHITKTMK----NI 2891
             +      V  L +     S  G+Y       +G     AKL +    +         ++
Sbjct: 7162 LQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSV 7221

Query: 2892 EVPETKTASFECEVSHFN-VPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAE 2950
            ++   ++ +F+C V+    +   W K+  EI     +K+ +      L ++     D+ +
Sbjct: 7222 DLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQ 7281

Query: 2951 YTF----VCGNDQVSATLTVT-PIMITSMLKDINAEEKDTIT-FEVTVNYEG-ISYKWLK 3003
            YT     + G D  SA L V  P      L+     ++D  T +E  +     I   W K
Sbjct: 7282 YTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYK 7341

Query: 3004 NGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTF----VAGKATSTATLYVEARHIE 3059
            +  EI+ + K +M        L + N+   D+ DYT      AG A+S+ +L V+   I 
Sbjct: 7342 DETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPI- 7400

Query: 3060 FRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPS 3118
            FRK    I+ L+      ECE+   P   V W KD +EL+   + KI  E ++  + I +
Sbjct: 7401 FRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILN 7460

Query: 3119 TRMSDAGKYTVVA----GGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDD 3174
               +D G+Y   A    G +     + ++     ++ +     V+ K+  +       + 
Sbjct: 7461 VDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEP 7520

Query: 3175 VDAHWYKDGIEINFQVQERHKYVVE--RRIHRMFISETRQSDAGEYTFV----AGRNRSS 3228
            +   W+KD  EI   V+E     +     I  +  S    ++AG+YT      AG     
Sbjct: 7521 ISVVWFKDKGEI---VRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECF 7577

Query: 3229 VTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFL 3288
             TL V   EP  ++++ + + V +G        ++G P+    W+K+ + L++  K K  
Sbjct: 7578 ATLSVL--EPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKIS 7635

Query: 3289 HDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAII 3348
               +   L +I   P D+ VY+ E +N  G  + +ASL V    V          PP+  
Sbjct: 7636 FFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTV----------PPSFT 7685

Query: 3349 TPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAY 3407
              L++T    G     +C+V G+  + VSW+ +  +I   R ++ T  ++T  L +    
Sbjct: 7686 RKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLE 7745

Query: 3408 PEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFS---------- 3457
              D G YT +A+N  G    +A L++  P S + +    ++       F+          
Sbjct: 7746 ESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFS 7805

Query: 3458 ----EGESEHSERDT-----RDAFSDSEDIDHKSMAAKRYASRISSTSSWPE-----YFK 3503
                +G SE    D       D+ ++ E  D  +  +  Y   +S+ +         Y K
Sbjct: 7806 VSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIK 7865

Query: 3504 P--SFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHH 3561
                F ++L    + +G+P++        P   +TW  N   +    R  I         
Sbjct: 7866 APAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEK---- 7921

Query: 3562 SSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLK 3611
            S+ LEI      D+G Y     N+ G    +A +L+++     K LE +K
Sbjct: 7922 SAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVK 7971



 Score =  433 bits (1114), Expect = e-120
 Identities = 716/3329 (21%), Positives = 1227/3329 (36%), Gaps = 505/3329 (15%)

Query: 942  PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM 1001
            PP+ V   + + V+ G++VT    I G P   V W+R   ++       I F+  +A L 
Sbjct: 5892 PPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELE 5951

Query: 1002 IREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETT------------------ 1043
            +       SG +TC   N AG  S +  L V+    F K  +                  
Sbjct: 5952 LFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTG 6011

Query: 1044 ----AVTEK--------------FTTEEKRFVESRDVVMTDTSL----TEEQAGPGEPAA 1081
                +VT K               TTE+   +E  +    D        E +AG     A
Sbjct: 6012 TLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGA 6071

Query: 1082 -------PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNK 1134
                   PYF+T+    +   G SV   CQV G P+  V W K    L     Y+  +  
Sbjct: 6072 LVSTLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTN 6131

Query: 1135 QTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL-LEEADYELLMKSQQEMLYQTQV 1193
                  LV +    +D+GEYT    N  G  S+     ++E         Q + + QT  
Sbjct: 6132 NVAT--LVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVG 6189

Query: 1194 TAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEER 1253
                   ++  +AP                 I+    +D V++R    D E   +SF + 
Sbjct: 6190 LPVTLTCRLNGSAP-----------------IQVCWYRDGVLLR----DDENLQTSFVDN 6228

Query: 1254 LIKEIEYRIIKTTLEELLEED-------GEEKMAVDISESEAVESGF-DSRIKNYRILEG 1305
            +      +I++T L    +         G    +  ++  E  +S F D +  +  ++ G
Sbjct: 6229 VAT---LKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAG 6285

Query: 1306 MGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAF 1365
                F C ++G    +I W KD K I+ G  Y +  + +    LRI  V   D G YT  
Sbjct: 6286 ESADFECHVTGAQPMRITWSKDNKEIRPGGNYTITCVGN-TPHLRILKVGKGDSGQYTCQ 6344

Query: 1366 ASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPR-----SVSRSP------ 1414
            A+N  G  +CS +L V+       P ++  LE  S++            +S SP      
Sbjct: 6345 ATNDVGKDMCSAQLSVKEP-----PKFVKKLE-ASKVAKQGESIQLECKISGSPEIKVSW 6398

Query: 1415 --------------------IRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERL 1454
                                + +     + A  S   +  A    G   + +  + L   
Sbjct: 6399 FRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHNGVG---DASCSTALTVK 6455

Query: 1455 YKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQS 1514
              PVF  KP     L+G       ++ G P  E  W  D +Q+ N    K+  K   T S
Sbjct: 6456 APPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDT-S 6514

Query: 1515 LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLE 1574
            L I+    SD GE+   A N  G  + S      +V+ +  P FV+KL + +   G  +E
Sbjct: 6515 LHILNLEASDVGEYHCKATNEVGSDTCSC-----SVKFKEPPRFVKKLSDTSTLIGDAVE 6569

Query: 1575 MKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAIN 1634
            ++    G     +VWLK+   ++  +    RI      A L++ S  + +S  Y     N
Sbjct: 6570 LRAIVEGFQPISVVWLKDRGEVI-RESENTRISFIDNIATLQLGSPEASNSGKYICQIKN 6628

Query: 1635 KAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAA---PELEPLHLRYGQE---- 1687
             AG       + V       E    + +  G   A E      PEL     + G+E    
Sbjct: 6629 DAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSAD 6688

Query: 1688 -------------------QWEEGDLYDKEKQQK------------------PFFKKKLT 1710
                               +  +  LY  E +                    P F +KL 
Sbjct: 6689 SKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLK 6748

Query: 1711 SLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSR 1770
             +          ECR++  G   + V W  DG  + +  + +       C+L+  +    
Sbjct: 6749 DVNAILGASVVLECRVS--GSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPS 6806

Query: 1771 DSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTG 1830
            D+GI TC A N  G+D  SA L V++  S  +                            
Sbjct: 6807 DTGIYTCVAANVAGSDECSAVLTVQEPPSFEQT--------------------------- 6839

Query: 1831 VTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVR 1890
                            P+ V VL G +  F   + G P  KV W+   + +   +   + 
Sbjct: 6840 ----------------PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNIS 6883

Query: 1891 Y-DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEF 1949
              D +  L++ + +  ++G+      N  G       L +++   F  V R A     +F
Sbjct: 6884 LEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATF--VKRLA-----DF 6936

Query: 1950 HVHEPGKLQFEVQKVDRP-VDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEG 2008
             V     +  E      P +  +  K+   + ++ER +                      
Sbjct: 6937 SVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCS---------------------- 6974

Query: 2009 YYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDK 2068
                IT  E        +  E+L  T ++   ++  +  E  + + E             
Sbjct: 6975 ----ITMTE------KSTILEILESTIEDYAQYSCLIENEAGQDICEA------------ 7012

Query: 2069 IELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYW 2128
              L   +E P   E ++      G  A  + +V G P+    WYK   K+ RS   Y   
Sbjct: 7013 --LVSVLEPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKL-RSAPAYKMQ 7069

Query: 2129 PEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEK 2188
             ++NV  LVI  V   D      KA N  G  +S A L+++A++L  F       V +  
Sbjct: 7070 FKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETL 7129

Query: 2189 DTMATFECET--SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSC 2246
                 FEC    SEP ++V WYKDG+ + +    +      V  L IL  D S    Y+C
Sbjct: 7130 GFPVAFECRINGSEP-LQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNC 7188

Query: 2247 VLVED-ENVKTTAKLIVEGAVVEFVKELQDIEVPESY--SGELEC-IVSPENIEGKWYHN 2302
                      ++AKLI+    V    +L+ + V  +   SG  +C +     I+  W  +
Sbjct: 7189 SASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKD 7248

Query: 2303 DVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFV---IDGKKTTCKLKMKPRPIAIL 2359
            + E++  G Y +T       LTV  V K D G+Y+     I GK +         P   +
Sbjct: 7249 NREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQEPPRFI 7308

Query: 2360 QGLSDQKVCEGD-IVQLEVKVS-LESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDM 2417
            + L   ++ + D   + E K+     ++ +W KD  E+Q S +  +       +L + ++
Sbjct: 7309 KKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNL 7368

Query: 2418 TKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAV---LECKVSVPDVT 2474
            + ED+G+Y+        S S   S+   +     K  + IE  K     LEC++      
Sbjct: 7369 SVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPF 7428

Query: 2475 SVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKI- 2533
             V WY +  +++   + + + +     + I    A+D G Y+      +   +  V  I 
Sbjct: 7429 HVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATN-DVGSDTCVGSIA 7487

Query: 2534 -----KIIRGLRDLTCTETQNVVFEVELSHSG-IDVLWNFKDKE--IKPSSKYKIEAHGK 2585
                 + ++ L D++    + V  +  +  +  I V+W FKDK   ++ S    I     
Sbjct: 7488 LKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVW-FKDKGEIVRESDNIWISYSEN 7546

Query: 2586 IYKLTVLNMMKDDEGKYTFY----AGENMTSGKLTVAGGA--ISKPLTDQTVAESQEAVF 2639
            I  L    +   + GKYT      AG       L+V   A  + KP + + V        
Sbjct: 7547 IATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIK-VTTGDTCTL 7605

Query: 2640 ECEVAN-PDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVAT--- 2695
            EC VA  P+   +W +DGK L   N  +         L I      D G Y+++V     
Sbjct: 7606 ECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVG 7665

Query: 2696 -SKTSAKLKVEAVKIK----KTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESN 2750
                +A L+V    +     + LK          V   ++       V W   G  + S 
Sbjct: 7666 KDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSG 7725

Query: 2751 EKYAISVKGTIYSLRIKNCAIVDESVYGF----RLGRLGASARLHV-ETVKIIKKPKDVT 2805
             KY  ++     +L +      D   Y        G    SA L V E    ++KP  + 
Sbjct: 7726 RKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMD 7785

Query: 2806 ALENATVAFEVSVSHDTVP--VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGE 2863
             L    V F  S+   T P  V WF  S E+ P D+  +  E  V +L L ++  S +GE
Sbjct: 7786 VLTGTNVTF-TSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGE 7844

Query: 2864 YTAVV----GQLECKAKLFVET-LHITKTMKNIEVPETKTASFECEVSHFNVPSM-WLKN 2917
            YT +V    G+  C   L+++      K + +  + + K    E   +     S+ W KN
Sbjct: 7845 YTCIVSNEAGKASCTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKN 7904

Query: 2918 GVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTF----VCGNDQVSATLTVT-PIMIT 2972
            G+ +  S++  I    K   L I +++ ED+ +Y        G D  SA + +  P    
Sbjct: 7905 GINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFV 7964

Query: 2973 SMLKDINAEEKDTITFEVTV-NYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVH 3031
              L+ +     D+ + +  +     I   W K   +++ T   +M  +    +L    V 
Sbjct: 7965 KQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVD 8024

Query: 3032 FGDAADYTFVA----GKATSTATLYVEARHI--EFRKHIKDIKVLEKKRAMFECEVSEPD 3085
              D+ +Y   A    G+ +++  L V+ + +   F + ++D++       +F+C +S  +
Sbjct: 8025 INDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSE 8084

Query: 3086 -ITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTAKL 3140
             I+V W KD + L+ +  ++         L I  T  S AG+Y+  A    G   S+A+L
Sbjct: 8085 PISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARL 8144

Query: 3141 FV-EGRDVRIRSIK-KEVQVIEKQRAVVEFEVN-EDDVDAHWYKDGIEINFQVQERHKYV 3197
             + EG++     I+   V  +  + A  E  V     +   W KD  EI    + +  Y+
Sbjct: 8145 ILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYL 8204

Query: 3198 VERRIHRMFISETRQSDAGEYTFVAGRN--RSSVTLYVNAPE---PPQVLQEL-QPVTVQ 3251
             E   H + + +  + D+G+YT  A     + S T  +N  E   PP   + L + V   
Sbjct: 8205 -ENSAH-LTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEET 8262

Query: 3252 SGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTC 3311
             G   +    ++G     ++WYK    +     C+         L + +A   DA +YTC
Sbjct: 8263 EGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTC 8322

Query: 3312 EAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGT 3371
            +  ND G A  ++S+ ++ P+           PP     L     SEG+  +  C V G+
Sbjct: 8323 KVSNDAGSALCTSSIVIKEPKK----------PPVFDQHLTPVTVSEGEYVQLSCHVQGS 8372

Query: 3372 D-LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3430
            + +++ W    ++IKPS                      D  +++F +  AV        
Sbjct: 8373 EPIRIQWLKAGREIKPS----------------------DRCSFSFASGTAV-------- 8402

Query: 3431 LSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDS--EDIDHKSMAAKRY 3488
                               +E++++      ++  + +  A SD+    +  K   A   
Sbjct: 8403 -------------------LELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAP 8443

Query: 3489 ASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNN-RPIPTG 3547
            A++ ++       F  S  Q +    V+E     F  ++   P P + W     R +  G
Sbjct: 8444 ATKKAAVDG--RLFFVSEPQSIR---VVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQG 8498

Query: 3548 LRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYL 3607
             R  I  + D     + LEI+     DSG YR +A N  G  ES  +L V     DE+  
Sbjct: 8499 GRVFIHQKGD----EAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQV-----DER-- 8547

Query: 3608 EFLKRAERTHENVEALVERGEDRIKVDLRFTGSPFNKKQDVEQKGMMRTIHFKTMSSAKK 3667
                              + +++I+ DLR       KK  + +KG         M   K 
Sbjct: 8548 ------------------KKQEKIEGDLR----AMLKKTPILKKGAGEEEEIDIMELLKN 8585

Query: 3668 TDYMYDEEY--LESKSDIRGWLNVGESFLDKETKVKLQRLREARKTLMEKKKLSLLDTSS 3725
             D    E+Y  +   +D RG L   E  L +  + +  RL        E+ +    +  S
Sbjct: 8586 VDPKEYEKYARMYGITDFRGLLQAFE-LLKQSQEEETHRLEIEEIERSERDEKEFEELVS 8644

Query: 3726 EISSRTLRSEASD--KDILFSREDMKIRSMSDLAESYKVDHSAESIVQNPHALSNQMDQN 3783
             I  R  ++E     KDI    E+  +   +D    +++D     I  N   +     + 
Sbjct: 8645 FIQQRLSQTEPVTLIKDI----ENQTVLKDNDAV--FEID-----IKINYPEIKLSWYKG 8693

Query: 3784 IESEELPTSFQTIVDEEIFQTEIRMSQEALVKESLPKDHLYGEILVNEN-TQARGQLEEI 3842
             E  E    F+  +D +     ++  Q   +K+      + G  + +   T      E  
Sbjct: 8694 TEKLEPSDKFEISIDGDRHTLRVKNCQ---LKDQGNYRLVCGPHIASAKLTVIEPAWERH 8750

Query: 3843 MANTTIGESSTYITNVCEKEEVYETPENVSQAITPHASESF--GTLVNVEESEEIASERI 3900
            + + T+ E  T  T  C+    +  P NV        SE F  G ++  +   +   E  
Sbjct: 8751 LQDVTLKEGQT-CTMTCQ----FSVP-NVK-------SEWFRNGRILKPQGRHKTEVEH- 8796

Query: 3901 KKDDLRELQLSASTRIDEFKTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDS 3960
                + +L ++     D+ +   K E++   E S   R +  P  F + I++  V E  S
Sbjct: 8797 ---KVHKLTIADVRAEDQGQYTCKYEDL---ETSAELRIEAEPIQFTKRIQNIVVSEHQS 8850

Query: 3961 CNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVL-F 4019
              F C    +   IVTWY     +  +Q +   +      +T+ +V   +EG  + +   
Sbjct: 8851 ATFECEVS-FDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARL 8909

Query: 4020 NQYGTVKTTSMLKVKAKQ-KHDVKAHKVP 4047
               G  ++T+ L +  K+ K ++K   +P
Sbjct: 8910 EPRGEARSTAELYLTTKEIKLELKPPDIP 8938



 Score =  433 bits (1113), Expect = e-120
 Identities = 663/2983 (22%), Positives = 1122/2983 (37%), Gaps = 393/2983 (13%)

Query: 940  VTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIAR 999
            + PP+    LK +  I+G  + LEC ++G    ++ W+++D +I +S  ++ +F    A 
Sbjct: 4672 IIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAF 4731

Query: 1000 LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKE------------------ 1041
            L I +    DSG +TCSA N+AG    S +L V+    F ++                  
Sbjct: 4732 LEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALV 4791

Query: 1042 --TTAVTEKFTTEEKRFVE--SRDVVMTDTSLTEE------------------QAGPGEP 1079
              T  +T K+  + K      +R V   DTS + E                    G    
Sbjct: 4792 GGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATS 4851

Query: 1080 AA-------PYFITKP-VVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVS 1131
             A       P FI KP  V  L  G S  F CQ+ G PK  V W   G  +T   ++ +S
Sbjct: 4852 KATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGIS 4911

Query: 1132 YNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQT 1191
            +    G     IS    +++G Y    RN  G  S S         EL +K     + + 
Sbjct: 4912 F--IDGLATFQISGARVENSGTYVCEARNDAGTASCS--------IELKVKEPPTFIREL 4961

Query: 1192 QVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFE 1251
            +    V+   V           +E  + K    IR    K T+  R  V +   HI+  +
Sbjct: 4962 KPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSS-KKYTLTDRVSVFN--LHITKCD 5018

Query: 1252 ERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFH 1311
                   EY+ I      +  E G    +  ++  E     F  +I+N   +     TF 
Sbjct: 5019 PS--DTGEYQCI------VSNEGGSCSCSTRVALKE--PPSFIKKIENTTTVLKSSATFQ 5068

Query: 1312 CKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1371
              ++G P   I W KD + +   +   + F+ D  A+L+I  V     G YT  A N  G
Sbjct: 5069 STVAGSPPISITWLKDDQILDEDDNVYISFV-DSVATLQIRSVDNGHSGRYTCQAKNESG 5127

Query: 1372 NAICSGKLYV-EPAAPLGAPTYIPTLE-------------PVSRIRSLSPRSVSRSPIRM 1417
               C   L V EPA  +     +   E             P  +++ L        P R 
Sbjct: 5128 VERCYAFLLVQEPAQIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKD-GKQIVPSRY 5186

Query: 1418 SPARMSPARMSPARMSPARMSPGRRLEETDES-----------QLERLYKPVFVLKPVSF 1466
                      S    S  +   G+   + +              L++   P F  K    
Sbjct: 5187 FSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKM 5246

Query: 1467 KCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSG 1526
              + G +   + KV G       WF DG++I     +++V  E    SL +      D+ 
Sbjct: 5247 DKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERSV-SLEVNNLELEDTA 5305

Query: 1527 EWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPD 1586
             +T    N AG  + S ILTV+       P F+ K         S +E K    G P   
Sbjct: 5306 NYTCKVSNVAGDDACSGILTVKE-----PPSFLVKPGRQQAIPDSTVEFKAILKGTPPFK 5360

Query: 1587 IVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRD--TTRCK 1644
            I W K+   +V      I +EG+   + L + S  +  +  YT    N  G D  TT   
Sbjct: 5361 IKWFKDDVELVSGPKCFIGLEGS--TSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLL 5418

Query: 1645 VNVEVEFAEPEPERKLIIPRGTYR--AKEIAAPELEPLHLRYGQE--------------- 1687
            V    +F +     K++    + R   K   +PE+  +  R   E               
Sbjct: 5419 VTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSV 5478

Query: 1688 ---------QWEEGDLYDKEK--------------QQKPFFKKKLTSLRLKRFGPAHFEC 1724
                       + GD   + +              ++ P F      +   +      EC
Sbjct: 5479 AVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVFSSFPPIVETLKNAEVSLEC 5538

Query: 1725 RLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYG 1784
             L+  G P   V W  D + L ++ + ++ ++  + S+      + D G   C+A N+ G
Sbjct: 5539 ELS--GTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVG 5596

Query: 1785 TDHTSATLIVKDEKSLV-----------EESQLPEGRKGLQRI--------EELERMAHE 1825
            +D    T+ +K+    V           E ++L    +G Q I        EE+ R +  
Sbjct: 5597 SDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESEN 5656

Query: 1826 GALT---GVTTDQKEKQKPD----------------------IVLYPE-------PVRVL 1853
              +T    V T Q  K +P                       +VL P        P+ V 
Sbjct: 5657 IRITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVT 5716

Query: 1854 EGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVR-YDGIHYLDIVDCKSYDTGEVKV 1912
             GET    C+V G P+  V WY +G+L+  S++ +   Y+ I  L I+  +  D G    
Sbjct: 5717 VGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTF 5776

Query: 1913 TAENPEGVIEHKVKLEIQQREDFRSVLRR-------------------APEPRPEFHVHE 1953
              +N  G       +++  R    S  RR                      P      HE
Sbjct: 5777 QVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHE 5836

Query: 1954 PGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEE---SEELRSKFKRRTEEGYY 2010
              K+    +      D   T ++  L  ++   +  V      S+E R+    +    + 
Sbjct: 5837 KTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPSFV 5896

Query: 2011 EAITAVELKSRKKDESYEELLRKTKDELLHW---TKELTEEEKKALAEEGKITIPTFKPD 2067
            +    +E+    K+ ++  ++R T    ++W    +EL + ++  +  E   T+   +  
Sbjct: 5897 KEPEPLEVLP-GKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFED--TVAELELF 5953

Query: 2068 KIELSPS----------------------MEAPKIFERIQSQTVGQGSDAHFRVRVVGKP 2105
             I++S S                       E     +R+   +V  G          G  
Sbjct: 5954 NIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTL 6013

Query: 2106 DPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAF 2165
                 W K+G  I  S++      E   C L I + T  D+     +  N AG     A 
Sbjct: 6014 PISVTWKKDGFNITTSEKCNIVTTE-KTCILEILNSTKRDAGQYSCEIENEAGRDVCGA- 6071

Query: 2166 LLVQAKQLITFTQELQDVVAKEKDTMATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHS 2224
             LV   +   F  EL+ + A   D++ + +C+ +  P + V WYK   ++    +YR + 
Sbjct: 6072 -LVSTLEPPYFVTELEPLEAAVGDSV-SLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYF 6129

Query: 2225 DRKVHFLSILTIDTSDAEDYSCVL---VEDENVKTTAKLIVEGAVVEFVKELQDIEVPES 2281
               V  L    ++ +D+ +Y+C     +   + KT  ++        F ++L+DIE    
Sbjct: 6130 TNNVATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVG 6189

Query: 2282 YSGELEC-IVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI 2340
                L C +     I+  WY + V L+ +     +       L +        G+YS   
Sbjct: 6190 LPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSA 6249

Query: 2341 DGKKTTCK-------LKMKPRPIAILQGLSDQKVCEGDIVQLEVKVS-LESVEGVWMKDG 2392
                 T          + K  P   ++ +S   V  G+    E  V+  + +   W KD 
Sbjct: 6250 SNPLGTASSSARLTAREPKKSPFFDIKPVSID-VIAGESADFECHVTGAQPMRITWSKDN 6308

Query: 2393 QEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLK 2452
            +E++P     I     +  L I  + K D+G Y  T  A         S   + V  P K
Sbjct: 6309 KEIRPGGNYTITCVGNTPHLRILKVGKGDSGQY--TCQATNDVGKDMCSA-QLSVKEPPK 6365

Query: 2453 DVNVIEGTKAV-------LECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVIN 2505
             V  +E +K         LECK+S      V W+ ND ++    +       +   L IN
Sbjct: 6366 FVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTIN 6425

Query: 2506 RTHASDEGPYKLI----VGRVETNCNLSVEKIKII-RGLRDLTCTETQNVVFEVELSHS- 2559
               A D G Y       VG    +  L+V+   +  +    +   +  +V+ + E+S + 
Sbjct: 6426 EASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTP 6485

Query: 2560 GIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAG 2619
              +V+W    K+++ S K+KI +      L +LN+   D G+Y   A   + S   + + 
Sbjct: 6486 PFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSV 6545

Query: 2620 GAISKPLTDQTVAESQEAVFECEVANPDSKG------EWLRD-GKHLPLTNNIRSESDGH 2672
                 P   + ++++   + +        +G       WL+D G+ +  + N R     +
Sbjct: 6546 KFKEPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDN 6605

Query: 2673 KRRLIIAATKLDDIGEYTYKVATS----KTSAKLKV-EAVKIKKTLKNLTVTETQDAVFT 2727
               L + + +  + G+Y  ++       + SA L V E  +I +  + +TVT        
Sbjct: 6606 IATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPARIIEKPEPMTVTTGNPFALE 6665

Query: 2728 VELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFR----LGR 2783
              +T       +W K+G  L ++ K+ I+    + SL+I    + D+ +Y F     +G+
Sbjct: 6666 CVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGK 6725

Query: 2784 LGASARLHVE----TVKIIKKPKDVTALENATVAFEVSVSHDT-VPVKWFHKSVEIKPSD 2838
               +  +HV         I+K KDV A+  A+V  E  VS    + V WF    EI    
Sbjct: 6726 SNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGP 6785

Query: 2839 KHRLVSERKVHKLMLQNISPSDAGEYTA----VVGQLECKAKLFV-ETLHITKTMKNIEV 2893
            K +      V  L L  + PSD G YT     V G  EC A L V E     +T  ++EV
Sbjct: 6786 KCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEV 6845

Query: 2894 PETKTASFECEV---SHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAE 2950
                + +F   +     F V   W K   E+   E   I ++  + +L +      +S +
Sbjct: 6846 LPGMSLTFTSVIRGTPPFKV--KWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGD 6903

Query: 2951 YTFVCGNDQVSATLTV-----TPIMITSMLKDINAEEKDTITFEVTVNYEG---ISYKWL 3002
            Y+ +  ND  SA+ T       P      L D + E    I  E T  Y G   IS  W+
Sbjct: 6904 YSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLEAT--YTGTPPISVSWI 6961

Query: 3003 KNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFV----AGKATSTATLYVEARHI 3058
            K+   I  +++C +   + +  L I      D A Y+ +    AG+    A + V     
Sbjct: 6962 KDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSV-LEPP 7020

Query: 3059 EFRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP 3117
             F + ++ ++ +  + A  +C+V   P+I + W K+  +L+     K+Q +  V  L+I 
Sbjct: 7021 YFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVIN 7080

Query: 3118 STRMSDAGKYTVVAGGNV----STAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEV--- 3170
                SD G+Y+  A  +V    S+A L ++ R +     +K   V E     V FE    
Sbjct: 7081 KVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRIN 7140

Query: 3171 NEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNR 3226
              + +   WYKDG+ +      +  +V    +  + I +T QS  G+Y   A    G   
Sbjct: 7141 GSEPLQVSWYKDGVLLKDDANLQTSFV--HNVATLQILQTDQSHIGQYNCSASNPLGTAS 7198

Query: 3227 SSVTLYVNAPEPPQVLQELQPVTVQ--SGKPARFCAVISGRPQPKISWYKEEQLLSTGFK 3284
            SS  L ++  E P    +L+PV+V    G+   F   ++G    KI+W K+ + +  G  
Sbjct: 7199 SSAKLILSEHEVPPFF-DLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGN 7257

Query: 3285 CKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYP 3344
             K        TL +++    DA  YTC A N  G  + SA L V+              P
Sbjct: 7258 YKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGVQ-------------EP 7304

Query: 3345 PAIITPLQDT-VTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLE 3402
            P  I  L+ + +  + +  R++C++ G+ ++KV WY  + +I+ S  FRM+  +    LE
Sbjct: 7305 PRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLE 7364

Query: 3403 IAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAP----------ESILHERIEQEIEM-- 3450
            +     ED G YT  A NA G  SS+ +L ++ P          E++    +  E E+  
Sbjct: 7365 MHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQG 7424

Query: 3451 ----------EMKELFSEGE----SEHSERDTRDAFSDSEDIDHKSMAAKRYASRISSTS 3496
                      + +EL S  +    SE+          D+ DI      A       +   
Sbjct: 7425 TPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVG 7484

Query: 3497 SWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAES 3556
            S      P F +KL+    + G+ V     +       + WF +   I      I  + S
Sbjct: 7485 SIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYS 7544

Query: 3557 DLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQ 3599
            +   + ++L+  RV+  ++G Y     N  G  E  A+L V++
Sbjct: 7545 E---NIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLE 7584



 Score =  427 bits (1098), Expect = e-118
 Identities = 449/1826 (24%), Positives = 751/1826 (41%), Gaps = 184/1826 (10%)

Query: 1456  KPVFVLKPVSFKCL-EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQS 1514
             + V +LKP+    + E ++A FD ++    +P   W   G+ +    T ++   E G + 
Sbjct: 11395 REVELLKPIEDVTIYEKESASFDAEISEADIPGQ-WKLKGELLRPSPTCEIKA-EGGKRF 11452

Query: 1515  LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLE 1574
             L +       +GE    A N    +  + ILTV+ +E      F   LK+V + E  +  
Sbjct: 11453 LTLHKVKLDQAGEVLYQALN----AITTAILTVKEIELD----FAVPLKDVTVPERRQAR 11504

Query: 1575  MKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAIN 1634
              +   T   N  ++W K  DII       I  +G K    L I+ +   D   YTA    
Sbjct: 11505 FECVLTREAN--VIWSKGPDIIKSSDKFDIIADGKKH--ILVINDSQFDDEGVYTAEVEG 11560

Query: 1635  KAGRDTTRCKVN-VEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGD 1693
             K  + + R  V  + ++F  P  ++       T +  E A    E  H            
Sbjct: 11561 K--KTSARLFVTGIRLKFMSPLEDQ-------TVKEGETATFVCELSH------------ 11599

Query: 1694  LYDKEKQQKPFFKK--KLTSLR---LKRFGPAH-FECRLTPIGDPTMVVEWLHDGKPLEA 1747
                 EK    +FK   KL + R   +   G  H  E +   + D + +   +   K L +
Sbjct: 11600 ----EKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQV---KELSS 11652

Query: 1748  ANRLRMINEFGYCS--LDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQ 1805
               +L+++    Y +  L    A  +D   + C  +              KD + +V   +
Sbjct: 11653 TAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKW------FKDGEEIVPSPK 11706

Query: 1806  LPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLE---------GE 1856
                   GL+RI ++++   +     V     +K K ++ +    ++V +         GE
Sbjct: 11707 YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGE 11766

Query: 1857  TARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGEVKVTAE 1915
             TA F   ++  P     W L GQ +  S    +  DG  H L + +C+   TGEV   A 
Sbjct: 11767 TAHFEIELSE-PDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAA 11825

Query: 1916  NPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKE 1975
             N +     KVK           +      P  +  V E  + +FE +       + E K 
Sbjct: 11826 NAKSAANLKVK----------ELPLIFITPLSDVKVFEKDEAKFECEV------SREPKT 11869

Query: 1976  VVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTK 2035
                LK  + IT                                     D+ +E +   TK
Sbjct: 11870 FRWLKGTQEIT------------------------------------GDDRFELIKDGTK 11893

Query: 2036  DELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDA 2095
               ++  +    +E K     E K T      + I L       K    ++  T  +   A
Sbjct: 11894 HSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRL-------KFLTPLKDVTAKEKESA 11946

Query: 2096  HFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAIN 2155
              F V  +   +   +W+KN  ++  + R      E     +  +D++ +D++ I V+A+ 
Sbjct: 11947 VFTVE-LSHDNIRVKWFKNDQRL-HTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMG 12004

Query: 2156  IAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVH 2215
             ++ E       L   +    FT +LQD    EKD +   +CE S+    VKW+KDG E+ 
Sbjct: 12005 MSSEAK-----LTVLEGDPYFTGKLQDYTGVEKDEV-ILQCEISKADAPVKWFKDGKEIK 12058

Query: 2216  EGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQD 2275
                   + +D K   L +     SD   Y+C    D   KT+ KL +E   ++ V+ L  
Sbjct: 12059 PSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTD---KTSGKLDIEDREIKLVRPLHS 12115

Query: 2276  IEVPESYSGELECIVSPENIEGKW--------YHNDVELKSNGKYTITSRRGRQNLTVKD 2327
             +EV E+ +   E  +S ++I   W           D E+K  GK          +L + +
Sbjct: 12116 VEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKI--------HSLVLHN 12167

Query: 2328  VTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGV 2387
                +  G   F     K++  L++KPR I +L+ L D  V  G+    + ++S E +   
Sbjct: 12168 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 12227

Query: 2388  WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV 2447
             W   G++++PSD+V    + + H L + D+  EDAG    T        +  V    V+ 
Sbjct: 12228 WYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEF 12287

Query: 2448  ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRT 2507
               PL+D  V EG  AVLEC+VS  +   VKW+ N  +I    + + +  G  ++LVI+  
Sbjct: 12288 TKPLEDQTVEEGATAVLECEVS-RENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDC 12346

Query: 2508  HASDEGPYKLIVGRVETNCNLSV--EKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLW 2565
                D   Y       +T+CNL+V    ++ +R L DL   E +   FE ELS     V W
Sbjct: 12347 TPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKVKW 12406

Query: 2566  NFKD-KEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTV--AGGAI 2622
              FKD  EIK   KY I + G +  L +   + DDE +Y+       TSG LTV       
Sbjct: 12407 -FKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVF 12465

Query: 2623  SKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATK 2682
             +K L +  V+E+      CEV+ P ++  W +  + +  T      ++G KR L+I    
Sbjct: 12466 TKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAH 12525

Query: 2683  LDDIGEYTYKVATSKTSAKLKVE--AVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQW 2740
             L+D G Y  ++ +S+T  K+KV   A +     +NL + E + A F   ++  +   VQW
Sbjct: 12526 LEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFP-VQW 12584

Query: 2741  IKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHV-ETVKIIK 2799
              ++   LES +KY +   G    L +K+  + D   Y   +G   A+A L V E ++I+ 
Sbjct: 12585 KRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVV 12644

Query: 2800  KPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPS 2859
               KD    E   V F   V+ +    KWF     I  S K+ ++ +  V+ L +++    
Sbjct: 12645 PLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLD 12704

Query: 2860  DAGEYTAVV-----GQLECKAKLFV--ETLHITKTMKNIEVPETKTASFECEVSHFNVPS 2912
             D   Y   +       ++  A L V  E L I + +K+IE  E K+ +F C+V+  NV  
Sbjct: 12705 DQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTL 12764

Query: 2913  MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIM 2970
              W KNG E+    +    V    H L I +    D  EY    G D+  A L +   P  
Sbjct: 12765 KWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTE 12824

Query: 2971  ITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNV 3030
                 L+D    E D   F   ++ E  + KW +NG EIK   K +       H L I++ 
Sbjct: 12825 FVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 12884

Query: 3031  HFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQW 3090
                D  +Y        S A L+VE   +E  +  +DI        +F  E+++  + VQW
Sbjct: 12885 RLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQW 12944

Query: 3091  MKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIR 3150
             ++++  +   D+ ++  E  +HRL I   +  D G+Y  +A    + AKL +     +I+
Sbjct: 12945 LRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIK 13003

Query: 3151  SIKKE--VQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFIS 3208
             +  ++  V V +    VV ++      +A W+K+   ++ +  +      E+   R  I 
Sbjct: 13004 TADQDLVVDVGKPLTMVVPYDA-YPKAEAEWFKENEPLSTKTIDT---TAEQTSFR--IL 13057

Query: 3209  ETRQSDAGEYTFVAGRNRSSVTLYVN 3234
             E ++ D G Y  V          ++N
Sbjct: 13058 EAKKGDKGRYKIVLQNKHGKAEGFIN 13083



 Score =  423 bits (1088), Expect = e-117
 Identities = 409/1674 (24%), Positives = 699/1674 (41%), Gaps = 128/1674 (7%)

Query: 1855  GETARFRCRVTGYPQPKVN-WYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGEVKV 1912
             G +A F C V+  P   +  W  +G  IR+S + R   DG    L I+D +  D GE   
Sbjct: 11133 GSSAIFECLVS--PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTC 11190

Query: 1913  TAE--NPEGVIEHKVKLE------IQQREDFRSVLRRAP---------------EPRPEF 1949
                  N E     K+ +E      ++  E+  +V++  P                   + 
Sbjct: 11191 VLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKERDVVWRKDGKI 11250

Query: 1950  HVHEPGKL---------QFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEE---- 1996
              V +PG++            +   D     T T  V      E  +  KV E   +    
Sbjct: 11251 VVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVK 11310

Query: 1997  -LRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKD--ELLHWTKELTEEEKKAL 2053
              +R +  +      +    A +  + K  + Y+E+  +  D  E+L     L  + K A+
Sbjct: 11311 PIRDQHVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAM 11370

Query: 2054  AE---------EGKITIP---TFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHF--RV 2099
              E         EGK   P   T    ++EL   +E   I+E+  +    + S+A    + 
Sbjct: 11371 PEDIAEYAVEIEGK-RYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPGQW 11429

Query: 2100  RVVG---KPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINI 2156
             ++ G   +P P CE     +K E   R            L +  V  + +  ++ +A+N 
Sbjct: 11430 KLKGELLRPSPTCE-----IKAEGGKRF-----------LTLHKVKLDQAGEVLYQALNA 11473

Query: 2157  AGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHE 2216
                  + A L V+  +L  F   L+DV   E+   A FEC  +     V W K    +  
Sbjct: 11474 I----TTAILTVKEIEL-DFAVPLKDVTVPER-RQARFECVLTRE-ANVIWSKGPDIIKS 11526

Query: 2217  GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDI 2276
              DK+ + +D K H   IL I+ S  +D      E E  KT+A+L V G  ++F+  L+D 
Sbjct: 11527 SDKFDIIADGKKH---ILVINDSQFDDEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQ 11583

Query: 2277  EVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2336
              V E  +    C +S E +   W+ ND +L ++    I+S      L +K+VT +D  + 
Sbjct: 11584 TVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQI 11643

Query: 2337  SFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQ 2396
                +    +T +LK+          L D+   E D + L+ +VS + V   W KDG+E+ 
Sbjct: 11644 KAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVS-KDVPVKWFKDGEEIV 11702

Query: 2397  PSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNV 2456
             PS +  I  D    +L I+    +D G Y           +  V    + V  PL  V V
Sbjct: 11703 PSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEV 11762

Query: 2457  IEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYK 2516
               G  A  E ++S PDV   +W L  + +      + I  G K  L+++       G   
Sbjct: 11763 FVGETAHFEIELSEPDVHG-QWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVS 11821

Query: 2517  LIVGRVETNCNLSVEKIKI--IRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKP 2574
                   ++  NL V+++ +  I  L D+   E     FE E+S       W    +EI  
Sbjct: 11822 FQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITG 11881

Query: 2575  SSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPLTDQTVA 2632
               ++++   G  + + + +   +DE KY F A +  TSGKL + G  +    PL D T  
Sbjct: 11882 DDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAK 11941

Query: 2633  ESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYK 2692
             E + AVF  E+++ + + +W ++ + L  T ++  + +G    +      +DD  +   +
Sbjct: 11942 EKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVE 12001

Query: 2693  VATSKTSAKLKVEAVKIKKT--LKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESN 2750
                  + AKL V       T  L++ T  E  + +   E++  +   V+W K+G  ++ +
Sbjct: 12002 AMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP-VKWFKDGKEIKPS 12060

Query: 2751  EKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVE--TVKIIKKPKDVTALE 2808
             +   I   G    L +K     D   Y    G    S +L +E   +K+++    V  +E
Sbjct: 12061 KNAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVME 12120

Query: 2809  NATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVV 2868
               T  FE  +S D +   W  K   +  +    +  E K+H L+L N      G      
Sbjct: 12121 TETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQA 12180

Query: 2869  GQLECKAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEK 2926
               ++  A L V+   + + + +K++ V   +TA+F+CE+S+ ++P  W   G ++E S+K
Sbjct: 12181 ANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVEWYLKGKKLEPSDK 12240

Query: 2927  FKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIMITSMLKDINAEEKD 2984
                  +GK+H L + +   ED+ E      + +  A L V   P+  T  L+D   EE  
Sbjct: 12241 VVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGA 12300

Query: 2985  TITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGK 3044
             T   E  V+ E    KW KNG EI  + K ++        L I +    D   YT  A  
Sbjct: 12301 TAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD 12360

Query: 3045  ATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIK 3104
               ++  L V   H+EF + + D++V EK+ A FECE+S  +  V+W KD  E++   +  
Sbjct: 12361 FKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYD 12420

Query: 3105  IQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRA 3164
             I  +  V  L+I    + D  +Y+       ++  L V   +         ++V E    
Sbjct: 12421 IISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTI 12480

Query: 3165  VVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYT--FVA 3222
              +  EV++   +  WYK   EI      R++ + E R   + I      DAG Y     +
Sbjct: 12481 KLVCEVSKPGAEVIWYKGDEEI--IETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPS 12538

Query: 3223  GRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTG 3282
              R    V ++  A E    + + Q + +  G+ A F   IS    P + W ++++ L +G
Sbjct: 12539 SRTDGKVKVHELAAE---FISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESG 12594

Query: 3283  FKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPV 3342
              K   + DG++  L++ +A  +D   Y        G A  +A L+V             +
Sbjct: 12595 DKYDVIADGKKRVLVVKDATLQDMGTYVVMV----GAARAAAHLTV-------------I 12637

Query: 3343  YPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLE 3402
                 I+ PL+DT   E Q   F C V+    K  W+  ++ I  S  + + Q +  Y L 
Sbjct: 12638 EKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLR 12697

Query: 3403  IAEAYPEDEGTYTFVASNAVGQ-VSSTANLSLEAPESILHERIEQEIEMEMKEL 3455
             I +A+ +D+  Y    +N  G+ V S ANL +E  +  + E ++    ME K +
Sbjct: 12698 IRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSV 12751



 Score =  419 bits (1076), Expect = e-116
 Identities = 644/3005 (21%), Positives = 1121/3005 (37%), Gaps = 430/3005 (14%)

Query: 835  AGSAIATLQKELSATSSAQKITKSVKAP-----------TVKPSETRVRAEPTPLPQFPF 883
            +G  I   Q    +TS + K+   VK P           T+K +E  +  E +  P F  
Sbjct: 5491 SGDFICEAQNPAGSTSCSTKVI--VKEPPVFSSFPPIVETLKNAEVSLECELSGTPPFEV 5548

Query: 884  ADTPDTYKSEAGVEVK---KEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPV 940
                D  +  +  + K   K    SI    V        H +      +      V++  
Sbjct: 5549 VWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSDTCVCTVKLK- 5607

Query: 941  TPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ-IESSIDFQITFQSGIAR 999
             PP  VS L ++TV+ GE   L+  I G     V W +E  + I  S + +ITF   +A 
Sbjct: 5608 EPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVAT 5667

Query: 1000 LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVES 1059
            L   +A   ++G++ C   N+ G                      + E   T        
Sbjct: 5668 LQFAKAEPANAGKYICQIKNDGG----------------------MRENMAT-------- 5697

Query: 1060 RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG 1119
              +++ + ++  E+AGP                +  G +    C+V G P+  V W K G
Sbjct: 5698 --LMVLEPAVIVEKAGP--------------MTVTVGETCTLECKVAGTPELSVEWYKDG 5741

Query: 1120 VPLTTGYRYKVS-YNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYE 1178
              LT+  ++K S YNK +    L I      DAG YT  V+N  G++S +A +++ +D  
Sbjct: 5742 KLLTSSQKHKFSFYNKIS---SLRILSVERQDAGTYTFQVQNNVGKSSCTA-VVDVSDRA 5797

Query: 1179 LLMKSQQEMLYQTQV--TAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKD--TV 1234
            +     + +     V   + + E KV  ++P  V   +EK      A  +   + +  T+
Sbjct: 5798 VPPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTL 5857

Query: 1235 VVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFD 1294
             + +       + +     +    E R + T  E              + E E +E    
Sbjct: 5858 QLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEP----------PSFVKEPEPLE---- 5903

Query: 1295 SRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVV 1354
                   +L G  VTF   + G P  K+ W++  + +  G+R  + + +D  A L +  +
Sbjct: 5904 -------VLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNI-YFEDTVAELELFNI 5955

Query: 1355 LPEDEGIYTAFASNIKGNAICSGKLYV-EPAAPLG---------------APTYIPTLEP 1398
                 G YT   SN  G A C+ +L+V EPAA L                  TY  TL P
Sbjct: 5956 DISQSGEYTCVVSNNAGQASCTTRLFVKEPAAFLKRLSDHSVEPGKSIILESTYTGTL-P 6014

Query: 1399 VSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDE-------SQL 1451
            +S        +++ S  + +        +     S  R +     E  +E       + +
Sbjct: 6015 ISVTWKKDGFNITTSE-KCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAGRDVCGALV 6073

Query: 1452 ERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDG 1511
              L  P FV +    +   G +     +V G P     W+    ++     ++     + 
Sbjct: 6074 STLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYF-TNN 6132

Query: 1512 TQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGS 1571
              +L+      +DSGE+T  A+N  G +S   +  ++  E Q+ P F  +LK++    G 
Sbjct: 6133 VATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQ--ERQLPPSFARQLKDIEQTVGL 6190

Query: 1572 RLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTAT 1631
             + +  R  G+    + W +  D ++      ++       A LKI  T    S  Y+ +
Sbjct: 6191 PVTLTCRLNGSAPIQVCWYR--DGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCS 6248

Query: 1632 AINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEE 1691
            A N  G  ++  ++                                              
Sbjct: 6249 ASNPLGTASSSARLTA-------------------------------------------- 6264

Query: 1692 GDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRL 1751
                 +E ++ PFF  K  S+ +     A FEC +T  G   M + W  D K +      
Sbjct: 6265 -----REPKKSPFFDIKPVSIDVIAGESADFECHVT--GAQPMRITWSKDNKEIRPGGNY 6317

Query: 1752 RMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVE--------- 1802
             +        L        DSG  TC+ATN  G D  SA L VK+    V+         
Sbjct: 6318 TITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKEPPKFVKKLEASKVAK 6377

Query: 1803 ------------------------ESQLPEGRK---------GLQRIEELER-------- 1821
                                    +S+L E  K          L  I E           
Sbjct: 6378 QGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYIC 6437

Query: 1822 MAHEG-ALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQL 1880
             AH G      +T    K  P     P PV  L+G     +C ++G P  +V W  + + 
Sbjct: 6438 EAHNGVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQ 6497

Query: 1881 IRKSKRFRVRYDGIHY---LDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRS 1937
            +R SK+F++     H+   L I++ ++ D GE    A N  G       ++ ++      
Sbjct: 6498 VRNSKKFKI--TSKHFDTSLHILNLEASDVGEYHCKATNEVGSDTCSCSVKFKE------ 6549

Query: 1938 VLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEEL 1997
                   PR    + +   L  +  ++   V+  +   VV LK        +V  ESE  
Sbjct: 6550 ------PPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLK-----DRGEVIRESENT 6598

Query: 1998 RSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEG 2057
            R  F         + I  ++L S +   S                K + + +  A   E 
Sbjct: 6599 RISF--------IDNIATLQLGSPEASNS---------------GKYICQIKNDAGMREC 6635

Query: 2058 KITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVK 2117
               +   +P            +I E+ +  TV  G+       V G P+   +W+K+G +
Sbjct: 6636 SAVLTVLEP-----------ARIIEKPEPMTVTTGNPFALECVVTGTPELSAKWFKDGRE 6684

Query: 2118 IERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQL-ITF 2176
            +  +D  +     + V  L I      D      +  N  G+++    + V  + +  +F
Sbjct: 6685 LS-ADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSF 6743

Query: 2177 TQELQDVVAKEKDTMATFECETS-EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILT 2235
             ++L+DV A         EC  S    + V W++DG E+  G K +      V  L++  
Sbjct: 6744 IRKLKDVNA-ILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSL 6802

Query: 2236 IDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIV-SPEN 2294
            ++ SD   Y+CV          + ++       F +    +EV    S     ++     
Sbjct: 6803 LEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPP 6862

Query: 2295 IEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI--DGKKTTCKLKM- 2351
             + KW+    EL       I+       L + +V   + G+YS ++  D    +C   + 
Sbjct: 6863 FKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSASCTTHLF 6922

Query: 2352 KPRPIAILQGLSDQKVCEGDIVQLEVK-VSLESVEGVWMKDGQEVQPSDRVHIVIDKQSH 2410
               P   ++ L+D  V  G  + LE        +   W+KD   +  S+R  I + ++S 
Sbjct: 6923 VKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKST 6982

Query: 2411 MLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVD---VITPLKDVNVIEGTKAVLECK 2467
            +L I + T ED   YS  I            V  ++    I PL+ V  + G  A L+CK
Sbjct: 6983 ILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPATLQCK 7042

Query: 2468 VSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKL----IVGRVE 2523
            V       + WY    +++     +   K     LVIN+   SD G Y       VG V 
Sbjct: 7043 VDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVA 7102

Query: 2524 TNCNLSVEKIKI----IRGLRDLTCTETQNVVFEVELSHS-GIDVLWNFKDKEIKPSSKY 2578
            ++  L ++  K+     R L+D+  T    V FE  ++ S  + V W      +K  +  
Sbjct: 7103 SSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANL 7162

Query: 2579 KIEAHGKIYKLTVLNMMKDDEGKYTFYA----GENMTSGKLTVAGGAIS-----KPLTDQ 2629
            +      +  L +L   +   G+Y   A    G   +S KL ++   +      KP++  
Sbjct: 7163 QTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVS-V 7221

Query: 2630 TVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGE 2688
             +A  +   F+C V      K  W +D + +    N +     +   L +      D G+
Sbjct: 7222 DLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQ 7281

Query: 2689 YTYKVAT----SKTSAKLKVEAVK--IKKTLKNLTVTETQDAVFTVEL-THPNVKGVQWI 2741
            YT   +        SA+L V+     IKK   +  V + +   +  ++   P +K V W 
Sbjct: 7282 YTCYASNIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIK-VLWY 7340

Query: 2742 KNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFR----LGRLGASARLHVETVKI 2797
            K+   ++ + K+ +S   ++  L + N ++ D   Y        G   +S  L V+   I
Sbjct: 7341 KDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKEPPI 7400

Query: 2798 I-KKPKDVTALENATVAFEVSVSHDTVP--VKWFHKSVEIKPSDKHRLVSERKVHKLMLQ 2854
              KKP  +  L+ A V  E  +   T P  V W+    E++   K++++SE  +  + + 
Sbjct: 7401 FRKKPHPIETLKGADVHLECEL-QGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHIL 7459

Query: 2855 NISPSDAGEY----TAVVGQLECKAKLFVET-LHITKTMKNIEVPETKTASFECEVSHFN 2909
            N+  +D GEY    T  VG   C   + ++      K + +I     K    +  +    
Sbjct: 7460 NVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAE 7519

Query: 2910 -VPSMWLKN-GVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGND----QVSAT 2963
             +  +W K+ G  +  S+   I     +  L        ++ +YT    ND    +  AT
Sbjct: 7520 PISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQECFAT 7579

Query: 2964 LTV-TPIMITSMLKDINAEEKDTITFEVTV-NYEGISYKWLKNGVEIKSTDKCQMRTKKL 3021
            L+V  P  I    + I     DT T E TV     +S KW K+G E+ S +K ++     
Sbjct: 7580 LSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNK 7639

Query: 3022 THSLNIRNVHFGDAADYTF----VAGKATSTATLYVEARHI--EFRKHIKDIKVLEKKRA 3075
               L I NV   D+  Y+F      GK + TA+L V  R +   F + +K+   L     
Sbjct: 7640 VSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSV 7699

Query: 3076 MFECEV-SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVV---- 3130
            + EC+V   P I+V W  +  E+    + +         L +     SD+G YT +    
Sbjct: 7700 VMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNM 7759

Query: 3131 AGGNVSTAKL-------FVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDG 3183
            AG +  +A L       FV+  D         V      +    F V+       W+K  
Sbjct: 7760 AGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVS-------WFKGS 7812

Query: 3184 IEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV----AGRNRSSVTLYVNAPEPP 3239
             E+     +R    +E  +  + + +   S +GEYT +    AG+   +  LY+ A  P 
Sbjct: 7813 SEL--VPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKA--PA 7868

Query: 3240 QVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLI 3299
            + ++ L   +++ GKP       +G P   ++W K    ++   +C      +   L + 
Sbjct: 7869 KFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIP 7928

Query: 3300 EAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEG 3359
             +  EDA  Y C  +N  G  + SA + +             + PP  +  L+    S G
Sbjct: 7929 SSTVEDAGQYNCYIENASGKDSCSAQILI-------------LEPPYFVKQLEPVKVSVG 7975

Query: 3360 QPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVA 3418
              A  QC+++GT ++ VSWY  D K++P+  ++M    +   L   +    D G Y   A
Sbjct: 7976 DSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKA 8035

Query: 3419 SNAVGQVSSTANLSLE---APESILHERIEQEIEMEMKELF---------------SEGE 3460
             N+VG+VS++  L+++    P S   +  + +  + +  +F                +G+
Sbjct: 8036 ENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGK 8095

Query: 3461 SEHSERDTRDAFSDSEDIDHKSMAAKRYASRISSTSSWP--------------EYFKPSF 3506
                  + + +F D+    +     +  A + S T++ P                  P F
Sbjct: 8096 PLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFF 8155

Query: 3507 TQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLE 3566
              +L     + GE   F C +      +++W  ++R I +G     K +     +S+ L 
Sbjct: 8156 DIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSG----GKYQISYLENSAHLT 8211

Query: 3567 IKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLKRAERTHENVEALVER 3626
            + +V   DSG Y   A+N  G    TA L + ++        F KR   T E  E    +
Sbjct: 8212 VLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPP---SFTKRLSETVEETEGNSFK 8268

Query: 3627 GEDRI 3631
             E R+
Sbjct: 8269 LEGRV 8273



 Score =  389 bits (1000), Expect = e-107
 Identities = 531/2397 (22%), Positives = 886/2397 (36%), Gaps = 391/2397 (16%)

Query: 940  VTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIAR 999
            + PP+ +  LK+V  I G SV LEC +SG    +V W+++  +I S    Q +F   +  
Sbjct: 6738 IVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCT 6797

Query: 1000 LMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVES 1059
            L +      D+G +TC A N AG+   S  L VQ    FE+   +V              
Sbjct: 6798 LNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPSFEQTPDSV-------------- 6843

Query: 1060 RDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSG 1119
                                            +++ G S+ F   + G P   V W K  
Sbjct: 6844 --------------------------------EVLPGMSLTFTSVIRGTPPFKVKWFKGS 6871

Query: 1120 VPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYEL 1179
              L  G    +S      E +L        ++G+Y+ +V N  G  S +  L        
Sbjct: 6872 RELVPGESCNISLEDFVTELELFEVQPL--ESGDYSCLVTNDAGSASCTTHL-------- 6921

Query: 1180 LMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTY 1239
                            FV+EP        FV    +   E    ++ +     T  +   
Sbjct: 6922 ----------------FVKEPAT------FVKRLADFSVETGSPIVLEATYTGTPPISVS 6959

Query: 1240 VEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDG------EEKMAVDISE---SEAVE 1290
                E+ IS  E   I   E   I   LE  +E+        E +   DI E   S    
Sbjct: 6960 WIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENEAGQDICEALVSVLEP 7019

Query: 1291 SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLR 1350
              F   +++   + G   T  CK+ G P  +I+WYK+  +++    Y+M F ++  ASL 
Sbjct: 7020 PYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQF-KNNVASLV 7078

Query: 1351 IPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIR----SLS 1406
            I  V   D G Y+  A N  G A+ S  + V  A  L  P +   L+ V        +  
Sbjct: 7079 INKVDHSDVGEYSCKADNSVG-AVASSAVLVIKARKL-PPFFARKLKDVHETLGFPVAFE 7136

Query: 1407 PRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLE--ETDESQL------------- 1451
             R     P+++S  +        A +  + +     L+  +TD+S +             
Sbjct: 7137 CRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGT 7196

Query: 1452 ----------ERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDY 1501
                      E    P F LKPVS     G++  F   V G    +  W  D ++I    
Sbjct: 7197 ASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGG 7256

Query: 1502 THKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEK 1561
             +K+ + E+ T +L ++     D+G++T  A N AG+ S S  L V     Q  P F++K
Sbjct: 7257 NYKMTLVEN-TATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGV-----QEPPRFIKK 7310

Query: 1562 LKNVNI---KEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKID 1618
            L+   I    E +R E K+   G+P   ++W K+   I   +  K R+      A L++ 
Sbjct: 7311 LEPSRIVKQDEFTRYECKIG--GSPEIKVLWYKDETEI--QESSKFRMSFVDSVAVLEMH 7366

Query: 1619 STVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELE 1678
            +   +DS  YT  A N AG  ++   + V+                              
Sbjct: 7367 NLSVEDSGDYTCEAHNAAGSASSSTSLKVK------------------------------ 7396

Query: 1679 PLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEW 1738
                                  + P F+KK   +   +    H EC L   G P   V W
Sbjct: 7397 ----------------------EPPIFRKKPHPIETLKGADVHLECELQ--GTPPFHVSW 7432

Query: 1739 LHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEK 1798
              D + L +  + ++++E    S+      + D G   C+ATN  G+D    ++ +K   
Sbjct: 7433 YKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPP 7492

Query: 1799 SLVE-----------ESQLPEGRKGLQ--------------------------RIEELER 1821
              V+           E QL    +G +                           I  L+ 
Sbjct: 7493 RFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQF 7552

Query: 1822 MAHEGALTGVTTDQKEK--------------QKPDIVLYPEPVRVLEGETARFRCRVTGY 1867
               E A  G  T Q +               +   IV  PE ++V  G+T    C V G 
Sbjct: 7553 SRVEPANAGKYTCQIKNDAGMQECFATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGT 7612

Query: 1868 PQPKVNWYLNGQLIRKSKRFRVR-YDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVK 1926
            P+    W+ +G+ +    ++++  ++ +  L I++            A +  GV   +V+
Sbjct: 7613 PELSTKWFKDGKELTSDNKYKISFFNKVSGLKIIN-----------VAPSDSGVYSFEVQ 7661

Query: 1927 LEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERIT 1986
              + +     S+                       Q  DR V  + T+   KLK    ++
Sbjct: 7662 NPVGKDSCTASL-----------------------QVSDRTVPPSFTR---KLKETNGLS 7695

Query: 1987 HEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELT 2046
               V  E +   S     +   ++E     E+ S +K   Y+  L    D     T  + 
Sbjct: 7696 GSSVVMECKVYGSP--PISVSWFHEGN---EISSGRK---YQTTLT---DNTCALTVNML 7744

Query: 2047 EEEKKALAEEGKIT-IPTFKPDKIELSPSM---EAPKIFERIQSQTVGQGSDAHFRVRVV 2102
            EE     ++ G  T I T      E S  +   E P   ++     V  G++  F   V 
Sbjct: 7745 EE-----SDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVK 7799

Query: 2103 GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSS 2162
            G P     W+K   ++   DR      ED+V EL + DV    S        N AG+ S 
Sbjct: 7800 GTPPFSVSWFKGSSELVPGDRCNVSL-EDSVAELELFDVDTSQSGEYTCIVSNEAGKASC 7858

Query: 2163 HAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRM 2222
               L ++A     F + L D   ++   +      T  P + V W K+G+ V    +  +
Sbjct: 7859 TTHLYIKAPA--KFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNI 7916

Query: 2223 HSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESY 2282
             +  K   L I +    DA  Y+C +       + +  I+      FVK+L+ ++V    
Sbjct: 7917 TTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGD 7976

Query: 2283 SGELEC-IVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVID 2341
            S  L+C +     I   WY  D +L+    Y +  R     L    V   D GEY    +
Sbjct: 7977 SASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAE 8036

Query: 2342 GK------KTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVS-LESVEGVWMKDGQE 2394
                     T   ++ +  P +  + L D +   G  V  +  +S  E +   W KDG+ 
Sbjct: 8037 NSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKP 8096

Query: 2395 VQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIP-ALGLSTSGRVSVYSVDVITPLKD 2453
            ++ S  V       +  L I    +  AG YS T    +G ++S    + +     P  D
Sbjct: 8097 LKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFD 8156

Query: 2454 -----VNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTH 2508
                 V+ + G  A  EC V+      V W  +  +I+   + Q         L + +  
Sbjct: 8157 IRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVD 8216

Query: 2509 ASDEGPYKLI----VGRVETNCNLSVEKIKIIRGLRDL---TCTETQNVVFEVELSHSG- 2560
              D G Y       VG+      L++++  I          T  ET+   F++E   +G 
Sbjct: 8217 KGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGS 8276

Query: 2561 --IDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVA 2618
              I V W   + EI+P+S  +I        L V     +D G YT     +  S  L  +
Sbjct: 8277 QPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSA-LCTS 8335

Query: 2619 GGAISKP---------LTDQTVAESQEAVFECEVANPDS-KGEWLRDGKHLPLTNNIRSE 2668
               I +P         LT  TV+E +     C V   +  + +WL+ G+ +  ++     
Sbjct: 8336 SIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFS 8395

Query: 2669 SDGHKRRLIIAATKLDDIGEYTYKVA------TSKTSAKLKVEAVKIKKTLK-------- 2714
                   L +      D G+Y  K +      T+K+   +K +      T K        
Sbjct: 8396 FASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLF 8455

Query: 2715 ------NLTVTETQDAVFTVELTHPNVKGVQWIKNGV-VLESNEKYAISVKGTIYSLRIK 2767
                  ++ V E   A F  ++    +  V+W K     L    +  I  KG    L I+
Sbjct: 8456 FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIR 8515

Query: 2768 NCAIVDESVYGF----RLGRLGASARLHVETVKIIKKPK-DVTALENATVAFEVSVSHDT 2822
            +    D  +Y        G + ++  L V+  K  +K + D+ A+   T   +     + 
Sbjct: 8516 DTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGAGEEE 8575

Query: 2823 -VPVKWFHKSVEIKPSDKHRLV-------------------SERKVHKLMLQNISPS--D 2860
             + +    K+V+ K  +K+  +                    E + H+L ++ I  S  D
Sbjct: 8576 EIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIERSERD 8635

Query: 2861 AGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSM---WLKN 2917
              E+  +V  ++ +     E + + K ++N  V +   A FE ++   N P +   W K 
Sbjct: 8636 EKEFEELVSFIQQRLSQ-TEPVTLIKDIENQTVLKDNDAVFEIDIK-INYPEIKLSWYKG 8693

Query: 2918 GVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKD 2977
              ++E S+KF+I + G  H L + N   +D   Y  VCG    SA LTV        L+D
Sbjct: 8694 TEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAWERHLQD 8753

Query: 2978 INAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAAD 3037
            +  +E  T T     +   +  +W +NG  +K   + +   +   H L I +V   D   
Sbjct: 8754 VTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQ 8813

Query: 3038 YTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL 3097
            YT       ++A L +EA  I+F K I++I V E + A FECEVS  D  V W K   EL
Sbjct: 8814 YTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPTEL 8873

Query: 3098 QITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA-----GGNVSTAKLFVEGRDVRI 3149
              + +   + +   H + I +    D G Y+V+A     G   STA+L++  +++++
Sbjct: 8874 TESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKL 8930



 Score =  385 bits (988), Expect = e-106
 Identities = 670/3179 (21%), Positives = 1182/3179 (37%), Gaps = 456/3179 (14%)

Query: 1287 EAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGR 1346
            EA    F   IK+ ++LE     F C++S  P   + W KD + ++  +R ++   +   
Sbjct: 3054 EARHIEFRKHIKDIKVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQ-KEKYV 3111

Query: 1347 ASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAA--------------------- 1385
              L IP     D G YT  A    G  + + KL+VE                        
Sbjct: 3112 HRLLIPSTRMSDAGKYTVVA----GGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVE 3167

Query: 1386 ------PLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRM--SPARMSPARMSPARMSPARM 1437
                   + A  Y   +E   +++      V R   RM  S  R S A          R 
Sbjct: 3168 FEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRS 3227

Query: 1438 SPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQI 1497
            S    +   +  Q+ +  +PV V          G+ ARF   + GRP P+  W+ + Q +
Sbjct: 3228 SVTLYVNAPEPPQVLQELQPVTVQS--------GKPARFCAVISGRPQPKISWYKEEQLL 3279

Query: 1498 VNDYTHKVVIKEDGTQ-SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVE----H 1552
               +  K +   DG + +L+++ A P D+  +T  A+N  G ++ S  L+VE  E     
Sbjct: 3280 STGFKCKFL--HDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPD 3337

Query: 1553 QVKPMF----VEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEG 1608
            Q  P++    +  L++    EG     + R +G  +  + W      I P ++   R+  
Sbjct: 3338 QEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRF--FRMTQ 3394

Query: 1609 TKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYR 1668
             +    L+I     +D   YT  A N  G+ ++   +++E                    
Sbjct: 3395 FEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLE-------------------- 3434

Query: 1669 AKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTP 1728
                 APE   LH R  QE        + E +  P  K+K+  L +     A F C +  
Sbjct: 3435 -----APE-SILHERIEQE-------IEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQS 3481

Query: 1729 IGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHT 1788
               P +  +W   G+ +  +++  + +     SL+       D G  TC+A+N+YG+   
Sbjct: 3482 A--PNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSC 3539

Query: 1789 SATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPE 1848
            +ATL V                                          E   P  +  P+
Sbjct: 3540 TATLTVT-----------------------------------------EAYPPTFLSRPK 3558

Query: 1849 PVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVR-YDGIHYLDIVDCKSYDT 1907
             +    G+ A+F C VTG P  +  W  +G  +  S  +R+   +  H L++ +    D 
Sbjct: 3559 SLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDR 3618

Query: 1908 GEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRP 1967
            G     A N  G    + +L I  +  F   L    EP  +  +++   L+ +V + DR 
Sbjct: 3619 GVYSCKASNKFGADICQAELIIIDKPHFIKEL----EP-VQSAINKKVHLECQVDE-DRK 3672

Query: 1968 VDTTETKEVVKLKRAE--RITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKS----- 2020
            V  T +K+  KL   +  +I  E      E   +K K   + G Y    + E  S     
Sbjct: 3673 VTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLK---DSGTYVCTASNEAGSSSCSA 3729

Query: 2021 -----------RKKDESYEELLRKTKDELLH------------W---TKELTEEEKKALA 2054
                       +K D SY  L+   +   LH            W    KEL+E     + 
Sbjct: 3730 TVTVREPPSFVKKVDPSY--LMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMY 3787

Query: 2055 EEGKITIPTFKPDKIELSPSM--------------------EAPKIFERIQSQTVGQGSD 2094
                  I      K+E S S                     E P   + ++   + +G++
Sbjct: 3788 FVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTN 3847

Query: 2095 AHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAI 2154
            A  +  V G    E  W+K+  +I  S +   +  +  VC L I    + D         
Sbjct: 3848 ALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVC-LEIFSFNSADVGEYECVVA 3906

Query: 2155 NIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEV 2214
            N  G+    A  L+  K+  TF +++ D++A    T+           + V W K    +
Sbjct: 3907 NEVGKCGCMATHLL--KEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVI 3964

Query: 2215 HEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQ 2274
             E  K +M     V  L I  +  S    Y+C+   +   +T+   ++     + ++  +
Sbjct: 3965 REDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAE 4024

Query: 2275 DIEVPESYSGELECIVS--PENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKED 2332
             I+V       LE  V+  PE ++ KWY +   L ++ KY I+ +     L        D
Sbjct: 4025 LIQVTAGDPATLEYTVAGTPE-LKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHD 4083

Query: 2333 QGEYSFVIDGK--KTTCK--LKMKPRPIA--ILQGLSDQKVCEGDIVQLEVKVSLESVEG 2386
             G+Y+F I  +   ++C+    +  R IA    + L +         +L+ K++      
Sbjct: 4084 SGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMR 4143

Query: 2387 V-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSF--TIPALGLSTSGRVSVY 2443
            V W KDG+E+  SDR  I   + +  L I  +   DAGN++   T       +SG + V 
Sbjct: 4144 VSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQ 4203

Query: 2444 SV-DVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRL 2502
                 +T     +V+ G+   L+         +++W+  ++++          +  +  L
Sbjct: 4204 EPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSL 4263

Query: 2503 VINRTHASDEGPYKL----IVGRVETNCNLSV-------EKIKIIRGLRDLTCTETQNVV 2551
             +     SD G Y      + G VE + NL V       EK++  + L+    T+    V
Sbjct: 4264 ELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLACKV 4323

Query: 2552 FEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA----- 2606
                     I + W   D+EIK SSK+++        L + ++  +D G+Y   A     
Sbjct: 4324 ----TGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAG 4379

Query: 2607 GENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVAN-PDSKGEWLRDGKHLPLTNNI 2665
             ++ +S  +       +K      V +  + +   EVA  P  +  W +D   L      
Sbjct: 4380 SDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKY 4439

Query: 2666 RSESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSAKLKV-EAVKIKKTLKNLTVTE 2720
            ++    H   L I      D GEY    T +V +S  SA++ + E     K +++ +   
Sbjct: 4440 KTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLR 4499

Query: 2721 TQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFR 2780
               A F   L       V W+K+   +  ++   ++ +  + SL +    +  +  Y  +
Sbjct: 4500 GGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQ 4559

Query: 2781 L----GRLGASARLHVETVKIIKKPK---DVTALENATVAFEVSVSHDTVPVKWFHKSVE 2833
                 G    SA L V+    I +     DVT  + AT+  + S + + +  KWF    E
Sbjct: 4560 AKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKE-ITAKWFKDGQE 4618

Query: 2834 IKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVV----GQLECKAKLFVETLHI----T 2885
            +    K+++     V  L + +    D+GEYT  V    G+  CKA++ V  L I    T
Sbjct: 4619 LTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFT 4678

Query: 2886 KTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTS 2944
            K +K ++  +      EC V+  +  S+ W K+  EI  SEK+K         L I    
Sbjct: 4679 KKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLE 4738

Query: 2945 TEDSAEYTFVC----GNDQVSATLTVT--PIMITS-MLKDINAEEKDTITFEVTVNYEGI 2997
              DS  YT       G++Q S  LTV   P  +     +D+N   +  +   V      +
Sbjct: 4739 GTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQLKALVG-GTAPM 4797

Query: 2998 SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFV----AGKATSTATLYV 3053
            + KW K+  E+ S     +     + SL +      D+  Y        G ATS ATL+V
Sbjct: 4798 TIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFV 4857

Query: 3054 EARHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKYVH 3112
            +      +K    + +   +   FEC+++  P I V W  D  E+    +  I     + 
Sbjct: 4858 KEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLA 4917

Query: 3113 RLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGR----DVRIRSIKKEVQVIEKQRAVVEF 3168
               I   R+ ++G Y   A  +  TA   +E +       IR +K  V+V++     +E 
Sbjct: 4918 TFQISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKP-VEVVKYSDVELEC 4976

Query: 3169 EVN-EDDVDAHWYKDGIEINFQVQERHKYVVERRIH--RMFISETRQSDAGEYTFVAGRN 3225
            EV      +  W K+    N +++   KY +  R+    + I++   SD GEY  +    
Sbjct: 4977 EVTGTPPFEVTWLKN----NREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNE 5032

Query: 3226 RSSVTLY--VNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3283
              S +    V   EPP  +++++  T      A F + ++G P   I+W K++Q+L    
Sbjct: 5033 GGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDD 5092

Query: 3284 KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVY 3343
                       TL +       +  YTC+AKN+ GV    A L V+ P            
Sbjct: 5093 NVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPA----------- 5141

Query: 3344 PPAIITPLQDTVTSEGQPARFQCRVSGT-DLKVSWYSKDKKIKPSRFFRMTQFEDTYQLE 3402
               I+   +    +E  P   +C V+GT +LKV W    K+I PSR+F M+   +     
Sbjct: 5142 --QIVEKAKSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFR 5199

Query: 3403 IAEAYPEDEGTYTFVASNAVGQVSSTANLSL---EAPESILHERIEQE------IEMEMK 3453
            I     +D G YTF   N  G  S  A L +     P S   +  + +      I ME K
Sbjct: 5200 IQSVMKQDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECK 5259

Query: 3454 ---------ELFSEGESEHSERDTRDAFSDS-----------EDIDHKSMAAKRYASRIS 3493
                     + F +G+   +    R    +            ED  + +      A   +
Sbjct: 5260 VSGSLPISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDA 5319

Query: 3494 STSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIK 3553
             +        PSF  K   +  +    V F   L   P  ++ WF ++  + +G +  I 
Sbjct: 5320 CSGILTVKEPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDDVELVSGPKCFIG 5379

Query: 3554 AESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLKRA 3613
             E      +S L +  V    +G Y     N  GS   T  LLV +  +  K LE  K  
Sbjct: 5380 LEGS----TSFLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLVTEPPKFVKKLEASK-- 5433

Query: 3614 ERTHENVEALVERGEDRIKVDLRFTGSP------FNKKQDVEQKGMMRTIHFKTMSSAKK 3667
                      + +  D  +++ +  GSP      F  + ++      R     +++  + 
Sbjct: 5434 ----------IVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQM 5483

Query: 3668 TDYMYDE--EYLESKSDIRGWLNVGESFLDKETKVKLQRLREARKTLMEKKKLSLLDTSS 3725
             +   ++  +++    +  G  +     + KE  V       +   ++E  K      ++
Sbjct: 5484 NNLSTEDSGDFICEAQNPAGSTSCSTKVIVKEPPVF-----SSFPPIVETLK------NA 5532

Query: 3726 EISSRTLRSEASDKDILFSREDMKIRSMSDLAESYKVDHSAESIVQNPHALSNQMDQNIE 3785
            E+S     S     ++++ ++  ++RS    ++ YK+  ++++   + H L      N++
Sbjct: 5533 EVSLECELSGTPPFEVVWYKDKRQLRS----SKKYKI--ASKNFHTSIHIL------NVD 5580

Query: 3786 SEELPTSFQTIVDEEIFQTEIRMSQEALVKESLPKDHLYGEILVNENTQARGQLEEIMAN 3845
            + +        + E   + +  +  +  V     K+       +N  T   G+  E+ A+
Sbjct: 5581 TSD--------IGEYHCKAQNEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQAS 5632

Query: 3846 TTIGESSTYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASERIKKDDL 3905
               G    ++  + EKEEV    EN+                 +   E +A+ +  K + 
Sbjct: 5633 IE-GAQPIFVQWLKEKEEVIRESENI----------------RITFVENVATLQFAKAE- 5674

Query: 3906 RELQLSASTRIDEFKTEQ-KEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFV 3964
                 +A   I + K +    ENM              P   +++     V  G++C   
Sbjct: 5675 ---PANAGKYICQIKNDGGMRENMATLMVLE-------PAVIVEKAGPMTVTVGETCTLE 5724

Query: 3965 CHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGT 4024
            C   G P+  V WY +   +  +Q          S L + SV  Q+ G+ T  + N  G 
Sbjct: 5725 CKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVGK 5784

Query: 4025 VKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTNLHLL 4084
               T+++        DV    VP                       PS ++  +    +L
Sbjct: 5785 SSCTAVV--------DVSDRAVP-----------------------PSFTRRLKNTGGVL 5813

Query: 4085 KTNP----PVPPSGDTELLSFPVEIQVTAATPIPEQDKESKEVFQTEELEPKAMPQ---- 4136
              +      V  S    +  F  + ++ +         ++    Q   L+   M      
Sbjct: 5814 GASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCV 5873

Query: 4137 -DQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQN 4195
               V  S + R V       EPP  ++E P+      G ++    +I G P   V WF+ 
Sbjct: 5874 AANVAGSDECRAVLT---VQEPPSFVKE-PEPLEVLPGKNVTFTSVIRGTPPFKVNWFRG 5929

Query: 4196 GVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV-EPVTY 4253
               L +  +      +   +L + +++   SG+Y CV  NN+G     + L V EP  +
Sbjct: 5930 ARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKEPAAF 5988



 Score =  340 bits (871), Expect = 3e-92
 Identities = 517/2392 (21%), Positives = 915/2392 (38%), Gaps = 331/2392 (13%)

Query: 2091 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIM 2150
            +G  A F ++VVG+P PE  W+ +G +I           ED    L+I   T  DS    
Sbjct: 1470 EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWT 1529

Query: 2151 VKAINIAGETSSHAFLLVQAKQLIT---FTQELQDVVAKEKDTMATFECETSEPFVKVKW 2207
            V A N AG +S    L V+A +      F ++L++V  KE   +      T  P   + W
Sbjct: 1530 VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1589

Query: 2208 YK--DGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTT-AKLIVEG 2264
             K  D +  H+  K R+   +    L I +  + D+  Y+   +      TT  K+ VE 
Sbjct: 1590 LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649

Query: 2265 AVVEFVKELQDIEVPESYSGELECIVSPENI----------EGKWYHNDVELKSNGKYTI 2314
               E   E + I    +Y  +       E +          EG  Y  + + K   K  +
Sbjct: 1650 EFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKL 1709

Query: 2315 TSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEG---- 2370
            TS R ++            G   F        C+L     P  +++ L D K  E     
Sbjct: 1710 TSLRLKRF-----------GPAHF-------ECRLTPIGDPTMVVEWLHDGKPLEAANRL 1751

Query: 2371 ------DIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGN 2424
                      L+  V+     G+          +D     +  +    L+E+    +   
Sbjct: 1752 RMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRK 1811

Query: 2425 YSFTIP---------ALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTS 2475
                I          AL   T+ +      D++   + V V+EG  A   C+V+      
Sbjct: 1812 GLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPK 1871

Query: 2476 VKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNCNLSVE 2531
            V WYLN + I+   R +    G     +++   + D G  K+      G +E    L ++
Sbjct: 1872 VNWYLNGQLIRKSKRFRVRYDGIHYLDIVD-CKSYDTGEVKVTAENPEGVIEHKVKLEIQ 1930

Query: 2532 KIKIIRGLR--------DLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAH 2583
            + +  R +         +    E   + FEV+     +D     + KE+    + +   H
Sbjct: 1931 QREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTT---ETKEVVKLKRAERITH 1987

Query: 2584 GKI----YKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVF 2639
             K+     +L      + +EG Y       + S K   +   + +   D+ +  ++E   
Sbjct: 1988 EKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTE 2047

Query: 2640 ECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTS 2699
            E        K     +GK                  + I   K D            K  
Sbjct: 2048 E-------EKKALAEEGK------------------ITIPTFKPD------------KIE 2070

Query: 2700 AKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEK-YAISVK 2758
                +EA KI + +++ TV +  DA F V +        +W KNGV +E +++ Y    +
Sbjct: 2071 LSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPE 2130

Query: 2759 GTIYSLRIKNCAIVDESVYGFRL----GRLGASARLHVETVKII---KKPKDVTALENAT 2811
              +  L I++    D +    +     G   + A L V+  ++I   ++ +DV A E  T
Sbjct: 2131 DNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2190

Query: 2812 VA-FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQ 2870
            +A FE   S   V VKW+   +E+   DK+R+ S+RKVH L +  I  SDA +Y+ V+ +
Sbjct: 2191 MATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2250

Query: 2871 ---LECKAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSE 2925
               ++  AKL VE   +   K +++IEVPE+ +   EC VS  N+   W  N VE++ + 
Sbjct: 2251 DENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNG 2310

Query: 2926 KFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTP--IMITSMLKDINAEEK 2983
            K+ I  +     L + + + ED  EY+FV    + +  L + P  I I   L D    E 
Sbjct: 2311 KYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEG 2370

Query: 2984 DTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAG 3043
            D +  EV V+ E +   W+K+G E++ +D+  +   K +H L I ++   DA +Y+F   
Sbjct: 2371 DIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIP 2430

Query: 3044 KATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDIT-VQWMKDDQELQITDR 3102
                + +  V    ++    +KD+ V+E  +A+ EC+VS PD+T V+W  +D++++  DR
Sbjct: 2431 ALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDR 2490

Query: 3103 IKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQ 3162
            ++   +    RL+I  T  SD G Y ++ G   +   L VE   ++I    +++   E Q
Sbjct: 2491 VQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRDLTCTETQ 2548

Query: 3163 RAVVEFEVNEDDVDAHW-YKDGIEINFQVQERHKYVVER--RIHRMFISETRQSDAGEYT 3219
              V E E++   +D  W +KD      +++   KY +E   +I+++ +    + D G+YT
Sbjct: 2549 NVVFEVELSHSGIDVLWNFKDK-----EIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYT 2603

Query: 3220 FVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARF-CAVISGRPQPKISWYKEEQL 3278
            F AG N +S  L V       + + L   TV   + A F C V +  P  K  W ++ + 
Sbjct: 2604 FYAGENMTSGKLTVAGGA---ISKPLTDQTVAESQEAVFECEVAN--PDSKGEWLRDGKH 2658

Query: 3279 LSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3338
            L      +   DG +  L++     +D   YT      Y VAT+  S  ++V  V     
Sbjct: 2659 LPLTNNIRSESDGHKRRLIIAATKLDDIGEYT------YKVATSKTSAKLKVEAV----- 2707

Query: 3339 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK-VSWYSKDKKIKPSRFFRMTQFED 3397
                    I   L++   +E Q A F   ++  ++K V W      ++ +  + ++    
Sbjct: 2708 -------KIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT 2760

Query: 3398 TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFS 3457
             Y L I      DE  Y F     +G++ ++A L +E  + I  ++ +    +E   +  
Sbjct: 2761 IYSLRIKNCAIVDESVYGF----RLGRLGASARLHVETVKII--KKPKDVTALENATVAF 2814

Query: 3458 EGESEHS-------ERDTRDAFSD-----SEDIDHKSMA-------AKRYASRISSTSSW 3498
            E    H         +      SD     SE   HK M        A  Y + +      
Sbjct: 2815 EVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECK 2874

Query: 3499 PEYFKPSFTQKLTFKY--VLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAES 3556
             + F  +     T K   V E +   F C +     P M W  N   I    +  I  + 
Sbjct: 2875 AKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQG 2933

Query: 3557 DLHHHSSSLEIKRVQDRDSGSYRLLA----------------------INSEGSAESTAS 3594
             LH     L I      DS  Y  +                       IN+E     T  
Sbjct: 2934 KLHQ----LIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFE 2989

Query: 3595 LLVIQKGQDEKYLEF---LKRAERTHENVEALVERGEDRI-----KVDLRFTGSPFNKKQ 3646
            + V  +G   K+L+    +K  ++     + L      R        D  F         
Sbjct: 2990 VTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTA 3049

Query: 3647 D--VEQKGMMRTIHFKTMSSAKKTDYMYDEEYLESKSDIRGWLNVGESFLDKETKVKLQR 3704
               VE + +    H K +   +K   M++ E  E    ++ W+   +  L    ++K+Q+
Sbjct: 3050 TLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQ-WMKDDQE-LQITDRIKIQK 3107

Query: 3705 LREARKTLMEKKKLSLLDTSSEISSRTLRSEASDKDILFSREDMKIRSMSDLAESYKVDH 3764
             +   + L+   ++S     + ++        S   +     D++IRS+    +  +   
Sbjct: 3108 EKYVHRLLIPSTRMSDAGKYTVVAG----GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3163

Query: 3765 SAESIVQNPHALSNQMDQNIESEELPTSFQT------IVDEEI---FQTEIRMSQEALVK 3815
            +      N     + +D +   + +  +FQ       +V+  I   F +E R S      
Sbjct: 3164 AVVEFEVN----EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYT 3219

Query: 3816 ESLPKDHLYGEILVN--ENTQARGQLEEIMANTTIGESSTYITNVCEKEEVYETPENVSQ 3873
                ++     + VN  E  Q   +L+ +   +  G+ + +   +  + +   +     Q
Sbjct: 3220 FVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQS--GKPARFCAVISGRPQPKISWYKEEQ 3277

Query: 3874 AITP-------HASESFGTLVNVEESEEIASERI--KKDDLRELQLSASTRIDEFKTEQK 3924
             ++        H  + + TL+ +E   E A+      K+D      SAS  ++  +    
Sbjct: 3278 LLSTGFKCKFLHDGQEY-TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3336

Query: 3925 EENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPI 3984
            ++ M  +           PP+ +  ++     EG    F C   G     V+WY+ D  I
Sbjct: 3337 DQEMPVY-----------PPAIITPLQDTVTSEGQPARFQCRVSGTDLK-VSWYSKDKKI 3384

Query: 3985 PRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAH 4044
              ++ F +   E+   L ++  + ++EG+ T V  N  G V +T+ L ++A +       
Sbjct: 3385 KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPES------ 3438

Query: 4045 KVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVE 4104
               + H+ +++E E+ +       A P + +         K  P     G   L  F  E
Sbjct: 3439 ---ILHERIEQEIEMEMK------AAPVIKR---------KIEPLEVALG--HLAKFTCE 3478

Query: 4105 IQVT---------AATPIPEQDK----ESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLS 4151
            IQ           A   I E DK     SK +   E L  + +   + T    + +  +S
Sbjct: 3479 IQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVS 3538

Query: 4152 -----DITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQ 4206
                  +T   P      PK      G +    C ++G P     W ++G  L  +  ++
Sbjct: 3539 CTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWR 3598

Query: 4207 FEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV----------EPVTYREN 4256
              +    H L + ++  QD G Y C A N  GA    ++L +          EPV    N
Sbjct: 3599 ISDAENKHILELSNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQSAIN 3658

Query: 4257 S------QFENIGEIYGKYSRDQQLQDQGESVRAHFYDYPAGPFTPWTNVKE 4302
                   Q +   ++   +S+D Q    G+  +  F D  A    P   +K+
Sbjct: 3659 KKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKD 3710



 Score =  331 bits (848), Expect = 1e-89
 Identities = 536/2389 (22%), Positives = 932/2389 (39%), Gaps = 310/2389 (12%)

Query: 1460 VLKPVSFKCL-EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIV 1518
            + KP++ + + E Q A F+ +V   P  +  W  DG+ +    T+ +  + DG +  +I+
Sbjct: 2622 ISKPLTDQTVAESQEAVFECEVAN-PDSKGEWLRDGKHL--PLTNNIRSESDGHKRRLII 2678

Query: 1519 PATPSDS-GEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKV 1577
             AT  D  GE+T     +   S  S  L VEAV+ +      + LKN+ + E       V
Sbjct: 2679 AATKLDDIGEYTY----KVATSKTSAKLKVEAVKIK------KTLKNLTVTETQDAVFTV 2728

Query: 1578 RATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWY--------- 1628
              T      + W+KN  ++  ++   I ++GT    +L+I +    D + Y         
Sbjct: 2729 ELTHPNVKGVQWIKNGVVLESNEKYAISVKGTI--YSLRIKNCAIVDESVYGFRLGRLGA 2786

Query: 1629 ------TATAINKAGRDTTRCKVNVEVEFA-------------------EPEPERKLIIP 1663
                      I K  +D T  + N  V F                    +P  + +L+  
Sbjct: 2787 SARLHVETVKIIKKPKDVTALE-NATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSE 2845

Query: 1664 RGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQ--QKPFFKKKLTSLRLKRFGPAH 1721
            R  ++   +    + P     G+     G L  K K   +     K + ++ +     A 
Sbjct: 2846 RKVHK---LMLQNISPSDA--GEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKTAS 2900

Query: 1722 FECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATN 1781
            FEC ++    P+M   WL +G  +E + + +++ +     L      + DS   T     
Sbjct: 2901 FECEVSHFNVPSM---WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVC-- 2955

Query: 1782 KYGTDHTSATLIVK-------------DEKSLV--EESQLPEG--RKGLQRIEELE---- 1820
              G D  SATL V              +EK  +  E +   EG   K L+   E++    
Sbjct: 2956 --GNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDK 3013

Query: 1821 ------RMAHE------------------GALTGVTTDQKEKQKPDIVLYPEPVRVLEGE 1856
                  ++ H                   G  T   T   E +  +   + + ++VLE +
Sbjct: 3014 CQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKK 3073

Query: 1857 TARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAE 1915
             A F C V+  P   V W  + Q ++ + R +++ +  +H L I   +  D G+  V A 
Sbjct: 3074 RAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAG 3132

Query: 1916 NPEGVIE----------HKVKLEIQQREDFRSVLR-RAPEPRPEFHVHEPG-KLQFEVQK 1963
                  +            +K E+Q  E  R+V+     E   + H ++ G ++ F+VQ+
Sbjct: 3133 GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQE 3192

Query: 1964 -----VDRPV-----------DTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEE 2007
                 V+R +           D  E   V    R+    +   PE  + L+       + 
Sbjct: 3193 RHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQS 3252

Query: 2008 GYYEAITAVELKSRKKDESY--EELLRKT--KDELLHWTKELTEEEKKALAEEGKITIPT 2063
            G      AV     +   S+  EE L  T  K + LH  +E T    +A  E+  +    
Sbjct: 3253 GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCE 3312

Query: 2064 FKPD----------KIEL----SPSMEAP----KIFERIQSQTVGQGSDAHFRVRVVGKP 2105
             K D           +E+    SP  E P     I   +Q     +G  A F+ RV G  
Sbjct: 3313 AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGT- 3371

Query: 2106 DPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAF 2165
            D +  WY    KI+ S R +     ++  +L I +   ED  +    A N  G+ SS A 
Sbjct: 3372 DLKVSWYSKDKKIKPS-RFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3430

Query: 2166 LLVQAKQLITFTQELQDVVAKEKDT----------------MATFECET-SEPFVKVKWY 2208
            L ++A + I   +  Q++  + K                  +A F CE  S P V+ +W+
Sbjct: 3431 LSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWF 3490

Query: 2209 KDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDE-NVKTTAKLIV-EGAV 2266
            K G E++E DK  + S + +  L IL     D  +Y+C    +  +V  TA L V E   
Sbjct: 3491 KAGREIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYP 3550

Query: 2267 VEFVKELQDIEVPESYSGELECIVSPEN-IEGKWYHNDVELKSNGKYTITSRRGRQNLTV 2325
              F+   + +      + +  C V+    IE  W  +   L  +  + I+    +  L +
Sbjct: 3551 PTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILEL 3610

Query: 2326 KDVTKEDQGEYSFVIDGK--KTTCKLKM----KPRPIAILQGLSDQKVCEGDIVQLEVKV 2379
             ++T +D+G YS     K     C+ ++    KP  I  L+ +          V LE +V
Sbjct: 3611 SNLTIQDRGVYSCKASNKFGADICQAELIIIDKPHFIKELEPVQS---AINKKVHLECQV 3667

Query: 2380 SLE-SVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSG 2438
              +  V   W KDGQ++ P     I  + +   L I     +D+G Y  T      S+S 
Sbjct: 3668 DEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSC 3727

Query: 2439 RVSVYSVDVITPLKDVN----VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAI 2494
              +V   +  + +K V+    ++ G  A L CK+    V  V W+ N++++   + V+  
Sbjct: 3728 SATVTVREPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMY 3787

Query: 2495 VKGTKQRLVINRTHASDEGPYKL-IVGRVETN-CNLSV---EKIKIIRGLRDLTCTETQN 2549
               ++  L I      D G Y    V  V ++ C+  +   E    I+ L         N
Sbjct: 3788 FVNSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPADIVRGTN 3847

Query: 2550 VVFEVELSHSG-IDVLWNFKDK-EIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAG 2607
             + + E+S +G  ++ W FKDK +I+ S KY++ +   +  L + +    D G+Y     
Sbjct: 3848 ALLQCEVSGTGPFEISW-FKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVA 3906

Query: 2608 ENMTSGKL-TVAGGAISKPLT------DQTVAESQEAVFECEVANPDSKG-EWLRDGKHL 2659
              +  GK   +A   + +P T      D      Q    +  V   +     W++  + +
Sbjct: 3907 NEV--GKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVI 3964

Query: 2660 PLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKV---ATSKTSAKLKV--EAVKIKKTLK 2714
                 I+         LII   ++   G+YT      A S+TS    +  E  KI +  +
Sbjct: 3965 REDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAKIIERAE 4024

Query: 2715 NLTVTETQDAV--FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIV 2772
             + VT    A   +TV  T P +K  +W K+G  L +++KY IS K  +  L+  +  + 
Sbjct: 4025 LIQVTAGDPATLEYTVAGT-PELKP-KWYKDGRPLVASKKYRISFKNNVAQLKFYSAELH 4082

Query: 2773 DESVYGFRLGR-LGASARLHVETV------KIIKKP-KDVTALENATVAFEVSVSHDT-V 2823
            D   Y F +   +G+S+     TV          KP ++V ++ N T   +  ++    +
Sbjct: 4083 DSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPM 4142

Query: 2824 PVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTA----VVGQLECKAKLFV 2879
             V WF    EI  SD++R+        L +  +  +DAG +T      VG  +    L V
Sbjct: 4143 RVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIV 4202

Query: 2880 ET--LHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQ 2937
            +     +TK      +P +             +   W K   E+       I  +     
Sbjct: 4203 QEPPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESS 4262

Query: 2938 LIIMNTSTEDSAEYTF----VCGNDQVSATLTVT-PIMITSMLKDINAEEKDTITFEVTV 2992
            L +    T DS  YT     V G  + SA L V  P      L+     +K   T ++  
Sbjct: 4263 LELYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDAT-QLAC 4321

Query: 2993 NYEG---ISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATST- 3048
               G   I   W  N  EIK + K +M   + T  L + +V   D+ +Y   A     + 
Sbjct: 4322 KVTGTPPIKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSD 4381

Query: 3049 --ATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVS-EPDITVQWMKDDQELQITDRIKI 3105
              +++ +      F K  K I+VL++   M   EV+  P   + W KD+  L+   + K 
Sbjct: 4382 HCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKT 4441

Query: 3106 QKEKYVHRLLIPSTRMSDAGKY----TVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEK 3161
              + ++  L I     +DAG+Y    T   G ++ +A++ +      I+ I+    +   
Sbjct: 4442 FIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGG 4501

Query: 3162 QRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV 3221
              A          +   W KD  EI     +  +   E  +  +++S       G+Y   
Sbjct: 4502 TAAFQATLKGSLPITVTWLKDSDEIT--EDDNIRMTFENNVASLYLSGIEVKHDGKYVCQ 4559

Query: 3222 A----GRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQ 3277
            A    G  R S  L V   EP  + +E   + V  G PA      SG  +    W+K+ Q
Sbjct: 4560 AKNDAGIQRCSALLSVK--EPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQ 4617

Query: 3278 LLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPD 3337
             L+ G K K         L +I    +D+  YT E +ND G ++  A ++V         
Sbjct: 4618 ELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDL------ 4671

Query: 3338 QEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD-LKVSWYSKDKKIKPSRFFRMTQFE 3396
                + PP+    L+   + +G     +C V+G+  + + W+  D++I  S  ++ +  +
Sbjct: 4672 ----IIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEKYKFSFHD 4727

Query: 3397 DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEI----EMEM 3452
            +T  LEI++    D GTYT  A+N  G    + +L+++ P   + +   Q++     +++
Sbjct: 4728 NTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKEPPYFVEKPQSQDVNPNTRVQL 4787

Query: 3453 KEL-----------FSEGESEHSERDTRDAFSDSEDIDHKSMAAK-----RYASRIS--- 3493
            K L           F + +  HS    R  + D      +  AAK      Y  ++S   
Sbjct: 4788 KALVGGTAPMTIKWFKDNKELHSGA-ARSVWKDDTSTSLELFAAKATDSGTYICQLSNDV 4846

Query: 3494 --STSSWPEYFK--PSFTQKLTFKYVL-EGEPVVFTCRLIACPTPEMTWFHNNRPIPTGL 3548
              +TS    + K  P F +K +   VL  G+   F C++   P   ++W+ +   I    
Sbjct: 4847 GTATSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQ 4906

Query: 3549 RRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLV 3597
            +  I     L    ++ +I   +  +SG+Y   A N  G+A  +  L V
Sbjct: 4907 KHGISFIDGL----ATFQISGARVENSGTYVCEARNDAGTASCSIELKV 4951



 Score =  310 bits (795), Expect = 2e-83
 Identities = 402/1824 (22%), Positives = 706/1824 (38%), Gaps = 316/1824 (17%)

Query: 942  PPTLVSGLKNVTVIEGESVT-LECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 1000
            PP  +  L+   +++ +  T  EC I G P   V WY+++ +I+ S  F+++F   +A L
Sbjct: 7304 PPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVL 7363

Query: 1001 MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESR 1060
             +     EDSG +TC A N AG+ S+S  L V+                           
Sbjct: 7364 EMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVK--------------------------- 7396

Query: 1061 DVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1120
                             EP  P F  KP   + ++G  V   C++ G P  HV W K   
Sbjct: 7397 -----------------EP--PIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKR 7437

Query: 1121 PLTTGYRYKV-SYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYEL 1179
             L +G +YK+ S N  T    + I    A D GEY     N  G  +   S+  +A    
Sbjct: 7438 ELRSGKKYKIMSENFLTS---IHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRF 7494

Query: 1180 LMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTY 1239
            + K        T V   VQ     E A       ++ + E    ++R+    D + + +Y
Sbjct: 7495 VKKLSD---ISTVVGKEVQLQTTIEGAEPISVVWFKDKGE----IVRES---DNIWI-SY 7543

Query: 1240 VEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKN 1299
             E+    I++ +      +E         ++  + G ++    +S  E        + ++
Sbjct: 7544 SEN----IATLQ---FSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPAT--IVEKPES 7594

Query: 1300 YRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDE 1359
             ++  G   T  C ++G P     W+KDGK +    +Y++ F     + L+I  V P D 
Sbjct: 7595 IKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFFNKV-SGLKIINVAPSDS 7653

Query: 1360 GIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSP----RSVSRSPI 1415
            G+Y+    N  G   C+  L V        P++   L+  + +   S     +     PI
Sbjct: 7654 GVYSFEVQNPVGKDSCTASLQVSDRTV--PPSFTRKLKETNGLSGSSVVMECKVYGSPPI 7711

Query: 1416 RMS----PARMSPARMSPARMSPARMS-PGRRLEETDESQ-----------------LER 1453
             +S       +S  R     ++    +     LEE+D                    L  
Sbjct: 7712 SVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPLTV 7771

Query: 1454 LYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQ 1513
               P FV KP     L G    F   V G P     WF    ++V      V + ED   
Sbjct: 7772 REPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSL-EDSVA 7830

Query: 1514 SLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRL 1573
             L +     S SGE+T +  N AG++S +  L ++A        FV++L + +I++G  L
Sbjct: 7831 ELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKA-----PAKFVKRLNDYSIEKGKPL 7885

Query: 1574 EMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAI 1633
             ++   TG P   + W KN   + P +  +  I  T+  A L+I S+  +D+  Y     
Sbjct: 7886 ILEGTFTGTPPISVTWKKNGINVTPSQ--RCNITTTEKSAILEIPSSTVEDAGQYNCYIE 7943

Query: 1634 NKAGRDTTRCKVNVEVEFAEP-------EPERKLIIPRGTYRAKEIAAPE---------- 1676
            N +G+D+   ++ +     EP       EP +  +    + + +    PE          
Sbjct: 7944 NASGKDSCSAQILI----LEPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDT 7999

Query: 1677 -LEP-----LHLRYGQEQ--WEEGDLYD-----------------------KEKQQKPFF 1705
             L P     +H R       + + D+ D                       +E++  P F
Sbjct: 8000 KLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSF 8059

Query: 1706 KKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYG 1765
             ++L  ++     P  F+C ++  G   + V W  DGKPL+ +  ++        +L+  
Sbjct: 8060 SRQLRDVQETVGLPVVFDCAIS--GSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIF 8117

Query: 1766 VAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHE 1825
                  +G  +C ATN  G+  +SA LI            L EG                
Sbjct: 8118 KTDRSLAGQYSCTATNPIGSASSSARLI------------LTEG---------------- 8149

Query: 1826 GALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK 1885
                        K  P   +   PV  + GE+A F C VTG    KV+W  + + IR   
Sbjct: 8150 ------------KNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGG 8197

Query: 1886 RFRVRY-DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPE 1944
            ++++ Y +   +L ++     D+G+    A N  G      +L I++R    S  +R  E
Sbjct: 8198 KYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSE 8257

Query: 1945 PRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRR 2004
               E   +   KL+  V    +P+     K  ++++          P  + E+   FK  
Sbjct: 8258 TVEETEGNS-FKLEGRVAG-SQPITVAWYKNNIEIQ----------PTSNCEIT--FKNN 8303

Query: 2005 TEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTF 2064
            T          + L+ RK   +   L          +T +++ +   AL     +     
Sbjct: 8304 T----------LVLQVRKAGMNDAGL----------YTCKVSNDAGSALCTSSIVIKEPK 8343

Query: 2065 KPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRI 2124
            KP           P   + +   TV +G        V G      +W K G +I+ SDR 
Sbjct: 8344 KP-----------PVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRC 8392

Query: 2125 YWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLIT--------- 2175
             + +       L +RDV   DS   + KA N+AG  ++ + + ++ K  +          
Sbjct: 8393 SFSF-ASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVD 8451

Query: 2176 ----FTQELQDVVAKEKDTMATFECETSEPFVKVKWYK-DGMEVHEGDKYRMHSDRKVHF 2230
                F  E Q +   EK T         +P   VKW K    ++++G +  +H       
Sbjct: 8452 GRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAK 8511

Query: 2231 LSILTIDTSDAEDYSCVLV-EDENVKTTAKLIV---------EGAVVEFVKELQDIEVPE 2280
            L I     +D+  Y CV   E   +++   L V         EG +   +K+   ++   
Sbjct: 8512 LEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGA 8571

Query: 2281 SYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRG---------------RQNLTV 2325
                E++ +   +N++ K Y     +     Y IT  RG                  L +
Sbjct: 8572 GEEEEIDIMELLKNVDPKEYEKYARM-----YGITDFRGLLQAFELLKQSQEEETHRLEI 8626

Query: 2326 KDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGD--IVQLEVKVSLES 2383
            +++ + ++ E  F         +L  +  P+ +++ + +Q V + +  + ++++K++   
Sbjct: 8627 EEIERSERDEKEFEELVSFIQQRLS-QTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPE 8685

Query: 2384 VEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVY 2443
            ++  W K  ++++PSD+  I ID   H L +++   +D GNY        L     ++  
Sbjct: 8686 IKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYR-------LVCGPHIASA 8738

Query: 2444 SVDVITP-----LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGT 2498
             + VI P     L+DV + EG    + C+ SVP+V S +W+ N   +KP  R +  V+  
Sbjct: 8739 KLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKS-EWFRNGRILKPQGRHKTEVEHK 8797

Query: 2499 KQRLVINRTHASDEGPYKLIVGRVETNCNLSV--EKIKIIRGLRDLTCTETQNVVFEVEL 2556
              +L I    A D+G Y      +ET+  L +  E I+  + ++++  +E Q+  FE E+
Sbjct: 8798 VHKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEV 8857

Query: 2557 SHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA-----GENMT 2611
            S     V W     E+  S KY     G+ + +T+ N+  DDEG Y+  A     GE  +
Sbjct: 8858 SFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARS 8917

Query: 2612 SGKLTVAGGAISKPLTDQTVAESQ 2635
            + +L +    I   L    + +S+
Sbjct: 8918 TAELYLTTKEIKLELKPPDIPDSR 8941



 Score =  260 bits (665), Expect = 2e-68
 Identities = 336/1516 (22%), Positives = 588/1516 (38%), Gaps = 182/1516 (12%)

Query: 2078 PKIFERIQSQTVG-QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCEL 2136
            P  F R   +T G  GS      +V G P     W+  G +I  S R Y     DN C L
Sbjct: 7681 PPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEIS-SGRKYQTTLTDNTCAL 7739

Query: 2137 VIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFEC 2196
             +  +   DS      A N+AG     A L V+         +  DV+     T  +   
Sbjct: 7740 TVNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVK 7799

Query: 2197 ETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKT 2256
             T  P   V W+K   E+  GD+  +  +  V  L +  +DTS + +Y+C++  +    +
Sbjct: 7800 GT--PPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKAS 7857

Query: 2257 TAKLIVEGAVVEFVKELQDIEVPESYSGELE-CIVSPENIEGKWYHNDVELKSNGKYTIT 2315
                +   A  +FVK L D  + +     LE        I   W  N + +  + +  IT
Sbjct: 7858 CTTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNIT 7917

Query: 2316 SRRGRQNLTVKDVTKEDQGEYSFVID---GKKTTCKLKMKPRPIAILQGLSDQKVCEGDI 2372
            +      L +   T ED G+Y+  I+   GK +     +   P   ++ L   KV  GD 
Sbjct: 7918 TTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVSVGDS 7977

Query: 2373 VQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIP- 2430
              L+ +++     GV W K   +++P+    +        L+   +   D+G Y      
Sbjct: 7978 ASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAEN 8037

Query: 2431 ALGLSTSGRVSVYSVDVITP-----LKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2485
            ++G  ++          + P     L+DV    G   V +C +S  +  SV WY + + +
Sbjct: 8038 SVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPL 8097

Query: 2486 KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLI----VGRVETNCNLSVEKIKI-----I 2536
            K    VQ         L I +T  S  G Y       +G   ++  L + + K      I
Sbjct: 8098 KDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDI 8157

Query: 2537 RGLRDLTCTETQNVVFEVELSHSG-IDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMM 2595
            R L  +     ++  FE  ++ +  I V W    +EI+   KY+I        LTVL + 
Sbjct: 8158 R-LAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVD 8216

Query: 2596 KDDEGKYTFYA----GENMTSGKLTVAGGAISKPLT---DQTVAESQEAVFECEVANPDS 2648
            K D G+YT YA    G++  + +L +    I    T    +TV E++   F+ E     S
Sbjct: 8217 KGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSETVEETEGNSFKLEGRVAGS 8276

Query: 2649 KG---EWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVE 2705
            +     W ++   +  T+N       +   L +    ++D G YT KV+    SA L   
Sbjct: 8277 QPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSA-LCTS 8335

Query: 2706 AVKIKKTLKN---------LTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAIS 2756
            ++ IK+  K          +TV+E +    +  +       +QW+K G  ++ +++ + S
Sbjct: 8336 SIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFS 8395

Query: 2757 VKGTIYSLRIKNCAIVDESVYGFRLGRL-GASARLHVETVK------------------- 2796
                   L +++ A  D   Y  +   + G+       T+K                   
Sbjct: 8396 FASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLF 8455

Query: 2797 IIKKPKDVTALENATVAFEVSVSHDTVP-VKWFH-KSVEIKPSDKHRLVSERKVHKLMLQ 2854
             + +P+ +  +E  T  F   V  D +P VKW   K  ++    +  +  +    KL ++
Sbjct: 8456 FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIR 8515

Query: 2855 NISPSDAGEYTAVV----GQLECKAKLFVETLHITKTMKNIE---------VPETKTASF 2901
            + + +D+G Y  V     G++E    L V+     K  + IE          P  K  + 
Sbjct: 8516 DTTKTDSGLYRCVAFNEHGEIESNVNLQVDE---RKKQEKIEGDLRAMLKKTPILKKGAG 8572

Query: 2902 ECEVSHFNVPSMWLKNGVEIEMSEK----------------FKIVVQGK---LHQLII-- 2940
            E E     +  M L   V+ +  EK                F+++ Q +    H+L I  
Sbjct: 8573 EEE----EIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEE 8628

Query: 2941 MNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTI-TFEVTVNYEGISY 2999
            +  S  D  E+  +    Q   + T    +I  +      ++ D +   ++ +NY  I  
Sbjct: 8629 IERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKL 8688

Query: 3000 KWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIE 3059
             W K   +++ +DK ++      H+L ++N    D  +Y  V G   ++A L V    IE
Sbjct: 8689 SWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTV----IE 8744

Query: 3060 --FRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP 3117
              + +H++D+ + E +     C+ S P++  +W ++ + L+   R K + E  VH+L I 
Sbjct: 8745 PAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIA 8804

Query: 3118 STRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDA 3177
              R  D G+YT       ++A+L +E   ++     + + V E Q A  E EV+ DD   
Sbjct: 8805 DVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIV 8864

Query: 3178 HWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA-----GRNRSSVTLY 3232
             WYK   E+     +++ +  + R H M I      D G Y+ +A     G  RS+  LY
Sbjct: 8865 TWYKGPTELT--ESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELY 8922

Query: 3233 VNAPE------PPQVLQELQPV---TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3283
            +   E      PP +     P+    +++  P     V++  P P +    EE+      
Sbjct: 8923 LTTKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPPVVA-PPIPLLLPTPEEK------ 8975

Query: 3284 KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVY 3343
                            +  P+   V     K D       A   V  P+ ++P +E+   
Sbjct: 8976 ----------------KPPPKRIEVTKKAVKKD-------AKKVVAKPKEMTPREEIVKK 9012

Query: 3344 PPAIIT------PLQDTVTSEGQPARFQCRVSGTDL---KVSWYSKDKKIKPSRFFRMTQ 3394
            PP   T      P    V+S+ +  +        ++   K + Y K + +   +   +  
Sbjct: 9013 PPPPTTLIPAKAPEIIDVSSKAEEVKIMTITRKKEVQKEKEAVYEKKQAVHKEKRVFIES 9072

Query: 3395 FEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIE----- 3449
            FE+ Y     E Y E      F              + +EA + + HE  E++ E     
Sbjct: 9073 FEEPYDELEVEPYTE-----PFEQPYYEEPDEDYEEIKVEAKKEV-HEEWEEDFEEGQEY 9126

Query: 3450 MEMKELFSEGESEHSE 3465
             E +E + EGE E  E
Sbjct: 9127 YEREEGYDEGEEEWEE 9142



 Score =  169 bits (427), Expect = 9e-41
 Identities = 351/1649 (21%), Positives = 635/1649 (38%), Gaps = 235/1649 (14%)

Query: 890   YKSEAGVEVKKEVGVSITGTTVREERFEV----LHGREAKVTETARVPAPVEIPVTPPTL 945
             +K++A +   + V +S  G T + E  EV    +   +A+V E +   A +++    P  
Sbjct: 11607 FKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSST-AQLKVLEADPYF 11665

Query: 946   VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM-IRE 1004
                L + T +E + +TL+C +S      V W+++  +I  S  + I    G+ R++ I++
Sbjct: 11666 TVKLHDKTAVEKDEITLKCEVS--KDVPVKWFKDGEEIVPSPKYSIK-ADGLRRILKIKK 11722

Query: 1005  AFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVM 1064
             A  +D G + C    + GT  T   + V+      ++     E F  E   F    ++ +
Sbjct: 11723 ADLKDKGEYVC----DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHF----EIEL 11774

Query: 1065  TDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGS----VVFGCQVG---------GNPKP 1111
             ++  +  +    G+P     +T     +++E G     ++  CQ+G          N K 
Sbjct: 11775 SEPDVHGQWKLKGQP-----LTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKS 11829

Query: 1112  HVYWKKSGVPL---------------TTGYRYKVSYNKQTGECKLVISMTFADDAGEYTI 1156
                 K   +PL                  +  +VS   +T            DD  E  I
Sbjct: 11830 AANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFE-LI 11888

Query: 1157  VVRNKHGETSASASLLEEADY--ELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEY 1214
                 KH     SA+  +EA Y  E   K     L    +      P    TA        
Sbjct: 11889 KDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAK------- 11941

Query: 1215  EKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEED 1274
                 EKE A+   +++ D + V+ +  DQ  H +     +  + E +    T ++L  +D
Sbjct: 11942 ----EKESAVFTVELSHDNIRVKWFKNDQRLHTT---RSVSMQDEGKTHSITFKDLSIDD 11994

Query: 1275  GE----EKMAVDISESEAVESG---FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1327
                   E M +       V  G   F  ++++Y  +E   V   C++S    P + W+KD
Sbjct: 11995 TSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP-VKWFKD 12053

Query: 1328  GKRIKHGERYQMDFLQDGRASLRI-PVVLPEDEGIYTAFASNIKGNAICSGKLYVEP-AA 1385
             GK IK  +   +    DG+  + I    L  D G YT      K     SGKL +E    
Sbjct: 12054 GKEIKPSKNAVIK--ADGKKRMLILKKALKSDIGQYTCDCGTDK----TSGKLDIEDREI 12107

Query: 1386  PLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS-------PARMS 1438
              L  P +  ++E +    +     +S   I  +      A +              + + 
Sbjct: 12108 KLVRPLH--SVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVL 12165

Query: 1439  PGRRLEETD---------ESQLERLYKP--VFVLKPV-SFKCLEGQTARFDLKVVGRPMP 1486
                RL++T          +S      KP  + +L+P+       G+TA FD ++    +P
Sbjct: 12166 HNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP 12225

Query: 1487  ETFWFHDGQQIVNDYTHKVVIKEDG-TQSLIIVPATPSDSGEWTVVAQNRAGRSSISVIL 1545
                W+  G+++  + + KVV + +G   +L +      D+GE  + A++    +++ V  
Sbjct: 12226 -VEWYLKGKKL--EPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFV-- 12280

Query: 1546  TVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIR 1605
                    +    F + L++  ++EG+   ++   +   N  + W KN   I+  K  +I 
Sbjct: 12281 ------KEPPVEFTKPLEDQTVEEGATAVLECEVS-RENAKVKWFKNGTEILKSKKYEIV 12333

Query: 1606  IEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV---EVEFAEPEPERKLII 1662
              +G   +  L I     +D   YT  A +      T C +NV    VEF  P  + ++  
Sbjct: 12334 ADGRVRK--LVIHDCTPEDIKTYTCDAKD----FKTSCNLNVVPPHVEFLRPLTDLQV-- 12385

Query: 1663  PRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHF 1722
                  R KE+A  E E        + +++G    K K+     K  +  L + +      
Sbjct: 12386 -----REKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINK------ 12434

Query: 1723  ECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDY-GVAYSRDSGIITCRATN 1781
              C L          E+  + +    +  L ++ E    + +   +  S    I      +
Sbjct: 12435 -CLLDD------EAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVS 12487

Query: 1782  KYGTDHTSATLIVKDEKSLVEESQ---LPEGRKGLQRIE--ELERMAHEGA-LTGVTTDQ 1835
             K G +     +  K ++ ++E  +   L EGRK +  I+   LE   +    L    TD 
Sbjct: 12488 KPGAE----VIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDG 12543

Query: 1836  KEK---QKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD 1892
             K K      + +  P+ + +LEGE A F C ++    P V W  + + +    ++ V  D
Sbjct: 12544 KVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYDVIAD 12602

Query: 1893  G-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHV 1951
             G    L + D    D G   V                                 R   H+
Sbjct: 12603 GKKRVLVVKDATLQDMGTYVV----------------------------MVGAARAAAHL 12634

Query: 1952  HEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYE 2011
                 KL+  V     P+  T  KE     + E + + +V   +E  ++K+  R EE  ++
Sbjct: 12635 TVIEKLRIVV-----PLKDTRVKE-----QQEVVFNCEV--NTEGAKAKW-FRNEEAIFD 12681

Query: 2012  AITAVELKSRKKDESYEELLRKTK-DELLHWTKELTEEEKKALAEEGKITIPTFKPDKIE 2070
             +   + L   +KD  Y   +R    D+  ++   LT    + +     + +         
Sbjct: 12682 SSKYIIL---QKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV--------- 12729

Query: 2071  LSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPE 2130
                  E  +I E ++     +     F  + V + +   +W KNG ++   +R+  Y  +
Sbjct: 12730 ---EEEDLRIVEPLKDIETMEKKSVTFWCK-VNRLNVTLKWTKNGEEVPFDNRVS-YRVD 12784

Query: 2131  DNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2190
                  L I+D    D    +V     AG+  S A LL+  +    F + L+D    E D 
Sbjct: 12785 KYKHMLTIKDCGFPDEGEYIV----TAGQDKSVAELLI-IEAPTEFVEHLEDQTVTEFDD 12839

Query: 2191  MATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2250
              A F C+ S     VKWY++G E+ EG KY+   D  +H L I      D  +Y+C +  
Sbjct: 12840 -AVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGV-- 12896

Query: 2251  DENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNG 2310
              E+ K+ A+L VE   VE ++  QDI             ++ + +E +W  N++ +    
Sbjct: 12897 -EDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD 12955

Query: 2311  KYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEG 2370
             K+ + S      L + D+   DQGEY F+   K+   KL++   P  I     D  V  G
Sbjct: 12956 KHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVG 13014

Query: 2371  DIVQLEVKV-SLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTI 2429
               + + V   +    E  W K+ + +  +  +    ++ S  +L  +  K D G Y   +
Sbjct: 13015 KPLTMVVPYDAYPKAEAEWFKENEPLS-TKTIDTTAEQTSFRIL--EAKKGDKGRYKIVL 13071

Query: 2430  PALGLSTSGRVSVYSVDVITPLKDVNVIE 2458
                     G +++  +DV  P++++ V E
Sbjct: 13072 QNKHGKAEGFINLKVIDVPGPVRNLEVTE 13100



 Score =  159 bits (402), Expect = 7e-38
 Identities = 237/1127 (21%), Positives = 408/1127 (36%), Gaps = 160/1127 (14%)

Query: 1096  GGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1155
             G +  F   V   P   V W  +GV L      K+ Y   +G   L I     DD+G Y 
Sbjct: 32388 GQNTRFILNVQSKPTAEVKWYHNGVELQESS--KIHYTNTSGVLTLEILDCHTDDSGTYR 32445

Query: 1156  IVVRNKHGETSASASL-LEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEY 1214
              V  N  GE S  A+L +   DY      +++      V      P++  T   +  S +
Sbjct: 32446 AVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVF-----PELTRTE-AYAVSSF 32499

Query: 1215  EKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEED 1274
             +K  E E +   ++       V++ + +    +SS+E     E++   +           
Sbjct: 32500 KKTSEMEASSSVRE-------VKSQMTETRESLSSYEHSASAEMKSAAL----------- 32541

Query: 1275  GEEKMAVDISESEAVESGFDSRI----KNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKR 1330
              EEK   + S +  +++   +RI    ++  + EG    F C   G P+P + W + G+ 
Sbjct: 32542 -EEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQV 32600

Query: 1331  IKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAP 1390
             +    R+Q+   +  +++  I  V   DEG Y+    N +G       L ++ A      
Sbjct: 32601 LSTSARHQVTTTK-YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKA 32659

Query: 1391  TYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQ 1450
                P      R++S  PR  S   ++      SP    P  +SP    P    E+     
Sbjct: 32660 VTSP-----PRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP-TPTEKVQHLP 32713

Query: 1451  LERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED 1510
             +    K    LK  + K +   T   +  V+     E  W+ DG+++  +   +     D
Sbjct: 32714 VSAPPKITQFLKAEASKEIAKLTCVVESSVL--RAKEVTWYKDGKKLKENGHFQFHYSAD 32771

Query: 1511  GTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEH------------------ 1552
             GT  L I   T SD GE+        G S  ++    +A +                   
Sbjct: 32772 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 32831

Query: 1553  -----------------QVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDI 1595
                                KP+ V  L++  +   S  +  V+ATG P P  +W K+   
Sbjct: 32832 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 32891

Query: 1596  IVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE-VEFAEP 1654
             I   +  K ++   KG   L+I  T + DS  YT T  N AG  ++ CK+ ++ ++  E 
Sbjct: 32892 IT--QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEA 32949

Query: 1655  EPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFK----KKLT 1710
             +          T + K +   E+    LR      EE  + + + Q+K   K    K L 
Sbjct: 32950 QKVSTQKTSEITPQKKAVVQEEISQKALRS-----EEIKMSEAKSQEKLALKEEASKVLI 33004

Query: 1711  SLRLKRFGPAHFECRLT--PIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAY 1768
             S  +K+      E  +    I   +   E +     ++A +    INE     L   +A 
Sbjct: 33005 SEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG 33064

Query: 1769  SRD-----SGI-ITCRATNKYGTDHTSATLIVK-----DEKSLVEESQLPEGRKGLQRIE 1817
             + D     +G+ +T     +YG   +  TL +K     DE  L   S+  EG    Q   
Sbjct: 33065 ATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQ--- 33121

Query: 1818  ELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLN 1877
                          +T  ++    P  +  P    + EG+   F C ++G P P++ W+ N
Sbjct: 33122 -----------YDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKN 33170

Query: 1878  GQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFR 1936
                I  S    + R   ++ L+I +    D+G+  + A+N  G       L         
Sbjct: 33171 NLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASL--------- 33221

Query: 1937  SVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEE 1996
              VL    EP  E  +   G    +     + V  + +K+                     
Sbjct: 33222 MVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASF---------------SS 33266

Query: 1997  LRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEE 2056
               S       E  + +++A  + S +  ES+ E+   +   + + T+  +   K   A  
Sbjct: 33267 FSSSSASSMTEMKFASMSAQSMSSMQ--ESFVEMSSSSFMGISNMTQLESSTSKMLKAGI 33324

Query: 2057  GKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGV 2116
               I      P KIE  PS             ++ +G          G+P PE  W   G 
Sbjct: 33325 RGI------PPKIEALPS-----------DISIDEGKVLTVACAFTGEPTPEVTWSCGGR 33367

Query: 2117  KIERSDRIYWYWPE-DNVCELVIRDVTAEDSASIMVKAINIAGETSS 2162
             KI   ++  ++    D++  L+I DV  +D     +   N  G  S+
Sbjct: 33368 KIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSA 33414



 Score =  153 bits (386), Expect = 5e-36
 Identities = 304/1510 (20%), Positives = 528/1510 (34%), Gaps = 317/1510 (20%)

Query: 442  VISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVA--------ADKAKEQELKS 493
            V+  +E  A+    T +HI    + +     KTA  +  V+             E E+  
Sbjct: 2867 VVGQLECKAKLFVET-LHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSE 2925

Query: 494  RTKEVITTKQEQMHVTHEQIRKETEKTFV-------------PKVVISAAK---AKEQET 537
            + K V+  K  Q+ + +       E TFV             P ++ S  K   A+E++T
Sbjct: 2926 KFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDT 2985

Query: 538  RISEEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPG--------------- 582
             I+ E+T   + ++ + ++   EI +     + T K T    +                 
Sbjct: 2986 -ITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGK 3044

Query: 583  AQEETTTQQDQMHLSYEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQI 642
            A    T   +  H+ + K +K+  K +  K  +   +V E D+  +  +      +++QI
Sbjct: 3045 ATSTATLYVEARHIEFRKHIKDI-KVLEKKRAMFECEVSEPDITVQWMKD----DQELQI 3099

Query: 643  TQEKMRKEAEKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAV 702
            T ++++ + EK     +  +T  +   +  +     ++T +  ++    ++   KK   V
Sbjct: 3100 T-DRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQV 3158

Query: 703  ATVVAAVDQARVREPREPGH-----LEESYAQQTTLEYGYKERISAAKVAEPPQRPASE- 756
                 AV +  V E     H     +E ++  Q   +Y  + RI    ++E  Q  A E 
Sbjct: 3159 IEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEY 3218

Query: 757  -------------------PHVVPKAVKPRVIQAPSETHIKTT-------------DQKG 784
                               P  V + ++P  +Q+                      +++ 
Sbjct: 3219 TFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQL 3278

Query: 785  MHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSK-------------ISVPKT-EHGY 830
            +    + K   D     L+ ++  P  A+ +   +K             + VP+      
Sbjct: 3279 LSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3338

Query: 831  EASIAGSAIAT-LQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDT 889
            E  +   AI T LQ  +++     +    V    +K S      +  P   F      DT
Sbjct: 3339 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDT 3398

Query: 890  YKSEAGVEVKKEVG------------VSITGTTVREERFEVLHGREAKVTETARVPAPVE 937
            Y+ E      ++ G            VS T     E    +LH R  +  E     APV 
Sbjct: 3399 YQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPV- 3457

Query: 938  IPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGI 997
                   +   ++ + V  G      C I   P+    W++   +I  S    I     I
Sbjct: 3458 -------IKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYI 3510

Query: 998  ARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFV 1057
            + L I      D G +TC A NE G+VS +              T  VTE +        
Sbjct: 3511 SSLEILRTQVVDCGEYTCKASNEYGSVSCTA-------------TLTVTEAY-------- 3549

Query: 1058 ESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKK 1117
                                    P F+++P       G +  F C V G P     W+K
Sbjct: 3550 -----------------------PPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQK 3586

Query: 1118 SGVPLTTGYRYKVS--YNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEA 1175
             G  L+    +++S   NK      L +S     D G Y+    NK G     A L+   
Sbjct: 3587 DGAALSPSPNWRISDAENKHI----LELSNLTIQDRGVYSCKASNKFGADICQAELI--- 3639

Query: 1176 DYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKK------M 1229
                                 + +P             + KE E  Q+ I KK      +
Sbjct: 3640 --------------------IIDKP------------HFIKELEPVQSAINKKVHLECQV 3667

Query: 1230 AKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLE----------EDGEEKM 1279
             +D  V  T+ +D +      + ++  E +   ++  L +L +          E G    
Sbjct: 3668 DEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSSSC 3727

Query: 1280 AVDISESEAVESGFDSRI-KNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQ 1338
            +  ++  E     F  ++  +Y +L G     HCK+ G P+ ++ W+K+ K +      +
Sbjct: 3728 SATVTVRE--PPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVR 3785

Query: 1339 MDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEP 1398
            M F+ +  A L I  V  ED G Y+  A N  G+  CS ++ ++       P++I TLEP
Sbjct: 3786 MYFV-NSEAILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKE-----PPSFIKTLEP 3839

Query: 1399 VSRIRSLS-----------PRSVS----RSPIRMSP-----ARMSPARMSPARMSPARMS 1438
               +R  +           P  +S    +  IR S      ++ S   +     + A + 
Sbjct: 3840 ADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVG 3899

Query: 1439 PGRRLEETDESQ----LERLYK--PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFH 1492
                +   +  +       L K  P FV K      L GQT      V G       W  
Sbjct: 3900 EYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWM- 3958

Query: 1493 DGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAG-RSSISVILTVEAVE 1551
             GQ+++ +     +   +G   LII     S  G++T +A+N AG ++S+  ++  E  +
Sbjct: 3959 KGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPAK 4018

Query: 1552 HQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKG 1611
                   +E+ + + +  G    ++    G P     W K+   +V  K  K RI     
Sbjct: 4019 ------IIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASK--KYRISFKNN 4070

Query: 1612 EAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKE 1671
             A LK  S    DS  YT    N+ G  ++ C+    V                      
Sbjct: 4071 VAQLKFYSAELHDSGQYTFEISNEVG--SSSCETTFTV---------------------- 4106

Query: 1672 IAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGD 1731
                                      ++   PFF K L ++     G    +C++   G 
Sbjct: 4107 -------------------------LDRDIAPFFTKPLRNVDSVVNGTCRLDCKIA--GS 4139

Query: 1732 PTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT 1791
              M V W  DGK + A++R R+    G  SL+       D+G  TCRATN  G+  +S  
Sbjct: 4140 LPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGA 4199

Query: 1792 LIVKDEKSLV 1801
            LIV++  S V
Sbjct: 4200 LIVQEPPSFV 4209



 Score =  133 bits (334), Expect = 6e-30
 Identities = 271/1231 (22%), Positives = 447/1231 (36%), Gaps = 258/1231 (20%)

Query: 942  PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM 1001
            PP  V  L+ V V  G+S +L+C ++G P   V+WY+ D ++  +  +++ F++ +A L+
Sbjct: 7960 PPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLV 8019

Query: 1002 IREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRD 1061
              +    DSG + C A N  G VS S +L VQ                   E++   S  
Sbjct: 8020 FNQVDINDSGEYICKAENSVGEVSASTFLTVQ-------------------EQKLPPSFS 8060

Query: 1062 VVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVP 1121
              + D                       VQ+ V G  VVF C + G+    V W K G P
Sbjct: 8061 RQLRD-----------------------VQETV-GLPVVFDCAISGSEPISVSWYKDGKP 8096

Query: 1122 LTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLM 1181
            L      + S+   T    L I  T    AG+Y+    N  G  S+SA L+       L 
Sbjct: 8097 LKDSPNVQTSFLDNTAT--LNIFKTDRSLAGQYSCTATNPIGSASSSARLI-------LT 8147

Query: 1182 KSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVE 1241
            + +    +  ++     +  VGE+A      ++E      Q  I+   AKD+  +R+  +
Sbjct: 8148 EGKNPPFFDIRLAPV--DAVVGESA------DFECHVTGTQP-IKVSWAKDSREIRSGGK 8198

Query: 1242 DQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEA-VESGFDSRI-KN 1299
             Q  ++ +     + +++           + E G++     ++  E  +   F  R+ + 
Sbjct: 8199 YQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSET 8258

Query: 1300 YRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDE 1359
                EG       +++G     +AWYK+   I+     ++ F ++    L++      D 
Sbjct: 8259 VEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITF-KNNTLVLQVRKAGMNDA 8317

Query: 1360 GIYTAFASNIKGNAICSGKLYV-EPAAPLGAPTYIPTLEPVS----RIRSLSPRSVSRSP 1414
            G+YT   SN  G+A+C+  + + EP  P   P +   L PV+        LS       P
Sbjct: 8318 GLYTCKVSNDAGSALCTSSIVIKEPKKP---PVFDQHLTPVTVSEGEYVQLSCHVQGSEP 8374

Query: 1415 IRMSPARMSPARMSPARMSPARMSPGRRLE----------------------ETDESQLE 1452
            IR+   +         R S +  S    LE                      +T +S++ 
Sbjct: 8375 IRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVT 8434

Query: 1453 RLYKPV---------------FVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQI 1497
               KP                FV +P S + +E  TA F  KV G P+P   W     + 
Sbjct: 8435 IKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQ 8494

Query: 1498 VNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTV------EAVE 1551
            +N      + ++     L I   T +DSG +  VA N  G    +V L V      E +E
Sbjct: 8495 LNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIE 8554

Query: 1552 HQVKPMF------------------VEKLKNVNIKEGSRLEMKVRATGNPN--PDIVWLK 1591
              ++ M                   +E LKNV+ KE  +       T           LK
Sbjct: 8555 GDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDFRGLLQAFELLK 8614

Query: 1592 NSDIIVPHKYPKIRIEGTKGEAAL--KIDSTVSQDSAWYTATAINKAGRDTTRCKVN--- 1646
             S     H+     IE ++ +     ++ S + Q  +      + K   + T  K N   
Sbjct: 8615 QSQEEETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAV 8674

Query: 1647 VEVEFAEPEPERKLIIPRGTYRAKEIAAPEL----EPLHLRYGQEQWEEGDLYD------ 1696
             E++     PE KL   +GT + +     E+    +   LR    Q ++   Y       
Sbjct: 8675 FEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPH 8734

Query: 1697 ----KEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLR 1752
                K    +P +++ L  + LK        C+ +    P +  EW  +G+ L+   R +
Sbjct: 8735 IASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFSV---PNVKSEWFRNGRILKPQGRHK 8791

Query: 1753 MINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKG 1812
               E     L      + D G  TC    KY    TSA L ++ E               
Sbjct: 8792 TEVEHKVHKLTIADVRAEDQGQYTC----KYEDLETSAELRIEAEPI------------- 8834

Query: 1813 LQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKV 1872
                                  Q  K+  +IV       V E ++A F C V+ +    V
Sbjct: 8835 ----------------------QFTKRIQNIV-------VSEHQSATFECEVS-FDDAIV 8864

Query: 1873 NWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAE-NPEG---------VI 1921
             WY     + +S+++  R DG  HY+ I +    D G   V A   P G         + 
Sbjct: 8865 TWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLT 8924

Query: 1922 EHKVKLEIQ------QREDFRSVLRRAPEPR--------------PEFHVHEPGKLQFEV 1961
              ++KLE++       R    ++  RA  P               P     +P   + EV
Sbjct: 8925 TKEIKLELKPPDIPDSRVPIPTMPIRAVPPEEIPPVVAPPIPLLLPTPEEKKPPPKRIEV 8984

Query: 1962 QK----------VDRPVDTTETKEVVKLKRAER-ITHEKVPE------ESEEL------R 1998
             K          V +P + T  +E+VK       +   K PE      ++EE+      R
Sbjct: 8985 TKKAVKKDAKKVVAKPKEMTPREEIVKKPPPPTTLIPAKAPEIIDVSSKAEEVKIMTITR 9044

Query: 1999 SKFKRRTEEGYYEAITAVELKSRKKDESYEE 2029
             K  ++ +E  YE   AV  + R   ES+EE
Sbjct: 9045 KKEVQKEKEAVYEKKQAVHKEKRVFIESFEE 9075



 Score =  130 bits (326), Expect = 5e-29
 Identities = 218/1038 (21%), Positives = 396/1038 (38%), Gaps = 111/1038 (10%)

Query: 1922  EHKVKLEIQQRED-FRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLK 1980
             E+K +L+   +E+  R   RR  E      + E    ++E+ K  +   ++    +++ +
Sbjct: 32217 EYKSELDFMSKEEKSRKKSRRQREVTEITEIEE----EYEISKHAQRESSSSASRLLRRR 32272

Query: 1981  RAERITH-EKVPEESEELRSKFKRRTE-EGYYEAITAVELKSRKK-------DESYEELL 2031
             R+   T+ E +   SE +RS+ +   E E   E  +    ++R +       + S     
Sbjct: 32273 RSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRSPTPERTRPRSPSPVSSERSLSRFE 32332

Query: 2032  RKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQ 2091
             R  + ++    + +    K     E K  + + +P  ++      AP+I  R++S  V  
Sbjct: 32333 RSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLD-----HAPRITLRMRSHRVPC 32387

Query: 2092  GSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMV 2151
             G +  F + V  KP  E +WY NGV+++ S +I+ Y     V  L I D   +DS +   
Sbjct: 32388 GQNTRFILNVQSKPTAEVKWYHNGVELQESSKIH-YTNTSGVLTLEILDCHTDDSGTYRA 32446

Query: 2152  KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2211
                N  GE S +A L V      T+  + +D    E+   + F   T      V  +K  
Sbjct: 32447 VCTNYKGEASDYATLDVTGGDYTTYASQRRD----EEVPRSVFPELTRTEAYAVSSFKKT 32502

Query: 2212  MEVHEGDKYR-MHSDRKVHFLSILTIDTSDAEDYSCVLVEDENV--KTTAKLIVEGAVVE 2268
              E+      R + S       S+ + + S + +     +E++++  K+T + I       
Sbjct: 32503 SEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAAR 32562

Query: 2269  FVKELQDIEVPESYSGELECIVSPENIEG-KWYHNDVELKSNGKYTITSRRGRQNLTVKD 2327
              + + + + V E  S    C    E +    W      L ++ ++ +T+ + +    +  
Sbjct: 32563 ILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISS 32622

Query: 2328  VTKEDQGEYSFVIDGKK---------TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVK 2378
             V   D+G YS V++  +         T  K ++  + +     +   K  E  +   E  
Sbjct: 32623 VQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRV---KSPEPRVKSPEAV 32679

Query: 2379  VSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLL-----IEDMTKEDAGNYSFTIPALG 2433
              S + V+       + V P++      +K  H+ +     I    K +A      +  + 
Sbjct: 32680 KSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVV 32739

Query: 2434  LSTSGRVSV-------------------YSVDVITPLKDVNVIEGTKAVLECKVSVPDVT 2474
              S+  R                      YS D    LK  N+ E  +    C++S    T
Sbjct: 32740 ESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGT 32799

Query: 2475  SVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGR-VETNCNLSV-EK 2532
             S        +       QA     ++   I+ T  SD+   +  V R  E      +  K
Sbjct: 32800 S--------KTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAPEPISSK 32851

Query: 2533  IKIIRGLRDLTCTETQNVVFEVELS-HSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTV 2591
               I+ GL+D T +      F V+ +       +W    K I    KYK+      + L +
Sbjct: 32852 PVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEI 32911

Query: 2592  LNMMKDDEGKYTF----YAGENMTSGKLTV----------AGGAISKPLTDQTVAESQEA 2637
                   D G YT      AG   +S KLT+               +  +T Q  A  QE 
Sbjct: 32912 HKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEE 32971

Query: 2638  VFECEVANPDSKGEWLRDGKHLPLTNNIRSE--SDGHKRRLIIAATKLDDIGEYTYKVAT 2695
             + +  + + + K    +  + L L         S+  K+    AAT L+    +     T
Sbjct: 32972 ISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKS---AATSLEKSIVHEEITKT 33028

Query: 2696  SKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAI 2755
             S+ S +++  A +IK     +++ E Q  V    +       V+W+ NGV L ++E+Y  
Sbjct: 33029 SQASEEVRTHA-EIKAFSTQMSINEGQRLVLKANIA--GATDVKWVLNGVELTNSEEYRY 33085

Query: 2756  SVKGTIYSLRIKNCAIVDESVY----GFRLGRLGASARLHV-----ETVKIIKKPKDVTA 2806
              V G+  +L IK  +  DE +       + G +     L +     +    I +P+    
Sbjct: 33086 GVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNI 33145

Query: 2807  LENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYT 2865
              E   V F   +S +  P ++WF  ++ I  S    +   R V+ L ++N S SD+G+YT
Sbjct: 33146 NEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYT 33205

Query: 2866  AVV----GQLECKAKLFV 2879
                    GQ    A L V
Sbjct: 33206 IKAKNFRGQCSATASLMV 33223



 Score =  127 bits (320), Expect = 2e-28
 Identities = 203/830 (24%), Positives = 316/830 (38%), Gaps = 160/830 (19%)

Query: 1732  PTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT 1791
             PT  V+W H+G  L+ ++++   N  G  +L+    ++ DSG      TN  G     AT
Sbjct: 32401 PTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYAT 32460

Query: 1792  LIV------------KDEK-----------------------------SLVEE--SQLPE 1808
             L V            +DE+                             S V E  SQ+ E
Sbjct: 32461 LDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTE 32520

Query: 1809  GRKGLQRIE-----ELERMA-HEGALTGVTTDQKEKQK--PDIVLYPEPVRVLEGETARF 1860
              R+ L   E     E++  A  E +L   +T +K K      I+  P  + V EGE+ARF
Sbjct: 32521 TRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARF 32580

Query: 1861  RCRVTGYPQPKVNWYLNGQLIRKSKRFRV---RYDGIHYLDIVDCKSYDTGEVKVTAENP 1917
              C   G P P V W   GQ++  S R +V   +Y      +I   ++ D G   V  EN 
Sbjct: 32581 SCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKST--FEISSVQASDEGNYSVVVENS 32638

Query: 1918  EGVIEHKVKLEIQQREDFRSVLR-----RAPEPR---PEFHVHEPGKLQFEVQKVDRPVD 1969
             EG  E +  L IQ+       +      ++PEPR   PE  V  P +++       + V 
Sbjct: 32639 EGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPE-AVKSPKRVKSPEPSHPKAVS 32697

Query: 1970  TTETK-------------------EVVKLKRAERITHEKVPEESEELRSK-------FKR 2003
              TETK                   + +K + ++ I       ES  LR+K        K+
Sbjct: 32698 PTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKK 32757

Query: 2004  RTEEG----YYEAITAVELKSRKKDESYE-ELLRKTKDE----------------LLHWT 2042
               E G    +Y A    ELK     ES + E + +   E                 +H  
Sbjct: 32758 LKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEK 32817

Query: 2043  KELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVV 2102
                  E KK+  +  + T+ T K +     P    P I   +Q  TV   S A F V+  
Sbjct: 32818 VSKISETKKSDQKTTESTV-TRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKAT 32876

Query: 2103  GKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSS 2162
             G+P P   W K+G  I +  + Y    +     L I      DS        N AG  SS
Sbjct: 32877 GEPRPTAIWTKDGKAITQGGK-YKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSS 32935

Query: 2163  HAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRM 2222
                L ++A         ++D  A++  T  T E    +  V  +  +   +    ++ +M
Sbjct: 32936 SCKLTIKA---------IKDTEAQKVSTQKTSEITPQKKAVVQE--EISQKALRSEEIKM 32984

Query: 2223  HSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVV--EFVKELQDIEVPE 2280
                +    L++        E+ S VL+ +E VK +A   +E ++V  E  K  Q  E   
Sbjct: 32985 SEAKSQEKLAL-------KEEASKVLISEE-VKKSAATSLEKSIVHEEITKTSQASEEVR 33036

Query: 2281  SYS-----------GELECIVSPENIEG----KWYHNDVELKSNGKYTITSRRGRQNLTV 2325
             +++            E + +V   NI G    KW  N VEL ++ +Y        Q LT+
Sbjct: 33037 THAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTI 33096

Query: 2326  KDVTKEDQGEYSFVIDGKK--------TTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEV 2377
             K  +  D+G  + +   K+         T   ++   P  I Q  S Q + EG  V    
Sbjct: 33097 KQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRS-QNINEGQNVLFTC 33155

Query: 2378  KVSLE-SVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYS 2426
             ++S E S E  W K+   +  S  V I   +  + L I + +  D+G Y+
Sbjct: 33156 EISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYT 33205



 Score =  125 bits (314), Expect = 1e-27
 Identities = 194/898 (21%), Positives = 333/898 (37%), Gaps = 139/898 (15%)

Query: 2796  KIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQ 2854
             +I+ KP+ +T  E  +  F      + VP V W  K   +  S +H++ + +      + 
Sbjct: 32562 RILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEIS 32621

Query: 2855  NISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMW 2914
             ++  SD G Y+ VV   E K     +    T T++   V E    S          P   
Sbjct: 32622 SVQASDEGNYSVVVENSEGK-----QEAEFTLTIQKARVTEKAVTS----PPRVKSPEPR 32672

Query: 2915  LKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSM 2974
             +K+   ++  ++ K       H   +  T T+ +         ++V       P  IT  
Sbjct: 32673 VKSPEAVKSPKRVKSPEPS--HPKAVSPTETKPTP-------TEKVQHLPVSAPPKITQF 32723

Query: 2975  LKDINAEEKDTITFEVTVNY-EGISYKWLKNGVEIKSTDKCQMR-TKKLTHSLNIRNVHF 3032
             LK   ++E   +T  V  +        W K+G ++K     Q   +   T+ L I N+  
Sbjct: 32724 LKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTE 32783

Query: 3033  GDAADYTFVAGKATSTATLYVEARHIEFRK-HIKDIKVLEKKR----------------- 3074
              D  +Y         T+   ++     F+  H K  K+ E K+                 
Sbjct: 32784 SDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPK 32843

Query: 3075  -------------------------AMFECEVS-EPDITVQWMKDDQELQITDRIKIQKE 3108
                                      A F  + + EP  T  W KD + +    + K+ ++
Sbjct: 32844 APEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSED 32903

Query: 3109  KYVHRLLIPSTRMSDAGKYTVV----AGGNVSTAKLFVEG-RDVRIRSI--KKEVQVIEK 3161
             K    L I  T  SD+G YT      AG   S+ KL ++  +D   + +  +K  ++  +
Sbjct: 32904 KGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQ 32963

Query: 3162  QRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFV 3221
             ++AVV+ E+++  + +   K       + + + K  ++    ++ ISE  +  A   +  
Sbjct: 32964 KKAVVQEEISQKALRSEEIKMS-----EAKSQEKLALKEEASKVLISEEVKKSAAT-SLE 33017

Query: 3222  AGRNRSSVTLYVNAPEPPQVLQELQPVTVQ----SGKPARFCAVISGRPQPKISWYKEEQ 3277
                    +T    A E  +   E++  + Q     G+     A I+G    K  W     
Sbjct: 33018 KSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVK--WVLNGV 33075

Query: 3278  LLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPD 3337
              L+   + ++   G + TL + +A   D  + TC +K   G+      L++         
Sbjct: 33076 ELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLS-------- 33127

Query: 3338  QEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFE 3396
             +E+   P  I  P    + +EGQ   F C +SG    ++ W+  +  I  S    +++  
Sbjct: 33128 KELSDAPAFISQPRSQNI-NEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSR 33186

Query: 3397  DTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLS----LEAPESILHERIEQEIEMEM 3452
             + Y LEI  A   D G YT  A N  GQ S+TA+L     +E P   +  R   +  ++ 
Sbjct: 33187 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQG 33246

Query: 3453  KELFSEGESEHSERDTRDAFSDSEDIDHKSMAAKRYAS-RISSTSSWPEYF--------- 3502
                FS    + S      +FS        SM   ++AS    S SS  E F         
Sbjct: 33247 S--FSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFM 33304

Query: 3503  -------KPSFTQKLTFKYVL----------------EGEPVVFTCRLIACPTPEMTWFH 3539
                      S T K+    +                 EG+ +   C     PTPE+TW  
Sbjct: 33305 GISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSC 33364

Query: 3540  NNRPIPTGL--RRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASL 3595
               R I +    R  I+   DL    ++L I  VQ +D G Y L   N  GS  +T ++
Sbjct: 33365 GGRKIHSQEQGRFHIENTDDL----TTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 33418



 Score =  119 bits (297), Expect = 1e-25
 Identities = 210/1065 (19%), Positives = 379/1065 (35%), Gaps = 197/1065 (18%)

Query: 843   QKELSATSSAQKITKSVKAPT----VKPSETRVRAEPTPLPQFPF-----ADTPDTYKSE 893
             Q+E S+++S     +   +PT    ++P    +R+ P P  ++       + TP+  +  
Sbjct: 32258 QRESSSSASRLLRRRRSLSPTYIELMRPVSELIRSRPQPAEEYEDDTERRSPTPERTRPR 32317

Query: 894   AGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEI----PVT---PPTLV 946
             +   V  E  +S    + R + F      +A +          E+    P T    P + 
Sbjct: 32318 SPSPVSSERSLSRFERSARFDIFSRYESMKAALKTQKTSERKYEVLSQQPFTLDHAPRIT 32377

Query: 947   SGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAF 1006
               +++  V  G++     ++   P+  V WY    +++ S     T  SG+  L I +  
Sbjct: 32378 LRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCH 32437

Query: 1007  AEDSGRFTCSAVNEAGTVSTSCYLAV---------------------------------- 1032
              +DSG +     N  G  S    L V                                  
Sbjct: 32438 TDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVS 32497

Query: 1033  ---QVSE--------EFEKETTAVTEKFTT-EEKRFVESRDVVMTDTSLTEEQAGPG--E 1078
                + SE        E + + T   E  ++ E     E +   + + SL E+        
Sbjct: 32498 SFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKT 32557

Query: 1079  PAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGE 1138
               A   +TKP    + EG S  F C   G P P V W + G  L+T  R++V+  K   +
Sbjct: 32558 TLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKY--K 32615

Query: 1139  CKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQ 1198
                 IS   A D G Y++VV N  G+        +EA++ L ++            A V 
Sbjct: 32616 STFEISSVQASDEGNYSVVVENSEGK--------QEAEFTLTIQK-----------ARVT 32656

Query: 1199  EPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEI 1258
             E  V  T+P  V S  E   +  +A+   K  K                     + +   
Sbjct: 32657 EKAV--TSPPRVKSP-EPRVKSPEAVKSPKRVKSP--------------EPSHPKAVSPT 32699

Query: 1259  EYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYP 1318
             E +   T   + L      K+   +    + E    + +    +L    VT         
Sbjct: 32700 ETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVT--------- 32750

Query: 1319  LPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGK 1378
                  WYKDGK++K    +Q  +  DG   L+I  +   D+G Y    S   G       
Sbjct: 32751 -----WYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGG------- 32798

Query: 1379  LYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMS 1438
                             T +   +    + +S+     ++S  + S  + + + ++     
Sbjct: 32799 ----------------TSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVT----- 32837

Query: 1439  PGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIV 1498
               R+ E      +    KPV V             A+F +K  G P P   W  DG+ I 
Sbjct: 32838 --RKTEPKAPEPISS--KPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAIT 32893

Query: 1499  NDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV-EHQVKPM 1557
                 +K + ++ G   L I     SDSG +T   +N AG  S S  LT++A+ + + + +
Sbjct: 32894 QGGKYK-LSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKV 32952

Query: 1558  FVEKLKNV----------NIKEGSRLEMKVRATGNPNPDIVWLKN--SDIIVPHKYPK-- 1603
               +K   +           I + +    +++ +   + + + LK   S +++  +  K  
Sbjct: 32953 STQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSA 33012

Query: 1604  --------IRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKV---------- 1645
                     +  E TK   A +   T ++  A+ T  +IN+  R   +  +          
Sbjct: 33013 ATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVL 33072

Query: 1646  -------NVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKE 1698
                    + E  +     ++ L I + ++R + I     +    + G  + +      KE
Sbjct: 33073 NGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISK---TKEGIVKCQYDLTLSKE 33129

Query: 1699  KQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFG 1758
                 P F  +  S  +       F C ++  G+P+  +EW  +  P+  ++ + +     
Sbjct: 33130 LSDAPAFISQPRSQNINEGQNVLFTCEIS--GEPSPEIEWFKNNLPISISSNVSISRSRN 33187

Query: 1759  YCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEE 1803
               SL+   A   DSG  T +A N  G    +A+L+V     LVEE
Sbjct: 33188 VYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV---LPLVEE 33229



 Score =  117 bits (293), Expect = 3e-25
 Identities = 201/970 (20%), Positives = 357/970 (36%), Gaps = 143/970 (14%)

Query: 2679  AATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGV 2738
             AA K     E  Y+V + +        A +I   +++  V   Q+  F + +       V
Sbjct: 32348 AALKTQKTSERKYEVLSQQPFTL--DHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEV 32405

Query: 2739  QWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKII 2798
             +W  NGV L+ + K   +    + +L I +C   D   Y          A  +  T+ + 
Sbjct: 32406 KWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYA-TLDVT 32464

Query: 2799  KKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISP 2858
                    A +        SV  +    + +  S   K S+     S R+V   M +    
Sbjct: 32465 GGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRES 32524

Query: 2859  SDAGEYTAVV----GQLECKAKLFVETLHITKTM---------KNIEVPETKTASFECEV 2905
               + E++A        LE K+     T    KT          +++ V E ++A F C+ 
Sbjct: 32525 LSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDT 32584

Query: 2906  SHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATL 2964
                 VP++ WL+ G  +  S +         HQ  +  T  + + E + V  +D+ + ++
Sbjct: 32585 DGEPVPTVTWLRKGQVLSTSAR---------HQ--VTTTKYKSTFEISSVQASDEGNYSV 32633

Query: 2965  TVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHS 3024
              V            N+E K    F +T+    ++ K + +   +KS +      + +   
Sbjct: 32634 VVE-----------NSEGKQEAEFTLTIQKARVTEKAVTSPPRVKSPEPRVKSPEAVKSP 32682

Query: 3025  LNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLE----KKRAMFECE 3080
               +++         +    K T T     + +H+      K  + L+    K+ A   C 
Sbjct: 32683 KRVKSPEPSHPKAVSPTETKPTPTE----KVQHLPVSAPPKITQFLKAEASKEIAKLTCV 32738

Query: 3081  VSEPDI---TVQWMKDDQELQITDRIKIQ-KEKYVHRLLIPSTRMSDAGKYTVVAGGNVS 3136
             V    +    V W KD ++L+     +        + L I +   SD G+Y     G   
Sbjct: 32739 VESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGG 32798

Query: 3137  TAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKY 3196
             T+K  ++      +SI ++V  I                                     
Sbjct: 32799 TSKTNLQFMGQAFKSIHEKVSKI------------------------------------- 32821

Query: 3197  VVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEP----PQVLQELQPVTVQS 3252
                        SET++SD         R          APEP    P ++  LQ  TV S
Sbjct: 32822 -----------SETKKSDQKTTESTVTRKTEP-----KAPEPISSKPVIVTGLQDTTVSS 32865

Query: 3253  GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCE 3312
                A+F    +G P+P   W K+ + ++ G K K   D   + L + +    D+ +YTC 
Sbjct: 32866 DSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCT 32925

Query: 3313  AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3372
              KN  G  ++S  L+++  +     Q++     + ITP +  V  E      Q  +   +
Sbjct: 32926 VKNSAGSVSSSCKLTIKAIKDTEA-QKVSTQKTSEITPQKKAVVQE---EISQKALRSEE 32981

Query: 3373  LKVSWYSKDKKI----KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVG----- 3423
             +K+S     +K+    + S+     + + +    + ++   +E T T  AS  V      
Sbjct: 32982 IKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEI 33041

Query: 3424  QVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDHKSM 3483
             +  ST     E    +L   I      ++K + +  E  +SE + R   S S+       
Sbjct: 33042 KAFSTQMSINEGQRLVLKANIAG--ATDVKWVLNGVELTNSE-EYRYGVSGSDQTLTIKQ 33098

Query: 3484  AAKRYASRISSTSSWPEYF---------------KPSFTQKLTFKYVLEGEPVVFTCRLI 3528
             A+ R    ++  S   E                  P+F  +   + + EG+ V+FTC + 
Sbjct: 33099 ASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEIS 33158

Query: 3529  ACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGS 3588
               P+PE+ WF NN PI       I    +++    SLEI+     DSG Y + A N  G 
Sbjct: 33159 GEPSPEIEWFKNNLPISISSNVSISRSRNVY----SLEIRNASVSDSGKYTIKAKNFRGQ 33214

Query: 3589  AESTASLLVI 3598
               +TASL+V+
Sbjct: 33215 CSATASLMVL 33224



 Score =  115 bits (287), Expect = 2e-24
 Identities = 113/443 (25%), Positives = 170/443 (38%), Gaps = 67/443 (15%)

Query: 5171 NEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIK 5230
            +E   P     PPSF++      V   T + F   V+G P   V W++  S L P +R  
Sbjct: 7763 DECSAPLTVREPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCN 7822

Query: 5231 MERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQH 5290
            +    +V  LE+ ++   + GEY C   N  G+A    ++ I    + V  L    + + 
Sbjct: 7823 VSLEDSVAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKFVKRLND-YSIEK 7881

Query: 5291 VMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSL--- 5347
                 LE T +   P      + V   +  +     Q   +T  E     KS I+ +   
Sbjct: 7882 GKPLILEGTFTGTPP------ISVTWKKNGINVTPSQRCNITTTE-----KSAILEIPSS 7930

Query: 5348 ---DVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVI 5404
               D   +N    N   ++    ++ I LE    PP F+  +   K+     A  +C + 
Sbjct: 7931 TVEDAGQYNCYIENASGKDSCSAQILI-LE----PPYFVKQLEPVKVSVGDSASLQCQLA 7985

Query: 5405 GIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAIC 5464
            G P   V WYK    + P    Y +       TL    V ++DS  Y C+A N VGE   
Sbjct: 7986 GTPEIGVSWYKGDTKLRPTTT-YKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSA 8044

Query: 5465 RGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCY 5524
              FLT+ + ++                                     PP F + + D  
Sbjct: 8045 STFLTVQEQKL-------------------------------------PPSFSRQLRDVQ 8067

Query: 5525 APIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEES---GTGFHNLFITSLVKSDE 5581
              +G    F C + GS   +V WYKDGK ++     V+ S    T   N+F T   +S  
Sbjct: 8068 ETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSP-NVQTSFLDNTATLNIFKTD--RSLA 8124

Query: 5582 GEYRCVATNKSGMAESFAALTLT 5604
            G+Y C ATN  G A S A L LT
Sbjct: 8125 GQYSCTATNPIGSASSSARLILT 8147



 Score =  113 bits (282), Expect = 6e-24
 Identities = 149/651 (22%), Positives = 267/651 (41%), Gaps = 85/651 (13%)

Query: 936  VEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQS 995
            ++ P  PP     L  VTV EGE V L CH+ G     + W +   +I+ S     +F S
Sbjct: 8339 IKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFAS 8398

Query: 996  GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKR 1055
            G A L +R+    DSG + C A N AG+ +T   + ++     +K   A   K    + R
Sbjct: 8399 GTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTIK-----DKPAVAPATKKAAVDGR 8453

Query: 1056 FVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYW 1115
                                       +F+++P   ++VE  +  F  +VGG+P P+V W
Sbjct: 8454 L--------------------------FFVSEPQSIRVVEKTTATFIAKVGGDPIPNVKW 8487

Query: 1116 KKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL--E 1173
             K G         +V  +++  E KL I  T   D+G Y  V  N+HGE  ++ +L   E
Sbjct: 8488 TK-GKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAFNEHGEIESNVNLQVDE 8546

Query: 1174 EADYELLMKSQQEMLYQTQV----TAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKM 1229
                E +    + ML +T +        +E  + E        EYEK Y +   +   + 
Sbjct: 8547 RKKQEKIEGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYEK-YARMYGITDFRG 8605

Query: 1230 AKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAV 1289
                  +    +++E H    EE         I ++  +E   E+    +   +S++E V
Sbjct: 8606 LLQAFELLKQSQEEETHRLEIEE---------IERSERDEKEFEELVSFIQQRLSQTEPV 8656

Query: 1290 ESGFDSRIKNYRILEGMGVTFHCKMS-GYPLPKIAWYKDGKRIKHGERYQMDFLQDGRAS 1348
                D  I+N  +L+     F   +   YP  K++WYK  ++++  +++++  +   R +
Sbjct: 8657 TLIKD--IENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEIS-IDGDRHT 8713

Query: 1349 LRIPVVLPEDEGIYTAFASNIKGNAICSGKL-YVEPA---------------APLGAPTY 1392
            LR+     +D+G Y      + G  I S KL  +EPA                 +     
Sbjct: 8714 LRVKNCQLKDQGNYRL----VCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFS 8769

Query: 1393 IPTL--EPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQ 1450
            +P +  E     R L P+   ++ +     +++ A +  A            LE + E +
Sbjct: 8770 VPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVR-AEDQGQYTCKYEDLETSAELR 8828

Query: 1451 LERLYKPV-FVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKE 1509
            +E   +P+ F  +  +    E Q+A F+ +V       T W+    ++    + K   + 
Sbjct: 8829 IEA--EPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVT-WYKGPTELTE--SQKYNFRN 8883

Query: 1510 DG-TQSLIIVPATPSDSGEWTVVAQ---NRAGRSSISVILTVEAVEHQVKP 1556
            DG    + I   TP D G ++V+A+       RS+  + LT + ++ ++KP
Sbjct: 8884 DGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAELYLTTKEIKLELKP 8934



 Score =  113 bits (282), Expect = 6e-24
 Identities = 176/875 (20%), Positives = 329/875 (37%), Gaps = 106/875 (12%)

Query: 1546  TVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIR 1605
             T   ++  +    + K +++ + EG          G P P + WL+   ++      + +
Sbjct: 32551 TTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVL--STSARHQ 32608

Query: 1606  IEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTT-------RCKVNVEVEFAEP---E 1655
             +  TK ++  +I S  + D   Y+    N  G+          + +V  +   + P    
Sbjct: 32609 VTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPRVKS 32668

Query: 1656  PERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLK 1715
             PE ++  P      K + +P  EP H +       +    +K +        K+T   LK
Sbjct: 32669 PEPRVKSPEAVKSPKRVKSP--EPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQF-LK 32725

Query: 1716  RFGPAHFECRLTPIGDPTMV----VEWLHDGKPLEAANRLRM-INEFGYCSLDYGVAYSR 1770
                      +LT + + +++    V W  DGK L+     +   +  G   L        
Sbjct: 32726 AEASKEI-AKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTES 32784

Query: 1771  DSGIITCRATNKYGTDHTSATLIVKDEKSLVEE-SQLPEGRKGLQRIEELERMAHEGALT 1829
             D G   C  + + GT  T+   + +  KS+ E+ S++ E +K  Q+  E    +     T
Sbjct: 32785 DQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTE----STVTRKT 32840

Query: 1830  GVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV 1889
                  +    KP IV   +   V     A+F  + TG P+P   W  +G+ I +  ++++
Sbjct: 32841 EPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKL 32900

Query: 1890  RYD-GIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPE 1948
               D G  +L+I    + D+G    T +N  G +    KL I+  +D     + + +   E
Sbjct: 32901 SEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKD-TEAQKVSTQKTSE 32959

Query: 1949  FHVHEPGKLQFEV-QKVDR--PVDTTETKEVVKLKRAERITHEKVPEE---------SEE 1996
                 +   +Q E+ QK  R   +  +E K   KL   E  +   + EE          + 
Sbjct: 32960 ITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLEKS 33019

Query: 1997  LRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKT-KDEL-----LHWT---KELTE 2047
             +  +   +T +   E  T  E+K+     S  E  R   K  +     + W     ELT 
Sbjct: 33020 IVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVELTN 33079

Query: 2048  EEKKALAEEGKITIPTFKPDK-----------------------IELSPSM-EAPKIFER 2083
              E+      G     T K                          + LS  + +AP    +
Sbjct: 33080 SEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPAFISQ 33139

Query: 2084  IQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTA 2143
              +SQ + +G +  F   + G+P PE EW+KN + I  S  +       NV  L IR+ + 
Sbjct: 33140 PRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVS-ISRSRNVYSLEIRNASV 33198

Query: 2144  EDSASIMVKAINIAGETSSHAFLLV------QAKQLITFT------------QELQDVVA 2185
              DS    +KA N  G+ S+ A L+V       +++++  T            Q +Q   +
Sbjct: 33199 SDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSAS 33258

Query: 2186  KEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYS 2245
             K++ + ++F   ++    ++K+     +        M S ++    S + + +S     S
Sbjct: 33259 KQEASFSSFSSSSASSMTEMKFASMSAQ-------SMSSMQE----SFVEMSSSSFMGIS 33307

Query: 2246  CVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPE-NIEGKWY--HN 2302
              +   + +     K  + G   +      DI + E     + C  + E   E  W     
Sbjct: 33308 NMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGR 33367

Query: 2303  DVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYS 2337
              +  +  G++ I +      L + DV K+D G Y+
Sbjct: 33368 KIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYT 33402



 Score =  110 bits (276), Expect = 3e-23
 Identities = 211/1011 (20%), Positives = 357/1011 (35%), Gaps = 183/1011 (18%)

Query: 664   AKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREPGHL 723
             A  +  E + R+     TR E   V+  K    K +E  A+      ++++ E RE    
Sbjct: 32472 ASQRRDEEVPRSVFPELTRTEAYAVSSFK----KTSEMEASSSVREVKSQMTETRESLSS 32527

Query: 724   EESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTTDQK 783
              E  A         +E+    K      +      ++ K     V +  S      TD +
Sbjct: 32528 YEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGE 32587

Query: 784   GMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIATLQ 843
              +   + ++K   L+T     V     T     T    SV  ++ G  + +  ++    +
Sbjct: 32588 PVPTVTWLRKGQVLSTSARHQVT----TTKYKSTFEISSVQASDEGNYSVVVENSEGKQE 32643

Query: 844   KELSATSSAQKITKSV--KAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKKE 901
              E + T    ++T+      P VK  E RV++             P+  KS   V+    
Sbjct: 32644 AEFTLTIQKARVTEKAVTSPPRVKSPEPRVKS-------------PEAVKSPKRVKSP-- 32688

Query: 902   VGVSITGTTVREERFEVLHGREAKVTETARVPAPVE----IPVT-PPTLVSGLKNVTVIE 956
                            E  H +    TET   P P E    +PV+ PP +   LK     E
Sbjct: 32689 ---------------EPSHPKAVSPTETK--PTPTEKVQHLPVSAPPKITQFLKAEASKE 32731

Query: 957   GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQS-GIARLMIREAFAEDSGRFTC 1015
                +T     S   +  VTWY++  +++ +  FQ  + + G   L I      D G + C
Sbjct: 32732 IAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVC 32791

Query: 1016  SAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAG 1075
                 E GT  T+     Q  +   ++ + ++E   +++K          T++++T +   
Sbjct: 32792 EISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT---------TESTVTRKT-- 32840

Query: 1076  PGEPAAPYFIT-KPVV-----QKLVEGGSVV-FGCQVGGNPKPHVYWKKSGVPLTTGYRY 1128
               EP AP  I+ KPV+        V   SV  F  +  G P+P   W K G  +T G +Y
Sbjct: 32841 --EPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKY 32898

Query: 1129  KV----------------------------SYNKQTGECKLVISMTFADDAGEYTIVVRN 1160
             K+                            S    +  CKL I     D   +     + 
Sbjct: 32899 KLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIK-AIKDTEAQKVSTQKT 32957

Query: 1161  KHGETSASASLLEEADYELLM---------KSQQEMLYQTQVTAFVQEPKVGETAP---- 1207
                     A + EE   + L          KSQ+++  + + +  +   +V ++A     
Sbjct: 32958 SEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAATSLE 33017

Query: 1208  -GFVYSEYEKEYEKE---------------------QALIRKKMAKDTVVVR-------- 1237
                V+ E  K  +                       Q L+ K        V+        
Sbjct: 33018 KSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGATDVKWVLNGVEL 33077

Query: 1238  TYVEDQEFHISSFEERL-IKEIEYR------IIKTTLEELLEEDGEEKMAVDISESEAVE 1290
             T  E+  + +S  ++ L IK+  +R       I  T E +++   +  ++ ++S++ A  
Sbjct: 33078 TNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELSDAPA-- 33135

Query: 1291  SGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLR 1350
               F S+ ++  I EG  V F C++SG P P+I W+K+   I       +   ++   SL 
Sbjct: 33136 --FISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRN-VYSLE 33192

Query: 1351  IPVVLPEDEGIYTAFASNIKGNAICSGKLYVEP-AAPLGAPTYIPTLEPVSRIRSLSPRS 1409
             I      D G YT  A N +G    +  L V P          + T    S   S S +S
Sbjct: 33193 IRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQS 33252

Query: 1410  VSRSPIR------------------MSPARMSPARMSPARMSPARMSPGRRLEETDESQL 1451
             V  S  +                  M  A MS   MS  + S   MS    +  ++ +QL
Sbjct: 33253 VQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQL 33312

Query: 1452  E-----------RLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVND 1500
             E           R   P     P      EG+         G P PE  W   G++I + 
Sbjct: 33313 ESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQ 33372

Query: 1501  YTHKVVIKE-DGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV 1550
                +  I+  D   +LII+     D G +T+   N  G  S +V + + ++
Sbjct: 33373 EQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI 33423



 Score =  109 bits (272), Expect = 9e-23
 Identities = 250/1192 (20%), Positives = 420/1192 (35%), Gaps = 215/1192 (18%)

Query: 1841  PDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNG-QLIRKSKRFRVRYDGIHYLDI 1899
             P I L     RV  G+  RF   V   P  +V WY NG +L   SK       G+  L+I
Sbjct: 32374 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEI 32433

Query: 1900  VDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRE--DFRSVLRRAPEPRPEFHVHEPGKL 1957
             +DC + D+G  +    N +G       L++   +   + S  R    PR  F    P   
Sbjct: 32434 LDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVF----PELT 32489

Query: 1958  QFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVE 2017
             + E   V     T+E    ++   + R    ++ E  E L S          YE   + E
Sbjct: 32490 RTEAYAVSSFKKTSE----MEASSSVREVKSQMTETRESLSS----------YEHSASAE 32535

Query: 2018  LKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEA 2077
             +KS   +E                 K L   E+K+   + K T+               A
Sbjct: 32536 MKSAALEE-----------------KSL---EEKSTTRKIKTTL---------------A 32560

Query: 2078  PKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELV 2137
              +I  + +S TV +G  A F     G+P P   W + G  +  S R +            
Sbjct: 32561 ARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSAR-HQVTTTKYKSTFE 32619

Query: 2138  IRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECE 2197
             I  V A D  +  V   N  G            KQ   FT  +Q     EK   +    +
Sbjct: 32620 ISSVQASDEGNYSVVVENSEG------------KQEAEFTLTIQKARVTEKAVTSPPRVK 32667

Query: 2198  TSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTT 2257
             + EP VK        E  +  K R+ S    H  ++   +T          V+   V   
Sbjct: 32668 SPEPRVK------SPEAVKSPK-RVKSPEPSHPKAVSPTETKPTPTEK---VQHLPVSAP 32717

Query: 2258  AKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGK---WYHNDVELKSNGKYTI 2314
              K      + +F+K     E+      +L C+V    +  K   WY +  +LK NG +  
Sbjct: 32718 PK------ITQFLKAEASKEI-----AKLTCVVESSVLRAKEVTWYKDGKKLKENGHF-- 32764

Query: 2315  TSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQ 2374
                                 ++ +  DG   T +LK+      + +    + VCE     
Sbjct: 32765 --------------------QFHYSADG---TYELKINN----LTESDQGEYVCE----- 32792

Query: 2375  LEVKVSLESVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPAL 2432
                     S EG   K   +   Q    +H  + K S     +  T E          A 
Sbjct: 32793 -------ISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTEPKAP 32845

Query: 2433  GLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQ 2492
                +S  V      ++T L+D  V   + A    K +     +  W  + + I    + +
Sbjct: 32846 EPISSKPV------IVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYK 32899

Query: 2493  AIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNCNLSVEKIKIIRGLRDLT----- 2543
                      L I++T  SD G Y   V    G V ++C L+++ IK     +  T     
Sbjct: 32900 LSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSE 32959

Query: 2544  CTETQNVVFEVELSHSGIDVLWNFKDKEIKPS---SKYKIEAHGKIYKLTVLNMMKD--- 2597
              T  +  V + E+S   +      + +EIK S   S+ K+    +  K+ +   +K    
Sbjct: 32960 ITPQKKAVVQEEISQKAL------RSEEIKMSEAKSQEKLALKEEASKVLISEEVKKSAA 33013

Query: 2598  ---------DEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPDS 2648
                      +E   T  A E + +         I    T  ++ E Q  V +  +A    
Sbjct: 33014 TSLEKSIVHEEITKTSQASEEVRTH------AEIKAFSTQMSINEGQRLVLKANIAGATD 33067

Query: 2649  KGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVK 2708
               +W+ +G  L  +   R    G  + L I      D G  T    T +   K + +   
Sbjct: 33068 V-KWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTL 33126

Query: 2709  IKKTL---------KNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKG 2759
              K+           ++  + E Q+ +FT E++      ++W KN + +  +   +IS   
Sbjct: 33127 SKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSR 33186

Query: 2760  TIYSLRIKNCAIVDESVYGFRL----GRLGASARLHVETVKIIKKP-KDVTALENATVAF 2814
              +YSL I+N ++ D   Y  +     G+  A+A L V  + ++++P ++V    +   + 
Sbjct: 33187 NVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMV--LPLVEEPSREVVLRTSGDTSL 33244

Query: 2815  EVSVSHDTVPVKWFHKSVEIK--PSDKHRLVSERKVHKLMLQNIS---------PSDAGE 2863
             + S S  +V +    +        S     ++E K   +  Q++S          S +  
Sbjct: 33245 QGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFM 33304

Query: 2864  YTAVVGQLECKAKLFVET------LHITKTMKNIEVPETKTASFECEVSHFNVPSM-WLK 2916
               + + QLE      ++         I     +I + E K  +  C  +    P + W  
Sbjct: 33305 GISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSC 33364

Query: 2917  NGVEIEMSE--KFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV 2966
              G +I   E  +F I     L  LIIM+   +D   YT   GN+  S + TV
Sbjct: 33365 GGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATV 33416



 Score =  108 bits (271), Expect = 1e-22
 Identities = 71/220 (32%), Positives = 111/220 (50%), Gaps = 3/220 (1%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P+F++ L+ V    G    F+  ISG     VSW++DG+ +  S  P VQ SF D  A L
Sbjct: 8057 PSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDS--PNVQTSFLDNTATL 8114

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             I    ++ +G+YS  ATN  G A+S+A L++     PP F  RL  +    G     + 
Sbjct: 8115 NIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKNPPFFDIRLAPVDAVVGESADFEC 8174

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             VTG     V + +D  EI+S   +QIS   +   L + +    DSG Y+  A N VG+ 
Sbjct: 8175 HVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKD 8234

Query: 186  TSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKI 225
            + TA+L ++ E  +P   TK +  T + +E    ++E ++
Sbjct: 8235 SCTAQLNIK-ERLIPPSFTKRLSETVEETEGNSFKLEGRV 8273



 Score =  104 bits (260), Expect = 2e-21
 Identities = 145/659 (22%), Positives = 258/659 (39%), Gaps = 105/659 (15%)

Query: 3064 IKDIKVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMS 3122
            +K++ V+E +    EC +S  P  TV W ++D +++ +   +I  +  + RL+I      
Sbjct: 949  LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAE 1008

Query: 3123 DAGKYTVVA---GGNVSTA--------------------------KLFVEGRDVRIRSIK 3153
            D+G++T  A    G VST+                          K FVE RDV    + 
Sbjct: 1009 DSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDV----VM 1064

Query: 3154 KEVQVIEKQ-------------RAVVEFEVNEDDV------------DAHWYKDGIEINF 3188
             +  + E+Q             + VV+  V    V              +W K G+ +  
Sbjct: 1065 TDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTT 1124

Query: 3189 QVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVTLYVNAPEPPQVLQE 3244
              + +  Y  +    ++ IS T   DAGEYT V     G   +S +L   A +   +++ 
Sbjct: 1125 GYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEA-DYELLMKS 1183

Query: 3245 LQPVTVQSGKPARFCAVISGRPQPKISW------YKEEQLLSTGFKCKFLHDGQEYTLLL 3298
             Q +  Q+   A       G   P   +      Y++EQ L    + K   D      ++
Sbjct: 1184 QQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQAL---IRKKMAKD-----TVV 1235

Query: 3299 IEAFPEDAAVYTCEAKN------DYGVATTSAS--LSVEVPEVVSPD-QEMPVYPPAIIT 3349
            +  + ED   +    +       +Y +  T+    L  +  E ++ D  E         +
Sbjct: 1236 VRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDS 1295

Query: 3350 PLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFED-TYQLEIAEAY 3407
             +++    EG    F C++SG  L K++WY   K+IK    ++M   +D    L I    
Sbjct: 1296 RIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVL 1355

Query: 3408 PEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIE--MEMKELFSEGESEHSE 3465
            PEDEG YT  ASN  G    +  L +E    +        +E    ++ L     S    
Sbjct: 1356 PEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPI 1415

Query: 3466 RDTRDAFSDSEDIDHKSMAAKRYASRI---SSTSSWPEYFKPSFTQKLTFKYVLEGEPVV 3522
            R +    S +     +   A+    R    +  S     +KP F  K      LEG+   
Sbjct: 1416 RMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTAR 1475

Query: 3523 FTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLA 3582
            F  +++  P PE  WFH+ + I       +  + D    + SL I      DSG + ++A
Sbjct: 1476 FDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED---GTQSLIIVPATPSDSGEWTVVA 1532

Query: 3583 INSEGSAESTASLLVIQKGQDEKYLEFLKRAERTHENVEALVERGEDRIKVDLRFTGSP 3641
             N  G + S + +L ++  + +    F+++ +  +      ++ G  R+++ +R TG+P
Sbjct: 1533 QNRAGRS-SISVILTVEAVEHQVKPMFVEKLKNVN------IKEG-SRLEMKVRATGNP 1583



 Score =  104 bits (259), Expect = 3e-21
 Identities = 198/977 (20%), Positives = 360/977 (36%), Gaps = 138/977 (14%)

Query: 2884  ITKTMKNIEVPETKTASFECEV-SHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMN 2942
             IT  M++  VP  +   F   V S       W  NGVE++ S K        +  L I++
Sbjct: 32376 ITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILD 32435

Query: 2943  TSTEDSAEYTFVCGNDQVSA----TLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGIS 2998
               T+DS  Y  VC N +  A    TL VT    T+       EE     F      E  +
Sbjct: 32436 CHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYA 32495

Query: 2999  YKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHI 3058
                 K   E++++   +    ++T +           + Y   A     +A L  E + +
Sbjct: 32496 VSSFKKTSEMEASSSVREVKSQMTETRE-------SLSSYEHSASAEMKSAAL--EEKSL 32546

Query: 3059  EFRKHIKDIK------VLEKKRAM---------FECEVS-EPDITVQWMKDDQELQITDR 3102
             E +   + IK      +L K R+M         F C+   EP  TV W++  Q L  + R
Sbjct: 32547 EEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSAR 32606

Query: 3103  IKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQ 3162
              ++   KY     I S + SD G Y+VV   +        EG+     ++      I+K 
Sbjct: 32607 HQVTTTKYKSTFEISSVQASDEGNYSVVVENS--------EGKQEAEFTL-----TIQKA 32653

Query: 3163  RAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA 3222
             R   +   +   V +   +  ++    V+   +       H   +S T            
Sbjct: 32654 RVTEKAVTSPPRVKSP--EPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTP------ 32705

Query: 3223  GRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRP--QPKISWYKEEQLLS 3280
                 +    ++    PP++ Q L+     S + A+   V+        +++WYK+ + L 
Sbjct: 32706 ----TEKVQHLPVSAPPKITQFLKAEA--SKEIAKLTCVVESSVLRAKEVTWYKDGKKLK 32759

Query: 3281  TG--FKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVE--------- 3329
                 F+  +  DG  Y L +      D   Y CE   + G + T+     +         
Sbjct: 32760 ENGHFQFHYSADGT-YELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKV 32818

Query: 3330  --VPEVVSPDQEM----------PVYP------PAIITPLQDTVTSEGQPARFQCRVSGT 3371
               + E    DQ+           P  P      P I+T LQDT  S    A+F  + +G 
Sbjct: 32819 SKISETKKSDQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGE 32878

Query: 3372  DLKVSWYSKD-KKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3430
                 + ++KD K I     +++++ +  + LEI +    D G YT    N+ G VSS+  
Sbjct: 32879 PRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCK 32938

Query: 3431  LSLEAPESILHERIE----QEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDHKSMAAK 3486
             L+++A +    +++      EI  + K +  E  S+ + R      S+++    + +A K
Sbjct: 32939 LTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAK--SQEKLALK 32996

Query: 3487  RYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPT 3546
               AS++  +    +    S  + +  + + +        R  A    E+  F     I  
Sbjct: 32997 EEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHA----EIKAFSTQMSINE 33052

Query: 3547  GLRRIIKA------------------ESDLHHHSSS-----LEIKRVQDRDSGSYRLLAI 3583
             G R ++KA                   S+ + +  S     L IK+   RD G    ++ 
Sbjct: 33053 GQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISK 33112

Query: 3584  NSEGSAESTASLLVIQKGQDEKYLEFLKRAERTHENVEALVE---RGEDRIKVDLRFTGS 3640
               EG  +    L + ++  D        R++  +E    L      GE   +++      
Sbjct: 33113 TKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNL 33172

Query: 3641  PFNKKQDVEQKGMMRTIHFKTMSSAKKTDYMYDEEYLESKSDIRGWLNVGESFLDKETKV 3700
             P +   +V      R ++   + +A  +D     +Y     + RG  +   S +      
Sbjct: 33173 PISISSNV-SISRSRNVYSLEIRNASVSD---SGKYTIKAKNFRGQCSATASLMVLPLVE 33228

Query: 3701  KLQR---LREARKTLME----KKKLSLLDTSSEISSRTLRSEASDKDILFSREDMKIRSM 3753
             +  R   LR +  T ++     + + +  +  E S  +  S ++          M  +SM
Sbjct: 33229 EPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSM 33288

Query: 3754  SDLAESYKVDHSAESIV 3770
             S + ES+ V+ S+ S +
Sbjct: 33289 SSMQESF-VEMSSSSFM 33304



 Score =  103 bits (257), Expect = 5e-21
 Identities = 60/213 (28%), Positives = 107/213 (50%), Gaps = 2/213 (0%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P F +PL+ V  + G  AT +  + G P   +SW+++   + ++  P  ++ F +  A
Sbjct: 7018 EPPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSA--PAYKMQFKNNVA 7075

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             L I  V  ++ G YS KA N  G   S+A L++KA   PP F ++L+ +    G  V  
Sbjct: 7076 SLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAF 7135

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
            + R+ G     V +Y+DG  ++   + Q S   ++ +L I +      G Y+ +A+N +G
Sbjct: 7136 ECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLG 7195

Query: 184  RATSTAELLVQGEEEVPAKKTKTIVSTAQISES 216
             A+S+A+L++   E  P    K +     + ES
Sbjct: 7196 TASSSAKLILSEHEVPPFFDLKPVSVDLALGES 7228



 Score =  101 bits (252), Expect = 2e-20
 Identities = 209/993 (21%), Positives = 355/993 (35%), Gaps = 191/993 (19%)

Query: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVS--WFRDGQVISTSTLPGVQISF 58
            +T   P + + LQ V + EG T T       F VP V   WFR+G+++        ++  
Sbjct: 8740 LTVIEPAWERHLQDVTLKEGQTCTMTCQ---FSVPNVKSEWFRNGRILKPQGRHKTEVEH 8796

Query: 59   SDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQG 118
                 KLTI  V   + G+Y+ K  +      ++AEL ++AE  P  F +R+Q++ V + 
Sbjct: 8797 KVH--KLTIADVRAEDQGQYTCKYED----LETSAELRIEAE--PIQFTKRIQNIVVSEH 8848

Query: 119  SQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNA 178
                 +  V+     +V +Y+   E+  S  +    +G  + + I    P+D G YSV A
Sbjct: 8849 QSATFECEVS-FDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIA 8907

Query: 179  T-NSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATV 237
                 G A STAEL +        K+ K  +    I +SR                +   
Sbjct: 8908 RLEPRGEARSTAELYLT------TKEIKLELKPPDIPDSR----------------VPIP 8945

Query: 238  EMVIDGAAGQQLPHKTPPRIP---PKPKSRSPTPPSIA---------AKAQLARQQSPSP 285
             M I     +++P    P IP   P P+ + P P  I          AK  +A+ +  +P
Sbjct: 8946 TMPIRAVPPEEIPPVVAPPIPLLLPTPEEKKPPPKRIEVTKKAVKKDAKKVVAKPKEMTP 9005

Query: 286  ----IRHSPSPVRHVRAPTPSPVRSVSPAARISTSPIRSVRS-----PLLMRKTQA---- 332
                ++  P P   + A  P  +   S A  +    I   +        +  K QA    
Sbjct: 9006 REEIVKKPPPPTTLIPAKAPEIIDVSSKAEEVKIMTITRKKEVQKEKEAVYEKKQAVHKE 9065

Query: 333  --------STVATGPEVPP---PWKQEGYVASSSEAEMRETTLTTSTQIRTEERWEGRYG 381
                           EV P   P++Q  Y     + E     +    +    E WE  + 
Sbjct: 9066 KRVFIESFEEPYDELEVEPYTEPFEQPYYEEPDEDYE----EIKVEAKKEVHEEWEEDFE 9121

Query: 382  VQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDADKSAAVATVV---AAVDMARV 438
              ++                 +Y    V    KEV +++ +    A V    A      +
Sbjct: 9122 EGQEYYEREEGYDEGEEEWEEAYQEREVIQVQKEVYEESHERKVPAKVPEKKAPPPPKVI 9181

Query: 439  REPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVAADKAKEQELKSRTKEV 498
            ++PVI  +E+T++                R E EK  VTKV               +K++
Sbjct: 9182 KKPVIEKIEKTSR----------------RMEEEKVQVTKV------------PEVSKKI 9213

Query: 499  ITTKQEQMHVTHEQIRKETEKTFVPKVVISAAK---AKEQETRISEEITKKQKQ-VTQEA 554
            +  K  +  V  E I  +       K+VIS  K   A   E  +S  + + QK+ VT+E 
Sbjct: 9214 VPQKPSRTPVQEEVIEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQKEIVTEEK 9273

Query: 555  IRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEKIMKETRKTVVPKVI 614
            I       A S  V    K  +L   P  +E       +        + E  K  VP+  
Sbjct: 9274 IH-----VAISKRVEPPPKVPELPEKPAPEEVAPVPIPKKVEPPAPKVPEVPKKPVPEEK 9328

Query: 615  VATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILR 674
               P  K++         +  K     + +EK+           + VA  K      +  
Sbjct: 9329 KPVPVPKKEPAAPPKVPEVPKK----PVPEEKI----------PVPVAKKKEAPPAKVPE 9374

Query: 675  TRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPREPGHLEESYAQQTTLE 734
             ++ + T +E+I +      V ++ E+    V  + + +V E R+P   +E         
Sbjct: 9375 VQKGVVT-EEKITI------VTQREESPPPAVPEIPKKKVPEERKPVPRKEE-------- 9419

Query: 735  YGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTTDQKGMHISSQIKKT 794
                      +V  PP+ PA     VP+      +  P     K    +     +++ K 
Sbjct: 9420 ----------EVPPPPKVPALPKKPVPE----EKVAVPVPVAKKAPPPR-----AEVSKK 9460

Query: 795  TDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSSAQK 854
            T +  +R V  +K        F V +  V  T H   A          ++E S +   + 
Sbjct: 9461 TVVEEKRFVAEEKL------SFAVPQ-RVEVTRHEVSA----------EEEWSYSEEEEG 9503

Query: 855  ITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVE-VKKEVGVSITGTTVRE 913
            ++ SV        E R   E   + ++   + P+ Y  E  +  + K V       T R+
Sbjct: 9504 VSISVYR-----EEEREEEEEAEVTEYEVMEEPEEYVVEEKLHIISKRVEAEPAEVTERQ 9558

Query: 914  ERFEVLHGREAKVTETARVPAPVEIPVTPPTLV 946
            E+  VL   + K+      P P ++P  P  +V
Sbjct: 9559 EKKIVL---KPKIPAKIEEPPPAKVPEAPKKIV 9588



 Score =  101 bits (251), Expect = 2e-20
 Identities = 65/197 (32%), Positives = 97/197 (49%), Gaps = 8/197 (4%)

Query: 6     PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD-GRAK 64
             P FT PL +     G    F   I+  P P V+W++ GQ I            SD G  +
Sbjct: 31690 PEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ 31749

Query: 65    LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAP------PNFVQRLQSMTVRQG 118
             LTI +VT  +   Y++ A N  G+ +  A+L V     P      P F + L +   ++G
Sbjct: 31750 LTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEG 31809

Query: 119   SQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEG-DLYSLLIAEAYPEDSGTYSVN 177
               V  ++RV+GIP P +K+ +DG  +    + +I  EG D Y+L I +  PED+G Y V 
Sbjct: 31810 QSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVT 31869

Query: 178   ATNSVGRATSTAELLVQ 194
             ATN+ G  +  A L V+
Sbjct: 31870 ATNTAGSTSCQAHLQVE 31886



 Score =  100 bits (249), Expect = 4e-20
 Identities = 74/252 (29%), Positives = 120/252 (47%), Gaps = 13/252 (5%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P+FT+ L+ +  ++GS    E  ++G     + WF+D Q IS S     + SF D  A L
Sbjct: 4675 PSFTKKLKKMDSIKGSFIDLECIVAGSHPISIQWFKDDQEISASEK--YKFSFHDNTAFL 4732

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             I  +   +SG Y+  ATN +G    +  L VK    PP FV++ QS  V   ++V+L+ 
Sbjct: 4733 EISQLEGTDSGTYTCSATNKAGHNQCSGHLTVKE---PPYFVEKPQSQDVNPNTRVQLKA 4789

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             V G     +K+++D  E+ S     + ++    SL +  A   DSGTY    +N VG A
Sbjct: 4790 LVGGTAPMTIKWFKDNKELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTA 4849

Query: 186  TSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRI----EKKIEAHFDARSIATVE--- 238
            TS A L V+   +   K +  +V     S + + +I    + ++  + D   I  ++   
Sbjct: 4850 TSKATLFVKEPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHG 4909

Query: 239  -MVIDGAAGQQL 249
               IDG A  Q+
Sbjct: 4910 ISFIDGLATFQI 4921



 Score =  100 bits (249), Expect = 4e-20
 Identities = 69/217 (31%), Positives = 107/217 (49%), Gaps = 10/217 (4%)

Query: 4    QAPTFTQPLQSVVVLE-GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
            + P F +    V+VL  G + TFE  I+G P   VSW+ DG  I+     G  ISF DG 
Sbjct: 4859 EPPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHG--ISFIDGL 4916

Query: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
            A   I      NSG Y  +A N +G A+ + EL VK    PP F++ L+ + V + S V 
Sbjct: 4917 ATFQISGARVENSGTYVCEARNDAGTASCSIELKVKE---PPTFIRELKPVEVVKYSDVE 4973

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
            L+  VTG P   V + ++  EI+SS  + ++    +++L I +  P D+G Y    +N  
Sbjct: 4974 LECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEYQCIVSNEG 5033

Query: 183  GRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQT 219
            G  + +  + +    + P    K I +T  + +S  T
Sbjct: 5034 GSCSCSTRVAL----KEPPSFIKKIENTTTVLKSSAT 5066



 Score = 99.8 bits (247), Expect = 7e-20
 Identities = 63/210 (30%), Positives = 108/210 (51%), Gaps = 6/210 (2%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P+F + +++   +  S+ATF++ ++G P   ++W +D Q++       V ISF D  A
Sbjct: 5046 EPPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDD--NVYISFVDSVA 5103

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             L I +V   +SGRY+ +A N SG     A LLV+    P   V++ +S+ V +   + L
Sbjct: 5104 TLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQE---PAQIVEKAKSVDVTEKDPMTL 5160

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
            +  V G P   VK+ +DG +I  S  F +S E ++ S  I     +DSG Y+    N  G
Sbjct: 5161 ECVVAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFG 5220

Query: 184  RATSTAELLVQGEEEVPAKKTKTIVSTAQI 213
             ++  A L V  ++ +P   TK +    ++
Sbjct: 5221 SSSCDAYLRVL-DQNIPPSFTKKLTKMDKV 5249



 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 90/354 (25%), Positives = 145/354 (40%), Gaps = 55/354 (15%)

Query: 1304  EGMGVTFHCKMSGYPLP-KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIY 1362
             EG  V + CK+  Y    ++ WY   +++++ E+Y++ + +DG A L +  +   D+G Y
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITY-EDGVAILYVKDITKLDDGTY 31639

Query: 1363  TAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARM 1422
                  N  G      +L+V+    +       T++ + R                     
Sbjct: 31640 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKR--------------------- 31678

Query: 1423  SPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVG 1482
                          R    R LE   E  L    K  +V          G+  RF + +  
Sbjct: 31679 -------------RTDTMRLLERPPEFTLPLYNKTAYV----------GENVRFGVTITV 31715

Query: 1483  RPMPETFWFHDGQQIV-NDYTHKVVIKED-GTQSLIIVPATPSDSGEWTVVAQNRAGRSS 1540
              P P   W+  GQ+I   D   K   + D G   L I   T  D  E+TVVA+N+ G  S
Sbjct: 31716 HPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDS 31775

Query: 1541  ISVILTVEA----VEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDII 1596
                 LTV       +  ++PMF   L N   +EG  +  ++R +G P P + W K+   +
Sbjct: 31776 CKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPL 31835

Query: 1597  VPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVE 1650
                   +I  EG     AL I  T+ +D+ +Y  TA N AG  +T C+ +++VE
Sbjct: 31836 SLGPNIEIIHEGL-DYYALHIRDTLPEDTGYYRVTATNTAG--STSCQAHLQVE 31886



 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 76/251 (30%), Positives = 122/251 (48%), Gaps = 31/251 (12%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG--VQISFSDG 61
            ++P F     S+ V+ G +A FE H++G     ++W +D + I     PG    I+    
Sbjct: 6269 KSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWSKDNKEIR----PGGNYTITCVGN 6324

Query: 62   RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTV-RQGSQ 120
               L I  V K +SG+Y+ +ATN  G+   +A+L VK    PP FV++L++  V +QG  
Sbjct: 6325 TPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE---PPKFVKKLEASKVAKQGES 6381

Query: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
            ++L+ +++G P   V ++R+ +E+  S  + +S    +  L I EA  EDSG Y   A N
Sbjct: 6382 IQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYICEAHN 6441

Query: 181  SVGRATSTAELLV-------QGEEEVPAKKTKTIVSTAQIS-----------ESRQTRIE 222
             VG A+ +  L V       Q    V A K   ++   +IS           + +Q R  
Sbjct: 6442 GVGDASCSTALTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNS 6501

Query: 223  KKIE---AHFD 230
            KK +    HFD
Sbjct: 6502 KKFKITSKHFD 6512



 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 109/437 (24%), Positives = 170/437 (38%), Gaps = 77/437 (17%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PPSF +     +V    +L F   + G P   VKW++    L P E   +     V  LE
Sbjct: 6833 PPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELE 6892

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            +  +Q  E G+Y C   N  G A    ++ +           P    + + +F +E    
Sbjct: 6893 LFEVQPLESGDYSCLVTNDAGSASCTTHLFVKE---------PATFVKRLADFSVE---- 6939

Query: 5302 SRTPSPQEIVLEVE------LSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFV 5355
              T SP  IVLE        +S   +K+ E  +        T   KS I  L++L     
Sbjct: 6940 --TGSP--IVLEATYTGTPPISVSWIKD-EYLISQSERCSITMTEKSTI--LEILESTIE 6992

Query: 5356 DPN-----MDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPE 5410
            D       +++  G+D   +  + V E PP FI P+   +      A  +C V G P   
Sbjct: 6993 DYAQYSCLIENEAGQDI-CEALVSVLE-PPYFIEPLEHVEAVIGEPATLQCKVDGTPEIR 7050

Query: 5411 VKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTM 5470
            + WYKE+  +      Y +  +    +L I  V  SD   Y C+A N VG         +
Sbjct: 7051 ISWYKEHTKLRSAPA-YKMQFKNNVASLVINKVDHSDVGEYSCKADNSVG--------AV 7101

Query: 5471 GDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTA 5530
              S +  + A+K                              PP F + + D +  +G  
Sbjct: 7102 ASSAVLVIKARKL-----------------------------PPFFARKLKDVHETLGFP 7132

Query: 5531 AYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDE---GEYRCV 5587
              F+C + GS    V WYKDG L++          +  HN+    ++++D+   G+Y C 
Sbjct: 7133 VAFECRINGSEPLQVSWYKDGVLLKD---DANLQTSFVHNVATLQILQTDQSHIGQYNCS 7189

Query: 5588 ATNKSGMAESFAALTLT 5604
            A+N  G A S A L L+
Sbjct: 7190 ASNPLGTASSSAKLILS 7206



 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 194/942 (20%), Positives = 344/942 (36%), Gaps = 118/942 (12%)

Query: 3347  IITPLQDTVTSEGQPARFQCRVSGTDLK-VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAE 3405
             I+T  +     EG+ ARF C   G  +  V+W  K + +  S   ++T  +     EI+ 
Sbjct: 32563 ILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISS 32622

Query: 3406  AYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSE 3465
                 DEG Y+ V  N+ G+  +   L+++    +  + +     ++  E     +S  + 
Sbjct: 32623 VQASDEGNYSVVVENSEGKQEAEFTLTIQKAR-VTEKAVTSPPRVKSPE--PRVKSPEAV 32679

Query: 3466  RDTRDAFSDSEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTC 3525
             +  +   S            +   +        P    P  TQ L  +   E   +    
Sbjct: 32680 KSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVV 32739

Query: 3526  RLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSS-----LEIKRVQDRDSGSYRL 3580
                     E+TW+ + + +        K       H S+     L+I  + + D G Y +
Sbjct: 32740 ESSVLRAKEVTWYKDGKKL--------KENGHFQFHYSADGTYELKINNLTESDQGEY-V 32790

Query: 3581  LAINSEGSAESTASLLVIQKGQDEKYLEFLKRAERT-HENVEALVERGEDRIKVDLRFTG 3639
               I+ EG    T              L+F+ +A ++ HE V  + E      K D + T 
Sbjct: 32791 CEISGEGGTSKTN-------------LQFMGQAFKSIHEKVSKISETK----KSDQKTTE 32833

Query: 3640  SPFNKKQD------VEQKGMMRT-IHFKTMSSAKKTDYMYDEEYLESKSDIRGWLNVGES 3692
             S   +K +      +  K ++ T +   T+SS     +          + I  W   G++
Sbjct: 32834 STVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAI--WTKDGKA 32891

Query: 3693  FLDKETKVKLQRLREARKTLMEKKKLSLLDTSSEISSRTLRSEASDKDILFSREDMKIRS 3752
              + +  K KL    +     +E  K    D  S + + T+++ A     + S   + I++
Sbjct: 32892 -ITQGGKYKLSE--DKGGFFLEIHKTDTSD--SGLYTCTVKNSAGS---VSSSCKLTIKA 32943

Query: 3753  MSDL-AESYKVDHSAESIVQNPHALSNQMDQN-IESEELPTSFQTIVDEEIFQTEIRMSQ 3810
             + D  A+      ++E   Q    +  ++ Q  + SEE+  S      E   Q ++ + +
Sbjct: 32944 IKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMS------EAKSQEKLALKE 32997

Query: 3811  EA---LVKESLPKD---HLYGEILVNENTQARGQLEEIMANTTIGESSTYITNVCEKEEV 3864
             EA   L+ E + K     L   I+  E T+     EE+  +  I   ST ++       +
Sbjct: 32998 EASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMS-------I 33050

Query: 3865  YETPENVSQAITPHASESFGTLVNVE--ESEEIASERIKKDDLRELQLSASTRIDEFKT- 3921
              E    V +A    A++    L  VE   SEE        D    ++  AS R +   T 
Sbjct: 33051 NEGQRLVLKANIAGATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIK-QASHRDEGILTC 33109

Query: 3922  --EQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYN 3979
               + KE  ++   +    +     P+F+ +  SQ + EG +  F C   G P P + W+ 
Sbjct: 33110 ISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFK 33169

Query: 3980  NDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKH 4039
             N++PI  + N  I    N   L + +    + G  T    N  G    T+ L V      
Sbjct: 33170 NNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLP---- 33225

Query: 4040  DVKAHKVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELL 4099
                          L EE    +V          +   G T+L    ++  V  S   +  
Sbjct: 33226 -------------LVEEPSREVV----------LRTSGDTSLQGSFSSQSVQMSASKQEA 33262

Query: 4100  SFPVEIQVTAAT-------PIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFL-S 4151
             SF      +A++        +  Q   S +    E      M    +TQ        L +
Sbjct: 33263 SFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESSTSKMLKA 33322

Query: 4152  DITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNG--VLLKQNQKFQFEE 4209
              I   PPK ++ +P      EG  + + C  +GEP P VTW   G  +  ++  +F  E 
Sbjct: 33323 GIRGIPPK-IEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIEN 33381

Query: 4210  VNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPV 4251
              +    L I DV  QD G Y     N  G+  +  ++ +  +
Sbjct: 33382 TDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIRSI 33423



 Score = 96.3 bits (238), Expect = 8e-19
 Identities = 82/313 (26%), Positives = 133/313 (42%), Gaps = 43/313 (13%)

Query: 3312 EAKNDYGVATTSASLSVEVPEV-------------VSPDQEMPVYPPAIITPLQDTVTSE 3358
            E K + GV+ T  ++  E  EV             V    E+PV PP +++ L++    E
Sbjct: 897  EVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIE 956

Query: 3359 GQPARFQCRVSG-TDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFV 3417
            G+    +C +SG     V+WY +D +I+ S  F++T      +L I EA+ ED G +T  
Sbjct: 957  GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCS 1016

Query: 3418 ASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSED 3477
            A N  G VS++  L+++         + +E E E   +  +  +E         F +S D
Sbjct: 1017 AVNEAGTVSTSCYLAVQ---------VSEEFEKETTAVTEKFTTEEKR------FVESRD 1061

Query: 3478 IDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTW 3537
            +           S     +   E   P F  K   + ++EG  VVF C++   P P + W
Sbjct: 1062 V------VMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYW 1115

Query: 3538 FHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLL- 3596
              +  P+ TG R   K   +       L I      D+G Y ++  N  G   ++ASLL 
Sbjct: 1116 KKSGVPLTTGYR--YKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLE 1173

Query: 3597 -----VIQKGQDE 3604
                 ++ K Q E
Sbjct: 1174 EADYELLMKSQQE 1186



 Score = 96.3 bits (238), Expect = 8e-19
 Identities = 59/197 (29%), Positives = 97/197 (49%), Gaps = 5/197 (2%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + PTF + +  ++ L G T T +A + G     V+W +  +VI       +++SFS+G A
Sbjct: 3922 EPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGK--IKMSFSNGVA 3979

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             L IP V  +  G+Y+  A N +G  TS  EL+VK    P   ++R + + V  G    L
Sbjct: 3980 VLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKE---PAKIIERAELIQVTAGDPATL 4036

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
            +  V G P    K+Y+DG  + +S  ++IS + ++  L    A   DSG Y+   +N VG
Sbjct: 4037 EYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVG 4096

Query: 184  RATSTAELLVQGEEEVP 200
             ++      V   +  P
Sbjct: 4097 SSSCETTFTVLDRDIAP 4113



 Score = 96.3 bits (238), Expect = 8e-19
 Identities = 101/458 (22%), Positives = 171/458 (37%), Gaps = 74/458 (16%)

Query: 5159 YEIWRSDSFGTPNEAIEP--KDNEMPPSFIEPLTKRKVYENTTLG----FIVEVEGLPVP 5212
            Y    S+  GT + + +    ++E+PP F      + V  +  LG    F   V G    
Sbjct: 7186 YNCSASNPLGTASSSAKLILSEHEVPPFF----DLKPVSVDLALGESGTFKCHVTGTAPI 7241

Query: 5213 GVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDI 5272
             + W ++   + P    KM  V N  +L +  + KG+ G+Y C+A NI G+    A + +
Sbjct: 7242 KITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSCSAQLGV 7301

Query: 5273 MPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVL------EVELSEKDVKEFEK 5326
                  +  L P    + V + +          SP+  VL      E++ S K    F  
Sbjct: 7302 QEPPRFIKKLEP---SRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVD 7358

Query: 5327 QVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPI 5386
             V ++ +   + +        D   +     N          LK+     + PP F    
Sbjct: 7359 SVAVLEMHNLSVE--------DSGDYTCEAHNAAGSASSSTSLKV-----KEPPIFRKKP 7405

Query: 5387 CDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLS 5446
               +  + +D   +C + G P   V WYK+   +     KY I  E    ++ I NV  +
Sbjct: 7406 HPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGK-KYKIMSENFLTSIHILNVDAA 7464

Query: 5447 DSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFE 5506
            D   Y+C+A N VG   C G + +                                    
Sbjct: 7465 DIGEYQCKATNDVGSDTCVGSIAL------------------------------------ 7488

Query: 5507 FQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKD-GKLVQGRRFTVEESG 5565
                + PPRF+K +SD    +G     Q  + G+   +V W+KD G++V+          
Sbjct: 7489 ----KAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYS 7544

Query: 5566 TGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
                 L  + +  ++ G+Y C   N +GM E FA L++
Sbjct: 7545 ENIATLQFSRVEPANAGKYTCQIKNDAGMQECFATLSV 7582



 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 70/219 (31%), Positives = 102/219 (46%), Gaps = 22/219 (10%)

Query: 956   EGESVTLECHISGYPSPT-VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFT 1014
             EG  V   C I  Y   T VTWY    Q+E+S  ++IT++ G+A L +++    D G + 
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 31640

Query: 1015  CSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQA 1074
             C  VN+ G  S+        +E F K    V + +     + ++ R    TDT    E+ 
Sbjct: 31641 CKVVNDYGEDSS-------YAELFVKGVREVYDYYCRRTMKKIKRR----TDTMRLLER- 31688

Query: 1075  GPGEPAAPYFITKPVVQKLV-EGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYR-YKVSY 1132
                    P   T P+  K    G +V FG  +  +P+PHV W KSG  +  G    K ++
Sbjct: 31689 -------PPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTF 31741

Query: 1133  NKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL 1171
                 G  +L I+    DD  EYT+V RNK+GE S  A L
Sbjct: 31742 ESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKL 31780



 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 58/188 (30%), Positives = 94/188 (50%), Gaps = 2/188 (1%)

Query: 7    TFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLT 66
            T  +  +S+ V  G T T E  ++G P     WF+DG+ +++      +ISF +  + L 
Sbjct: 7587 TIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNK--YKISFFNKVSGLK 7644

Query: 67   IPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVR 126
            I  V  ++SG YS +  N  G+ + TA L V   T PP+F ++L+      GS V ++ +
Sbjct: 7645 IINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECK 7704

Query: 127  VTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRAT 186
            V G P   V ++ +G EI S   +Q +   +  +L +      DSG Y+  ATN  G   
Sbjct: 7705 VYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDE 7764

Query: 187  STAELLVQ 194
             +A L V+
Sbjct: 7765 CSAPLTVR 7772



 Score = 93.6 bits (231), Expect = 5e-18
 Identities = 112/497 (22%), Positives = 193/497 (38%), Gaps = 104/497 (20%)

Query: 5182 PPSFIEPLT-KRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSL 5240
            PP FI+ L   R V ++    +  ++ G P   V WY++++ ++   + +M  V +V  L
Sbjct: 7304 PPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVL 7363

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQ--HVMEFDLEH 5298
            E+ N+   + G+Y C A N  G A S  ++ +           PP+  +  H +E     
Sbjct: 7364 EMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVK---------EPPIFRKKPHPIE----- 7409

Query: 5299 TTSSRTPSPQEIVLEVELS---------EKDVKEFE--KQVKIVTVPEFTPDHKSMIVSL 5347
                 T    ++ LE EL           KD +E    K+ KI++    T  H   I+++
Sbjct: 7410 -----TLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIH---ILNV 7461

Query: 5348 DVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIP 5407
            D            +  G D    +     + PPRF+  + D       +   + ++ G  
Sbjct: 7462 DAADIGEYQCKATNDVGSD--TCVGSIALKAPPRFVKKLSDISTVVGKEVQLQTTIEGAE 7519

Query: 5408 TPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGF 5467
               V W+K+   I  ++    IS  +   TL+   V  +++  Y C+  N  G   C  F
Sbjct: 7520 PISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDAGMQEC--F 7577

Query: 5468 LTMGDSEIFAVIAKKS--KVTLSSLM--------------------EELVLKSNYTDSFF 5505
             T+   E   ++ K    KVT                         +EL   + Y  SFF
Sbjct: 7578 ATLSVLEPATIVEKPESIKVTTGDTCTLECTVAGTPELSTKWFKDGKELTSDNKYKISFF 7637

Query: 5506 -------------------EFQVVEG-----------------PPRFIKGISDCYAPIGT 5529
                                F+V                    PP F + + +     G+
Sbjct: 7638 NKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGS 7697

Query: 5530 AAYFQCLVRGSPRPTVYWYKDG-KLVQGRRF--TVEESGTGFHNLFITSLVKSDEGEYRC 5586
            +   +C V GSP  +V W+ +G ++  GR++  T+ ++      L +  L +SD G+Y C
Sbjct: 7698 SVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCA---LTVNMLEESDSGDYTC 7754

Query: 5587 VATNKSGMAESFAALTL 5603
            +ATN +G  E  A LT+
Sbjct: 7755 IATNMAGSDECSAPLTV 7771



 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 108/448 (24%), Positives = 163/448 (36%), Gaps = 72/448 (16%)

Query: 5159 YEIWRSDSFGTPNE--AIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKW 5216
            Y     +S GT +       ++ ++PPSF   L   +      +     + G     V W
Sbjct: 6149 YTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCW 6208

Query: 5217 YRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQE 5276
            YR+  LL  DE ++   V NV +L+I        G+Y C A N +G A S A +     +
Sbjct: 6209 YRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPK 6268

Query: 5277 ERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVK-IVTVPE 5335
            +       PV+   +     +         P  I        KD KE        +T   
Sbjct: 6269 KSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITW-----SKDNKEIRPGGNYTITCVG 6323

Query: 5336 FTPDHKSMIV------SLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDF 5389
             TP  + + V             N V  +M S +   KE          PP+F+  +   
Sbjct: 6324 NTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLSVKE----------PPKFVKKLEAS 6373

Query: 5390 KIPENSDAV-FKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDS 5448
            K+ +  +++  +C + G P  +V W++    +  ++ KY +S       L I      DS
Sbjct: 6374 KVAKQGESIQLECKISGSPEIKVSWFRNDSELH-ESWKYNMSFINSVALLTINEASAEDS 6432

Query: 5449 ATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQ 5508
              Y C A N VG+A C   LT                                       
Sbjct: 6433 GDYICEAHNGVGDASCSTALT--------------------------------------- 6453

Query: 5509 VVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGR---RFTVEESG 5565
             V+ PP F +  S   A  G+    QC + G+P   V W KD K V+     + T +   
Sbjct: 6454 -VKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFD 6512

Query: 5566 TGFHNLFITSLVKSDEGEYRCVATNKSG 5593
            T  H   I +L  SD GEY C ATN+ G
Sbjct: 6513 TSLH---ILNLEASDVGEYHCKATNEVG 6537



 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 64/212 (30%), Positives = 98/212 (46%), Gaps = 7/212 (3%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD-GQVISTSTLPGVQISFSDGRAK 64
            P F + L  +  + G     +  I G     V WF+D G+++  S    + IS+S+  A 
Sbjct: 7492 PRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESD--NIWISYSENIAT 7549

Query: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQ 124
            L    V  AN+G+Y+ +  N +G     A L V     P   V++ +S+ V  G    L+
Sbjct: 7550 LQFSRVEPANAGKYTCQIKNDAGMQECFATLSV---LEPATIVEKPESIKVTTGDTCTLE 7606

Query: 125  VRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184
              V G P    K+++DG E+ S   ++IS    +  L I    P DSG YS    N VG+
Sbjct: 7607 CTVAGTPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGK 7666

Query: 185  ATSTAELLVQGEEEVPAKKTKTIVSTAQISES 216
             + TA L V  +  VP   T+ +  T  +S S
Sbjct: 7667 DSCTASLQV-SDRTVPPSFTRKLKETNGLSGS 7697



 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 117/475 (24%), Positives = 176/475 (37%), Gaps = 73/475 (15%)

Query: 5150  TPTEERGSAYEIWRSDSFGTPNEAIEPKDNEMPPSF--------IEPLTKRK---VYENT 5198
             T T E  S+YE   S S    + A+E K  E   +            LTK +   VYE  
Sbjct: 32519 TETRESLSSYE--HSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGE 32576

Query: 5199  TLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAV 5258
             +  F  + +G PVP V W R   +L    R ++       + EIS++Q  + G Y     
Sbjct: 32577 SARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVE 32636

Query: 5259  NIIGEAKSFANVDIMPQE--ERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVEL 5316
             N  G+ ++   + I      E+ V  PP V                ++P P+    E   
Sbjct: 32637 NSEGKQEAEFTLTIQKARVTEKAVTSPPRV----------------KSPEPRVKSPEAVK 32680

Query: 5317  SEKDVKEFE-KQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEV 5375
             S K VK  E    K V+  E  P     +  L V                          
Sbjct: 32681 SPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPV-------------------------- 32714

Query: 5376  FEMPPRFIMPICDFKIPENSDAVFKCSVIG----IPTPEVKWYKEYMCIEPDNIKYVISE 5431
                PP+    I  F   E S  + K + +     +   EV WYK+   ++ +        
Sbjct: 32715 -SAPPK----ITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYS 32769

Query: 5432  EKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLM 5491
               G++ LKI N+  SD   Y C  ++  G         MG +   ++  K SK++ +   
Sbjct: 32770 ADGTYELKINNLTESDQGEYVCE-ISGEGGTSKTNLQFMGQA-FKSIHEKVSKISETKKS 32827

Query: 5492  EELVLKSNYTDSFFEF--QVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYK 5549
             ++   +S  T        + +   P  + G+ D      + A F     G PRPT  W K
Sbjct: 32828 DQKTTESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTK 32887

Query: 5550  DGK-LVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
             DGK + QG ++ + E   GF  L I     SD G Y C   N +G   S   LT+
Sbjct: 32888 DGKAITQGGKYKLSEDKGGFF-LEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTI 32941



 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 108/456 (23%), Positives = 168/456 (36%), Gaps = 78/456 (17%)

Query: 5172 EAIEPKDNEMP---PSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDER 5228
            E + P D EMP   P+ I PL      E     F   V G  +  V WY     ++P   
Sbjct: 3332 EVVSP-DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK-VSWYSKDKKIKPSRF 3389

Query: 5229 IKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTH 5288
             +M +  +   LEI+     + G Y   A N +G+  S AN+ +          P  + H
Sbjct: 3390 FRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL--------EAPESILH 3441

Query: 5289 QHV-MEFDLEHTTS---SRTPSPQEIVL--------EVELSEK-DVKEFEKQVKIVTVPE 5335
            + +  E ++E   +    R   P E+ L        E++ +     + F+   +I    +
Sbjct: 3442 ERIEQEIEMEMKAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDK 3501

Query: 5336 FTPDHKSMIVSLDVLPFNFVDPN----MDSREGEDKELKIDLEVFEM-PPRFIMPICDFK 5390
             +      I SL++L    VD        S E         L V E  PP F+       
Sbjct: 3502 CSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLT 3561

Query: 5391 IPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSAT 5450
                  A F C+V G P  E  W K+   + P    + IS+ +  H L++ N+ + D   
Sbjct: 3562 TFVGKAAKFICTVTGTPVIETIWQKDGAALSPSP-NWRISDAENKHILELSNLTIQDRGV 3620

Query: 5451 YRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVV 5510
            Y C+A N  G  IC+  L + D                                      
Sbjct: 3621 YSCKASNKFGADICQAELIIIDK------------------------------------- 3643

Query: 5511 EGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDG-KLVQGRRFTV--EESGTG 5567
               P FIK +    + I    + +C V    + TV W KDG KL  G+ + +  E+    
Sbjct: 3644 ---PHFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDK--- 3697

Query: 5568 FHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
               L I      D G Y C A+N++G +   A +T+
Sbjct: 3698 IATLEIPLAKLKDSGTYVCTASNEAGSSSCSATVTV 3733



 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 92/431 (21%), Positives = 165/431 (38%), Gaps = 65/431 (15%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PPSFI+ +        ++  F   V G P   + W ++  +L+ D+ + +  V +V +L+
Sbjct: 5047 PPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQ 5106

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            I ++  G  G Y C A N  G  + +A + +    +             ++E       +
Sbjct: 5107 IRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEPAQ-------------IVEKAKSVDVT 5153

Query: 5302 SRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDS 5361
             + P   E V+     E  VK  +   +IV    F+   ++ + S  +      D    +
Sbjct: 5154 EKDPMTLECVV-AGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYT 5212

Query: 5362 REGEDKELKIDLEVF------EMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYK 5415
             + E+       + +       +PP F   +        S    +C V G      +W+K
Sbjct: 5213 FKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFK 5272

Query: 5416 EYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEI 5475
            +   I   + KY +   + S +L++ N+ L D+A Y C+  N  G+  C G LT+ +   
Sbjct: 5273 DGKEIST-SAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILTVKEPPS 5331

Query: 5476 FAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQC 5535
            F V   + +    S +E                                        F+ 
Sbjct: 5332 FLVKPGRQQAIPDSTVE----------------------------------------FKA 5351

Query: 5536 LVRGSPRPTVYWYKDG-KLVQGRR-FTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
            +++G+P   + W+KD  +LV G + F   E  T F NL+  S+  S  G+Y C  TN  G
Sbjct: 5352 ILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLY--SVDASKTGQYTCHVTNDVG 5409

Query: 5594 MAESFAALTLT 5604
                   L +T
Sbjct: 5410 SDSCTTMLLVT 5420



 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 100/457 (21%), Positives = 167/457 (36%), Gaps = 74/457 (16%)

Query: 5158 AYEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWY 5217
            ++E+  S        ++   D  +PPSFI  L         ++     V G     V W+
Sbjct: 6716 SFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAPISVGWF 6775

Query: 5218 RNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIG--EAKSFANVDIMPQ 5275
            ++ + +    + +     NVC+L +S ++  + G Y C A N+ G  E  +   V   P 
Sbjct: 6776 QDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQEPPS 6835

Query: 5276 EERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEI--------VLEVELSEKDVKEFEKQ 5327
             E+      P + + +    L  T+  R   P ++        ++  E     +++F  +
Sbjct: 6836 FEQT-----PDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTE 6890

Query: 5328 VKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPIC 5387
            +++  V        S +V+ D                        L V E P  F+  + 
Sbjct: 6891 LELFEVQPLESGDYSCLVTND---------------AGSASCTTHLFVKE-PATFVKRLA 6934

Query: 5388 DFKIPENSDAVFKCSVIGIPTPEVKWYK-EYMCIEPDNIKYVISEEKGSHTLKIRNVCLS 5446
            DF +   S  V + +  G P   V W K EY+  + +     ++E+  S  L+I    + 
Sbjct: 6935 DFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEK--STILEILESTIE 6992

Query: 5447 DSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFE 5506
            D A Y C   N  G+ IC                      L S++E              
Sbjct: 6993 DYAQYSCLIENEAGQDICE--------------------ALVSVLE-------------- 7018

Query: 5507 FQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGT 5566
                  PP FI+ +    A IG  A  QC V G+P   + WYK+   ++       +   
Sbjct: 7019 ------PPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKN 7072

Query: 5567 GFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
               +L I  +  SD GEY C A N  G   S A L +
Sbjct: 7073 NVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVI 7109



 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 117/488 (23%), Positives = 196/488 (40%), Gaps = 87/488 (17%)

Query: 5185 FIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNK-SLLEPDERIKMERVGNVCSLEIS 5243
            F+      +V E TT  FI +V G P+P VKW + K   L    R+ + + G+   LEI 
Sbjct: 8456 FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIR 8515

Query: 5244 NIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSR 5303
            +  K + G Y C A N  GE +S  N+ +   +ER          Q  +E DL      +
Sbjct: 8516 DTTKTDSGLYRCVAFNEHGEIESNVNLQV---DER--------KKQEKIEGDL-RAMLKK 8563

Query: 5304 TP-------SPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVD 5356
            TP         +EI +   L   D KE+EK  ++  + +F    + ++ + ++L  +  +
Sbjct: 8564 TPILKKGAGEEEEIDIMELLKNVDPKEYEKYARMYGITDF----RGLLQAFELLKQSQEE 8619

Query: 5357 -------PNMDSREGEDKELKIDLEVFEM------PPRFIMPICDFKIPENSDAVFKCSV 5403
                     ++  E ++KE +  +   +       P   I  I +  + +++DAVF+  +
Sbjct: 8620 ETHRLEIEEIERSERDEKEFEELVSFIQQRLSQTEPVTLIKDIENQTVLKDNDAVFEIDI 8679

Query: 5404 -IGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEA 5462
             I  P  ++ WYK    +EP + K+ IS +   HTL+++N  L D   YR      +  A
Sbjct: 8680 KINYPEIKLSWYKGTEKLEPSD-KFEISIDGDRHTLRVKNCQLKDQGNYRLVCGPHIASA 8738

Query: 5463 --------------------------ICRGFLTMGDSEIF--------------AVIAKK 5482
                                       C+  +    SE F               V  K 
Sbjct: 8739 KLTVIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRILKPQGRHKTEVEHKV 8798

Query: 5483 SKVTLSSLMEE----LVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVR 5538
             K+T++ +  E       K    ++  E ++   P +F K I +       +A F+C V 
Sbjct: 8799 HKLTIADVRAEDQGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIVVSEHQSATFECEV- 8857

Query: 5539 GSPRPTVYWYK-DGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVA-TNKSGMAE 5596
                  V WYK   +L + +++     G   H + I ++   DEG Y  +A     G A 
Sbjct: 8858 SFDDAIVTWYKGPTELTESQKYNFRNDGR-CHYMTIHNVTPDDEGVYSVIARLEPRGEAR 8916

Query: 5597 SFAALTLT 5604
            S A L LT
Sbjct: 8917 STAELYLT 8924



 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 320/1710 (18%), Positives = 594/1710 (34%), Gaps = 224/1710 (13%)

Query: 3938 RPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLEN 3997
            + +  PP+F+Q ++S  V +G          G P P+V +Y +   I  + +F I    +
Sbjct: 98   KAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGD 157

Query: 3998 YSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDE-- 4055
               L ++  + ++ G+ +    N  G   +T+ L V+ +++   K  K  V    + E  
Sbjct: 158  LYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESR 217

Query: 4056 ----EEELALVFDQAKGAHPSMSQEGQTNLHL-LKTNPPVPPSGDTELLSFPVEIQVTAA 4110
                E+++   FD    A   M  +G     L  KT P +PP   +     P    + A 
Sbjct: 218  QTRIEKKIEAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSR---SPTPPSIAAK 274

Query: 4111 TPIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARC 4170
              +  Q   S        +     P    T SP       + I+  P + ++  P   R 
Sbjct: 275  AQLARQQSPSPIRHSPSPVRHVRAP----TPSPVRSVSPAARISTSPIRSVRS-PLLMRK 329

Query: 4171 REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKY- 4229
             +  +      ++  P+    W Q G +   ++  +  E   +    I+    +  G+Y 
Sbjct: 330  TQAST------VATGPEVPPPWKQEGYVASSSEA-EMRETTLTTSTQIR-TEERWEGRYG 381

Query: 4230 ---KCVAENNSGAVESVSDLTVEPVTYRENSQFENIGEIYGKYSRDQQLQDQGESVRAHF 4286
               +      +GA  SVS       +Y   +      E+          QD  +S     
Sbjct: 382  VQEQVTISGAAGAAASVS----ASASYAAEAVATGAKEV---------KQDADKS----- 423

Query: 4287 YDYPAGPFTPWTNVKEYSVRDYFQSLETIEQIDQKEQVRCI---PSREKIPRFVHGASRT 4343
                A   T    V    VR+    +  +EQ  Q+     +   P++E++ +     + T
Sbjct: 424  ----AAVATVVAAVDMARVRE--PVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVT 477

Query: 4344 IKISKPIRAEFIQCQAEGKERHVSEKSKLHQAEGTVYPFVDDFSDVTIKKEIRNNFGKLG 4403
              +    +A+  + ++  KE   +++ ++H      +  +   ++ T   ++  +  K  
Sbjct: 478  KVVVAADKAKEQELKSRTKEVITTKQEQMH----VTHEQIRKETEKTFVPKVVISAAKAK 533

Query: 4404 RSEKENVQECAQSDYLPNIHSERISDSYNTKDSSAIVYEESLGEEIHYPGKKVKHRIIEF 4463
              E    +E  +      +  E I        +S +V   +   ++       +    + 
Sbjct: 534  EQETRISEEITKKQ--KQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQ 591

Query: 4464 EKLHV--EKGVLEKRPTRTSIVNPPQKKIDDKAFSLKQRESRSSNLNANMYQAEKMSPNT 4521
            +++H+  EK + E R T    V     K+ ++    + RE  ++         EKM    
Sbjct: 592  DQMHLSYEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEA 651

Query: 4522 ESDS-SNIAI-NLKLLSSQTHKEFDAQEREQQEKISLI-DKPAISKRAEHESPITFDLKQ 4578
            E  + S IA+   K    +T          +QE+I +   K  + K+AE  + +   + Q
Sbjct: 652  EKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQ 711

Query: 4579 FHTQIKHTDVKFQELDSGQPEEAYFKIQHPADTENIVFDLKQMYSHIGDPALEFQGQETR 4638
               +        +  + G  EE+Y      A    + +  K+  S     A +      R
Sbjct: 712  ARVR--------EPREPGHLEESY------AQQTTLEYGYKERIS-----AAKVAEPPQR 752

Query: 4639 EQQEIHYKEKIPSPETLQ-PDTHNISKSVQNNVFASQEISSSQELSNRTMVEKSSIDENS 4697
               E H   K   P  +Q P   +I  + Q  +  S +I  + +L+   +V    +D+  
Sbjct: 753  PASEPHVVPKAVKPRVIQAPSETHIKTTDQKGMHISSQIKKTTDLTTERLVH---VDKRP 809

Query: 4698 ISLEKEVRHVQEQNLDILKTDLSLKS--FSEEIYSESCALLPTSSAD-IEETDLSEKSCP 4754
             +      H     + + KT+   ++      I +    L  TSSA  I ++  +    P
Sbjct: 810  RTASP---HFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSSAQKITKSVKAPTVKP 866

Query: 4755 LENGGRSSISHLKKAASEEKPLGVGEMEEECTLEPELAAFPKQDGGT-QEYTDATLEDHR 4813
             E   R+  + L +    + P      + E  +E +        G T +E     L    
Sbjct: 867  SETRVRAEPTPLPQFPFADTP---DTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGRE 923

Query: 4814 GDVQEADTLHRQLSLSQCFPLLMTEEQQ---NPGEQISTNIHASGEEK-----CYEEVQV 4865
              V E   +   + +    P L++  +      GE ++   H SG          E+ Q+
Sbjct: 924  AKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQI 983

Query: 4866 QNEASF-----STLEGEMIETSFSQNIPKLDEAHTTEAAESETSLTQYLLAAGKREVPET 4920
            ++   F     S +   MI  +F+++  +   +   EA    TS    +  + + E   T
Sbjct: 984  ESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETT 1043

Query: 4921 ----KDTRDQAKLVQSESITSMEVEEVTFNTVYEYYNQKQESLGRPLSPESDISIGVGST 4976
                K T ++ + V+S  +   +              ++Q   G P +P           
Sbjct: 1044 AVTEKFTTEEKRFVESRDVVMTDTS----------LTEEQAGPGEPAAPY--------FI 1085

Query: 4977 TSEEISELDQFYTPPSSVEYFESPKSPDLYFNPSDITKQSSIHSGGETVERYSTPLGEVA 5036
            T   + +L +  +     +   +PK P +Y+  S +     + +G      Y+   GE  
Sbjct: 1086 TKPVVQKLVEGGSVVFGCQVGGNPK-PHVYWKKSGV----PLTTGYRYKVSYNKQTGECK 1140

Query: 5037 ERYSTPSEGEVGER---YSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLE 5093
               S     + GE         GET    S       E       E L  Y T     ++
Sbjct: 1141 LVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEML--YQTQVTAFVQ 1198

Query: 5094 R---YSTPPGETLERYSTPPGEALERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEHFYT 5150
                  T PG     Y     +  E+  I       T   +TY    E    +  E    
Sbjct: 1199 EPKVGETAPGFVYSEYEKEYEK--EQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIK 1256

Query: 5151 PTEER---GSAYEIWRSDSFGTPNEAIEPKDNEMPPS-FIEPLTKRKVYENTTLGFIVEV 5206
              E R    +  E+   D  G    A++  ++E   S F   +   ++ E   + F  ++
Sbjct: 1257 EIEYRIIKTTLEELLEED--GEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKM 1314

Query: 5207 EGLPVPGVKWYRNKSLLEPDERIKMERV-GNVCSLEISNIQKGEGGEYMCHAVNIIGEAK 5265
             G P+P + WY++   ++  ER +M+ +     SL I  +   + G Y   A NI G A 
Sbjct: 1315 SGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAI 1374

Query: 5266 SFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFE 5325
                + + P          P          LE  +  R+ SP+     V  S   +    
Sbjct: 1375 CSGKLYVEPAAPLGAPTYIPT---------LEPVSRIRSLSPR----SVSRSPIRMSPAR 1421

Query: 5326 KQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMP 5385
                 ++    +P   S              P     E ++ +L+    +++  P F++ 
Sbjct: 1422 MSPARMSPARMSPARMS--------------PGRRLEETDESQLE---RLYK--PVFVLK 1462

Query: 5386 ICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCL 5445
               FK  E   A F   V+G P PE  W+ +   I  D    V+ +E G+ +L I     
Sbjct: 1463 PVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATP 1522

Query: 5446 SDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFF 5505
            SDS  +   A N  G +     LT+                                   
Sbjct: 1523 SDSGEWTVVAQNRAGRSSISVILTV--------------------------------EAV 1550

Query: 5506 EFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRF-TVEES 5564
            E QV    P F++ + +     G+    +    G+P P + W K+  ++   ++  +   
Sbjct: 1551 EHQV---KPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIE 1607

Query: 5565 GT-GFHNLFITSLVKSDEGEYRCVATNKSG 5593
            GT G   L I S V  D   Y   A NK+G
Sbjct: 1608 GTKGEAALKIDSTVSQDSAWYTATAINKAG 1637



 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 61/205 (29%), Positives = 98/205 (47%), Gaps = 9/205 (4%)

Query: 3    TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
            T  P+FT+ L+    L GS+   E  + G P   VSWF +G  IS+      Q + +D  
Sbjct: 7679 TVPPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRK--YQTTLTDNT 7736

Query: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
              LT+  + +++SG Y+  ATN +G    +A L V+    PP+FVQ+   M V  G+ V 
Sbjct: 7737 CALTVNMLEESDSGDYTCIATNMAGSDECSAPLTVRE---PPSFVQKPDPMDVLTGTNVT 7793

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
                V G P   V +++  +E+       +S E  +  L + +     SG Y+   +N  
Sbjct: 7794 FTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELFDVDTSQSGEYTCIVSNEA 7853

Query: 183  GRATSTAELLVQGEEEVPAKKTKTI 207
            G+A+ T  L +    + PAK  K +
Sbjct: 7854 GKASCTTHLYI----KAPAKFVKRL 7874



 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 120/524 (22%), Positives = 196/524 (37%), Gaps = 69/524 (13%)

Query: 5136 KIEREDGTPNEHFYTPTEERGSAYEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVY 5195
            + E+E     E F T  +    + ++  +D+  T  +A         P FI     +K+ 
Sbjct: 1037 EFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQA--GPGEPAAPYFITKPVVQKLV 1094

Query: 5196 ENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKME--RVGNVCSLEISNIQKGEGGEY 5253
            E  ++ F  +V G P P V W ++   L    R K+   +    C L IS     + GEY
Sbjct: 1095 EGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEY 1154

Query: 5254 MCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLE 5313
                 N  GE  + A++      E ++        Q  M +  + T   + P   E    
Sbjct: 1155 TIVVRNKHGETSASASLLEEADYELLMK------SQQEMLYQTQVTAFVQEPKVGETAPG 1208

Query: 5314 VELSEKDVKEFEKQVKI---------VTVPEFTPDHKSMIVSLDV-----LPFNFVDPNM 5359
               SE + KE+EK+  +         V V  +  D +  I S +      + +  +   +
Sbjct: 1209 FVYSEYE-KEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTL 1267

Query: 5360 DSREGEDKELKIDLEVFE---MPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKE 5416
            +    ED E K+ +++ E   +   F   I +++I E     F C + G P P++ WYK+
Sbjct: 1268 EELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1327

Query: 5417 YMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFL------TM 5470
               I+      +   + G  +L+I  V   D   Y   A N  G AIC G L       +
Sbjct: 1328 GKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPL 1387

Query: 5471 GDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVE------GPPRFIKG----- 5519
            G       +   S++   SL    V +S    S               P R   G     
Sbjct: 1388 GAPTYIPTLEPVSRI--RSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEE 1445

Query: 5520 -----ISDCYAPI------------GTAAYFQCLVRGSPRPTVYWYKDGKLVQG---RRF 5559
                 +   Y P+            G  A F   V G P P  +W+ DG+ +      + 
Sbjct: 1446 TDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKV 1505

Query: 5560 TVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
             ++E GT   +L I     SD GE+  VA N++G +     LT+
Sbjct: 1506 VIKEDGT--QSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTV 1547



 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 60/190 (31%), Positives = 96/190 (50%), Gaps = 5/190 (2%)

Query: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64
            AP FT+PL++V  +   T   +  I+G     VSWF+DG+ I+ S     +I+F +G A 
Sbjct: 4112 APFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEIAASDR--YRIAFVEGTAS 4169

Query: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQ 124
            L I  V   ++G ++ +ATN  G   S+  L+V+    PP+FV +  S  V  GS V L+
Sbjct: 4170 LEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQE---PPSFVTKPGSKDVLPGSAVCLK 4226

Query: 125  VRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184
                G     +++++   E+ S     I++E    SL +      DSGTY+   +N  G 
Sbjct: 4227 STFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGG 4286

Query: 185  ATSTAELLVQ 194
               +A L V+
Sbjct: 4287 VECSANLFVK 4296



 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 55/188 (29%), Positives = 96/188 (51%), Gaps = 2/188 (1%)

Query: 7    TFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLT 66
            T T+   S+ V +G  AT +   SG       WF+DGQ ++  +    +IS +D  + L 
Sbjct: 4580 TITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSK--YKISVTDTVSILK 4637

Query: 67   IPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVR 126
            I +  K +SG Y+ +  N  G+++  A + V     PP+F ++L+ M   +GS + L+  
Sbjct: 4638 IISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECI 4697

Query: 127  VTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRAT 186
            V G     +++++D  EI +S  ++ S   +   L I++    DSGTY+ +ATN  G   
Sbjct: 4698 VAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQ 4757

Query: 187  STAELLVQ 194
             +  L V+
Sbjct: 4758 CSGHLTVK 4765



 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 59/210 (28%), Positives = 100/210 (47%), Gaps = 5/210 (2%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P F   L S+ V+ G  A  +A I G     V W ++ + +   +   ++I+F +  A
Sbjct: 5608 EPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRES-ENIRITFVENVA 5666

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             L       AN+G+Y  +  N  G   + A L+V     P   V++   MTV  G    L
Sbjct: 5667 TLQFAKAEPANAGKYICQIKNDGGMRENMATLMV---LEPAVIVEKAGPMTVTVGETCTL 5723

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
            + +V G P   V++Y+DG  + SS   + S    + SL I     +D+GTY+    N+VG
Sbjct: 5724 ECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQVQNNVG 5783

Query: 184  RATSTAELLVQGEEEVPAKKTKTIVSTAQI 213
            +++ TA + V  +  VP   T+ + +T  +
Sbjct: 5784 KSSCTAVVDV-SDRAVPPSFTRRLKNTGGV 5812



 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 63/189 (33%), Positives = 94/189 (49%), Gaps = 6/189 (3%)

Query: 4    QAPTFTQPLQ-SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
            + P F + L+ S V  +G +   E  ISG P  +VSWFR+   +  S      +SF +  
Sbjct: 6362 EPPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWK--YNMSFINSV 6419

Query: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
            A LTI   +  +SG Y  +A NG G A+ +  L VKA   PP F Q+   +   +GS V 
Sbjct: 6420 ALLTINEASAEDSGDYICEAHNGVGDASCSTALTVKA---PPVFTQKPSPVGALKGSDVI 6476

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
            LQ  ++G P   V + +D  ++++S  F+I+ +    SL I      D G Y   ATN V
Sbjct: 6477 LQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHILNLEASDVGEYHCKATNEV 6536

Query: 183  GRATSTAEL 191
            G  T +  +
Sbjct: 6537 GSDTCSCSV 6545



 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 76/318 (23%), Positives = 129/318 (40%), Gaps = 31/318 (9%)

Query: 3935 FRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHS 3994
            FR + ++ PPSF ++++  E   G      C   G     V WY + + +  ++N     
Sbjct: 6166 FRIQERQLPPSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSF 6225

Query: 3995 LENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKH---DVKAHKVPVFHD 4051
            ++N + L +      + G  +C   N  GT  +++ L  +  +K    D+K    PV  D
Sbjct: 6226 VDNVATLKILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIK----PVSID 6281

Query: 4052 YLDEEEELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAAT 4111
             +  E   A       GA P         +   K N  + P G+  +      +  T   
Sbjct: 6282 VIAGES--ADFECHVTGAQPM-------RITWSKDNKEIRPGGNYTITC----VGNTPHL 6328

Query: 4112 PIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCR 4171
             I +  K     +  +              S K           EPPK ++++      +
Sbjct: 6329 RILKVGKGDSGQYTCQATNDVGKDMCSAQLSVK-----------EPPKFVKKLEASKVAK 6377

Query: 4172 EGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKC 4231
            +G+SI LEC ISG P+  V+WF+N   L ++ K+    +N    L I + +++DSG Y C
Sbjct: 6378 QGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALLTINEASAEDSGDYIC 6437

Query: 4232 VAENNSGAVESVSDLTVE 4249
             A N  G     + LTV+
Sbjct: 6438 EAHNGVGDASCSTALTVK 6455



 Score = 87.0 bits (214), Expect = 5e-16
 Identities = 62/220 (28%), Positives = 103/220 (46%), Gaps = 6/220 (2%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P+F + L+ +    G   T    ++G    +V W+RDG ++       +Q SF D  A L
Sbjct: 6175 PSFARQLKDIEQTVGLPVTLTCRLNGSAPIQVCWYRDGVLLRDDE--NLQTSFVDNVATL 6232

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             I     ++SG+YS  A+N  G A+S+A L  +     P F  +  S+ V  G     + 
Sbjct: 6233 KILQTDLSHSGQYSCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFEC 6292

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             VTG     + + +D  EI+   ++ I+  G+   L I +    DSG Y+  ATN VG+ 
Sbjct: 6293 HVTGAQPMRITWSKDNKEIRPGGNYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKD 6352

Query: 186  TSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKI 225
              +A+L V    + P K  K + ++    +    ++E KI
Sbjct: 6353 MCSAQLSV----KEPPKFVKKLEASKVAKQGESIQLECKI 6388



 Score = 86.3 bits (212), Expect = 8e-16
 Identities = 108/466 (23%), Positives = 172/466 (36%), Gaps = 105/466 (22%)

Query: 5175 EPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERV 5234
            + K+ + P   + P   R V E  T  F   V G P P V WY N  L+   +R ++ R 
Sbjct: 1834 DQKEKQKPDIVLYPEPVR-VLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RY 1891

Query: 5235 GNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEE-----RVVALPPPVTHQ 5289
              +  L+I + +  + GE    A N  G  +    ++I  +E+     R    P P  H 
Sbjct: 1892 DGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHV 1951

Query: 5290 HV---MEFDL---------------------EHTTSSRTPSPQE---------------- 5309
            H    ++F++                     E  T  + P   E                
Sbjct: 1952 HEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYE 2011

Query: 5310 IVLEVEL-SEKDVKEFEKQVK------IVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSR 5362
             +  VEL S K  + +E+ ++      +    E T + K  +     +      P+    
Sbjct: 2012 AITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPD---- 2067

Query: 5363 EGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEP 5422
                   KI+L      P+    I    + + SDA F+  V+G P PE +WYK  + IE 
Sbjct: 2068 -------KIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIER 2120

Query: 5423 DNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKK 5482
             +  Y    E     L IR+V   DSA+   +A+N  GE           S  F ++  K
Sbjct: 2121 SDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET---------SSHAFLLVQAK 2171

Query: 5483 SKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPR 5542
              +T +  ++++V K   T + FE +  E                             P 
Sbjct: 2172 QLITFTQELQDVVAKEKDTMATFECETSE-----------------------------PF 2202

Query: 5543 PTVYWYKDGKLV-QGRRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
              V WYKDG  V +G ++ +  S    H L I ++  SD  +Y CV
Sbjct: 2203 VKVKWYKDGMEVHEGDKYRM-HSDRKVHFLSILTIDTSDAEDYSCV 2247



 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 64/220 (29%), Positives = 97/220 (44%), Gaps = 11/220 (5%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRD-GQVISTSTLPGVQISFSDGR 62
            + P F + L     L G      A + GF    V W +D G+VI  S     +ISF D  
Sbjct: 6549 EPPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESE--NTRISFIDNI 6606

Query: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
            A L + +   +NSG+Y  +  N +G    +A L V     P   +++ + MTV  G+   
Sbjct: 6607 ATLQLGSPEASNSGKYICQIKNDAGMRECSAVLTV---LEPARIIEKPEPMTVTTGNPFA 6663

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
            L+  VTG P    K+++DG E+ +     I+    + SL I  A   D G YS    NSV
Sbjct: 6664 LECVVTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSV 6723

Query: 183  GRATSTAELLVQGEEEVPA-----KKTKTIVSTAQISESR 217
            G++  T  + V      P+     K    I+  + + E R
Sbjct: 6724 GKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECR 6763



 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/182 (29%), Positives = 90/182 (49%), Gaps = 2/182 (1%)

Query: 13   QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
            + + V  G+    E  ++G P     WF+DG+ +S  +     I+F +  A L IP    
Sbjct: 6652 EPMTVTTGNPFALECVVTGTPELSAKWFKDGRELSADSKH--HITFINKVASLKIPCAEM 6709

Query: 73   ANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPT 132
            ++ G YS +  N  G++  T  + V     PP+F+++L+ +    G+ V L+ RV+G   
Sbjct: 6710 SDKGLYSFEVKNSVGKSNCTVSVHVSDRIVPPSFIRKLKDVNAILGASVVLECRVSGSAP 6769

Query: 133  PVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELL 192
              V +++DG EI S    Q S   ++ +L ++   P D+G Y+  A N  G    +A L 
Sbjct: 6770 ISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAGSDECSAVLT 6829

Query: 193  VQ 194
            VQ
Sbjct: 6830 VQ 6831



 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 54/199 (27%), Positives = 96/199 (48%), Gaps = 2/199 (1%)

Query: 2    TTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDG 61
            T + P F   L+ +    G + + +  ++G P   VSW++    +  +  P  +  F++ 
Sbjct: 6075 TLEPPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPT--PEYRTYFTNN 6132

Query: 62   RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQV 121
             A L    V   +SG Y+ KA N  G A+S     ++    PP+F ++L+ +    G  V
Sbjct: 6133 VATLVFNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQLPPSFARQLKDIEQTVGLPV 6192

Query: 122  RLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181
             L  R+ G     V +YRDG  ++   + Q S   ++ +L I +     SG YS +A+N 
Sbjct: 6193 TLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASNP 6252

Query: 182  VGRATSTAELLVQGEEEVP 200
            +G A+S+A L  +  ++ P
Sbjct: 6253 LGTASSSARLTAREPKKSP 6271



 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 64/220 (29%), Positives = 103/220 (46%), Gaps = 7/220 (3%)

Query: 4    QAPTFTQPLQ-SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
            + P F + L+ S +V +     +E  I G P  +V W++D   I  S+    ++SF D  
Sbjct: 7303 EPPRFIKKLEPSRIVKQDEFTRYECKIGGSPEIKVLWYKDETEIQESSK--FRMSFVDSV 7360

Query: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
            A L +  ++  +SG Y+ +A N +G A+S+  L VK    PP F ++   +   +G+ V 
Sbjct: 7361 AVLEMHNLSVEDSGDYTCEAHNAAGSASSSTSLKVKE---PPIFRKKPHPIETLKGADVH 7417

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
            L+  + G P   V +Y+D  E++S   ++I  E  L S+ I      D G Y   ATN V
Sbjct: 7418 LECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDV 7477

Query: 183  GRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIE 222
            G  T    + ++       KK   I +        QT IE
Sbjct: 7478 GSDTCVGSIALKAPPRF-VKKLSDISTVVGKEVQLQTTIE 7516



 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 123/533 (23%), Positives = 194/533 (36%), Gaps = 88/533 (16%)

Query: 5091 TLERYSTPPGETLER---YSTPPGEALERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEH 5147
            T   Y   P + ++R   YS   G+ L      TG P  + T+K     +     TP++ 
Sbjct: 7859 TTHLYIKAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINV-----TPSQR 7913

Query: 5148 FYTPTEERGSAYEIWRS--DSFGTPNEAIEPKDNE----------MPPSFIEPLTKRKVY 5195
                T E+ +  EI  S  +  G  N  IE    +           PP F++ L   KV 
Sbjct: 7914 CNITTTEKSAILEIPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEPVKVS 7973

Query: 5196 ENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMC 5255
               +     ++ G P  GV WY+  + L P    KM    NV +L  + +   + GEY+C
Sbjct: 7974 VGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYIC 8033

Query: 5256 HAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVE 5315
             A N +GE  +   + +  Q+     LPP  + Q     D++ T          +V +  
Sbjct: 8034 KAENSVGEVSASTFLTVQEQK-----LPPSFSRQ---LRDVQETVG------LPVVFDCA 8079

Query: 5316 LSEKD---VKEFEKQVKIVTVPEFTPDHKSMIVSLDV------LPFNFVDPNMDSREGED 5366
            +S  +   V  ++    +   P           +L++      L   +     +      
Sbjct: 8080 ISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSAS 8139

Query: 5367 KELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIK 5426
               ++ L   + PP F + +          A F+C V G    +V W K+   I     K
Sbjct: 8140 SSARLILTEGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGG-K 8198

Query: 5427 YVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVT 5486
            Y IS  + S  L +  V   DS  Y C AVN VG+  C   L                  
Sbjct: 8199 YQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQL------------------ 8240

Query: 5487 LSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPI-GTAAYFQCLVRGSPRPTV 5545
              ++ E L+                 PP F K +S+      G +   +  V GS   TV
Sbjct: 8241 --NIKERLI-----------------PPSFTKRLSETVEETEGNSFKLEGRVAGSQPITV 8281

Query: 5546 YWYKDGKLVQGRRFTVEESGTGFHNLFITSLVK---SDEGEYRCVATNKSGMA 5595
             WYK+   +Q    T     T  +N  +  + K   +D G Y C  +N +G A
Sbjct: 8282 AWYKNNIEIQP---TSNCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSA 8331



 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 98/429 (22%), Positives = 162/429 (37%), Gaps = 47/429 (10%)

Query: 5178 DNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNV 5237
            + + PP F   L         +  F   V G     V W ++   +    + ++  + N 
Sbjct: 8148 EGKNPPFFDIRLAPVDAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENS 8207

Query: 5238 CSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLE 5297
              L +  + KG+ G+Y C+AVN +G+    A ++I   +ER++  PP  T +      L 
Sbjct: 8208 AHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNI---KERLI--PPSFTKR------LS 8256

Query: 5298 HTTSSRTPSPQEIVLEVELSEK-DVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVD 5356
             T      +  ++   V  S+   V  ++  ++I          K+  + L V      D
Sbjct: 8257 ETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKAGMND 8316

Query: 5357 PNMDSREGEDKE------LKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPE 5410
              + + +  +          I ++  + PP F   +    + E       C V G     
Sbjct: 8317 AGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLSCHVQGSEPIR 8376

Query: 5411 VKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTM 5470
            ++W K    I+P + +   S   G+  L++R+V  +DS  Y C+A N  G    +  +T+
Sbjct: 8377 IQWLKAGREIKPSD-RCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGSDTTKSKVTI 8435

Query: 5471 GDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTA 5530
             D    A   KK+                          V+G   F+           T 
Sbjct: 8436 KDKPAVAPATKKA-------------------------AVDGRLFFVSEPQSIRVVEKTT 8470

Query: 5531 AYFQCLVRGSPRPTVYWYKDG--KLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVA 5588
            A F   V G P P V W K    +L QG R  + + G     L I    K+D G YRCVA
Sbjct: 8471 ATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEA-KLEIRDTTKTDSGLYRCVA 8529

Query: 5589 TNKSGMAES 5597
             N+ G  ES
Sbjct: 8530 FNEHGEIES 8538



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 72/251 (28%), Positives = 104/251 (41%), Gaps = 11/251 (4%)

Query: 5360 DSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMC 5419
            +++  E   +   +E+   PP  +  + +  + E      +C + G P+P V WY+E   
Sbjct: 923  EAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 982

Query: 5420 IEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIF--- 5476
            IE  +I + I+ + G   L IR     DS  + C AVN  G      +L +  SE F   
Sbjct: 983  IE-SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKE 1041

Query: 5477 -AVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPR---FIKGISDCYAPIGTAAY 5532
               + +K        +E   +    T S  E Q   G P    FI          G +  
Sbjct: 1042 TTAVTEKFTTEEKRFVESRDVVMTDT-SLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVV 1100

Query: 5533 FQCLVRGSPRPTVYWYKDG-KLVQGRRFTVE-ESGTGFHNLFITSLVKSDEGEYRCVATN 5590
            F C V G+P+P VYW K G  L  G R+ V     TG   L I+     D GEY  V  N
Sbjct: 1101 FGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRN 1160

Query: 5591 KSGMAESFAAL 5601
            K G   + A+L
Sbjct: 1161 KHGETSASASL 1171



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 53/190 (27%), Positives = 91/190 (47%), Gaps = 5/190 (2%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P+F + ++S   L G TA F+A + G     V+W +D   I+      ++++F +  A
Sbjct: 4484 EPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDD--NIRMTFENNVA 4541

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             L +  +   + G+Y  +A N +G    +A L VK    P    +   S+ V QG    L
Sbjct: 4542 SLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE---PATITEEAVSIDVTQGDPATL 4598

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
            QV+ +G      K+++DG E+     ++IS    +  L I     +DSG Y+    N VG
Sbjct: 4599 QVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVG 4658

Query: 184  RATSTAELLV 193
            R++  A + V
Sbjct: 4659 RSSCKARINV 4668



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 102/432 (23%), Positives = 150/432 (34%), Gaps = 71/432 (16%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PPSF++     +V     + F   + G P   V W+R    L   +R  +     V  LE
Sbjct: 5892 PPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELE 5951

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            + NI   + GEY C   N  G+A             R+    P    + + +  +E   S
Sbjct: 5952 LFNIDISQSGEYTCVVSNNAGQASCTT---------RLFVKEPAAFLKRLSDHSVEPGKS 6002

Query: 5302 SRTPSPQEIVLEVELSEK----DVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDP 5357
                S     L + ++ K    ++   EK   IVT        K+ I  L++L     D 
Sbjct: 6003 IILESTYTGTLPISVTWKKDGFNITTSEK-CNIVTT------EKTCI--LEILNSTKRDA 6053

Query: 5358 NMDSREGEDKE-------LKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPE 5410
               S E E++        L   LE    PP F+  +   +         +C V G P   
Sbjct: 6054 GQYSCEIENEAGRDVCGALVSTLE----PPYFVTELEPLEAAVGDSVSLQCQVAGTPEIT 6109

Query: 5411 VKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTM 5470
            V WYK    + P   +Y         TL    V ++DS  Y C+A N +G A  +     
Sbjct: 6110 VSWYKGDTKLRPTP-EYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASSK----- 6163

Query: 5471 GDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTA 5530
                                            + F  Q  + PP F + + D    +G  
Sbjct: 6164 --------------------------------TVFRIQERQLPPSFARQLKDIEQTVGLP 6191

Query: 5531 AYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATN 5590
                C + GS    V WY+DG L++               L I     S  G+Y C A+N
Sbjct: 6192 VTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQYSCSASN 6251

Query: 5591 KSGMAESFAALT 5602
              G A S A LT
Sbjct: 6252 PLGTASSSARLT 6263



 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 56/192 (29%), Positives = 96/192 (50%), Gaps = 9/192 (4%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG--VQISFSDG 61
            + P+F Q    + VL G+  TF + + G P   VSWF+     S+  +PG    +S  D 
Sbjct: 7773 EPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKG----SSELVPGDRCNVSLEDS 7828

Query: 62   RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQV 121
             A+L +  V  + SG Y+   +N +G+A+ T  L +KA   P  FV+RL   ++ +G  +
Sbjct: 7829 VAELELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKA---PAKFVKRLNDYSIEKGKPL 7885

Query: 122  RLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181
             L+   TG P   V + ++G  +  S    I+       L I  +  ED+G Y+    N+
Sbjct: 7886 ILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENA 7945

Query: 182  VGRATSTAELLV 193
             G+ + +A++L+
Sbjct: 7946 SGKDSCSAQILI 7957



 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 57/189 (30%), Positives = 89/189 (47%), Gaps = 5/189 (2%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P+F + L+ V  + G++   E  +SG     V WF+DG  I +   P  Q SFS+    L
Sbjct: 6741 PSFIRKLKDVNAILGASVVLECRVSGSAPISVGWFQDGNEIVSG--PKCQSSFSENVCTL 6798

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             +  +  +++G Y+  A N +G    +A L V+    PP+F Q   S+ V  G  +    
Sbjct: 6799 NLSLLEPSDTGIYTCVAANVAGSDECSAVLTVQE---PPSFEQTPDSVEVLPGMSLTFTS 6855

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             + G P   VK+++   E+       IS E  +  L + E  P +SG YS   TN  G A
Sbjct: 6856 VIRGTPPFKVKWFKGSRELVPGESCNISLEDFVTELELFEVQPLESGDYSCLVTNDAGSA 6915

Query: 186  TSTAELLVQ 194
            + T  L V+
Sbjct: 6916 SCTTHLFVK 6924



 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 57/213 (26%), Positives = 103/213 (48%), Gaps = 2/213 (0%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P F + L+ V V  G +A+ +  ++G P   VSW++    +  +T    ++ F +  A
Sbjct: 7959 EPPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTT--YKMHFRNNVA 8016

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             L    V   +SG Y  KA N  G+ +++  L V+ +  PP+F ++L+ +    G  V  
Sbjct: 8017 TLVFNQVDINDSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVF 8076

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
               ++G     V +Y+DG  ++ S + Q S   +  +L I +     +G YS  ATN +G
Sbjct: 8077 DCAISGSEPISVSWYKDGKPLKDSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIG 8136

Query: 184  RATSTAELLVQGEEEVPAKKTKTIVSTAQISES 216
             A+S+A L++   +  P    +     A + ES
Sbjct: 8137 SASSSARLILTEGKNPPFFDIRLAPVDAVVGES 8169



 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 56/207 (27%), Positives = 104/207 (50%), Gaps = 7/207 (3%)

Query: 4    QAPTFTQPLQ-SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
            + P+F + +  S ++L G +A     + G PV +V+WF++ + +S S    V++ F +  
Sbjct: 3735 EPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNT--VRMYFVNSE 3792

Query: 63   AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
            A L I  V   +SG YS +A N  G  + + E+++K    PP+F++ L+   + +G+   
Sbjct: 3793 AILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKE---PPSFIKTLEPADIVRGTNAL 3849

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
            LQ  V+G     + +++D  +I+SS  +++  +  L  L I      D G Y     N V
Sbjct: 3850 LQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADVGEYECVVANEV 3909

Query: 183  GRATSTAELLVQGEEEVPAKKTKTIVS 209
            G+    A  L++ E     KK   +++
Sbjct: 3910 GKCGCMATHLLK-EPPTFVKKVDDLIA 3935



 Score = 83.2 bits (204), Expect = 7e-15
 Identities = 58/220 (26%), Positives = 107/220 (48%), Gaps = 6/220 (2%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P F + L+ V    G    FE  I+G    +VSW++DG ++       +Q SF    A L
Sbjct: 7116 PFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDA--NLQTSFVHNVATL 7173

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             I    +++ G+Y+  A+N  G A+S+A+L++     PP F  +  S+ +  G     + 
Sbjct: 7174 QILQTDQSHIGQYNCSASNPLGTASSSAKLILSEHEVPPFFDLKPVSVDLALGESGTFKC 7233

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             VTG     + + +D  EI+   +++++   +  +L + +    D+G Y+  A+N  G+ 
Sbjct: 7234 HVTGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKD 7293

Query: 186  TSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKI 225
            + +A+L VQ     P +  K +  +  + +   TR E KI
Sbjct: 7294 SCSAQLGVQ----EPPRFIKKLEPSRIVKQDEFTRYECKI 7329



 Score = 83.2 bits (204), Expect = 7e-15
 Identities = 91/401 (22%), Positives = 150/401 (37%), Gaps = 71/401 (17%)

Query: 3845  NTTIGESSTYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASERIKKDD 3904
             + T G+ +TY +    ++E  E P +V   +T   + +  +     E E  +S R  K  
Sbjct: 32462 DVTGGDYTTYASQ--RRDE--EVPRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQ 32517

Query: 3905  LRELQLSASTRIDEFKTEQK----EENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDS 3960
             + E + S S+       E K    EE     +++ RK         L +  S  VYEG+S
Sbjct: 32518 MTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGES 32577

Query: 3961  CNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFN 4020
               F C   G P P VTW      +  +    + + +  S   +SSV   +EG+ + V+ N
Sbjct: 32578 ARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVEN 32637

Query: 4021  QYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTN 4080
               G                               +E E  L   +A+    ++       
Sbjct: 32638 SEGK------------------------------QEAEFTLTIQKARVTEKAV------- 32660

Query: 4081  LHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESKEVFQTEELEPKAMPQDQVT 4140
                  T+PP   S +  + S             PE  K  K V   E   PKA+   +  
Sbjct: 32661 -----TSPPRVKSPEPRVKS-------------PEAVKSPKRVKSPEPSHPKAVSPTETK 32702

Query: 4141  QSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPV--VTWFQNGVL 4198
              +P  +   L    + PPK+ Q +   A     +   L C++         VTW+++G  
Sbjct: 32703 PTPTEKVQHLP--VSAPPKITQFLKAEA---SKEIAKLTCVVESSVLRAKEVTWYKDGKK 32757

Query: 4199  LKQNQKFQFE-EVNCSHQLYIKDVNSQDSGKYKCVAENNSG 4238
             LK+N  FQF    + +++L I ++   D G+Y C      G
Sbjct: 32758 LKENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGG 32798



 Score = 82.8 bits (203), Expect = 9e-15
 Identities = 52/182 (28%), Positives = 89/182 (48%), Gaps = 2/182 (1%)

Query: 13   QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
            +SV V E    T E  ++G P  +V W +DG+ I  S      +SF +  A   I +V K
Sbjct: 5148 KSVDVTEKDPMTLECVVAGTPELKVKWLKDGKQIVPSRY--FSMSFENNVASFRIQSVMK 5205

Query: 73   ANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPT 132
             +SG+Y+ K  N  G ++  A L V  +  PP+F ++L  M    GS + ++ +V+G   
Sbjct: 5206 QDSGQYTFKVENDFGSSSCDAYLRVLDQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLP 5265

Query: 133  PVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELL 192
               ++++DG EI +S  +++       SL +     ED+  Y+   +N  G    +  L 
Sbjct: 5266 ISAQWFKDGKEISTSAKYRLVCHERSVSLEVNNLELEDTANYTCKVSNVAGDDACSGILT 5325

Query: 193  VQ 194
            V+
Sbjct: 5326 VK 5327



 Score = 82.8 bits (203), Expect = 9e-15
 Identities = 59/230 (25%), Positives = 109/230 (47%), Gaps = 5/230 (2%)

Query: 6    PTFTQPL-QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64
            P+FT+ L ++V   EG++   E  ++G     V+W+++   I  ++    +I+F +    
Sbjct: 8249 PSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTS--NCEITFKNNTLV 8306

Query: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQ 124
            L +      ++G Y+ K +N +G A  T+ +++K    PP F Q L  +TV +G  V+L 
Sbjct: 8307 LQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQLS 8366

Query: 125  VRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184
              V G     +++ + G EI+ S     S       L + +    DSG Y   A+N  G 
Sbjct: 8367 CHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVAGS 8426

Query: 185  ATSTAELLVQGEEEVPAKKTKTIVSTAQ--ISESRQTRIEKKIEAHFDAR 232
             T+ +++ ++ +  V     K  V      +SE +  R+ +K  A F A+
Sbjct: 8427 DTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSIRVVEKTTATFIAK 8476



 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 56/189 (29%), Positives = 96/189 (50%), Gaps = 5/189 (2%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            PTF    +S+    G  A F   ++G PV E  W +DG  +S S  P  +IS ++ +  L
Sbjct: 3551 PTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPS--PNWRISDAENKHIL 3608

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             +  +T  + G YS KA+N  G     AEL++  +   P+F++ L+ +      +V L+ 
Sbjct: 3609 ELSNLTIQDRGVYSCKASNKFGADICQAELIIIDK---PHFIKELEPVQSAINKKVHLEC 3665

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
            +V       V + +DG ++    D++I  E  + +L I  A  +DSGTY   A+N  G +
Sbjct: 3666 QVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTASNEAGSS 3725

Query: 186  TSTAELLVQ 194
            + +A + V+
Sbjct: 3726 SCSATVTVR 3734



 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 79/322 (24%), Positives = 126/322 (39%), Gaps = 38/322 (11%)

Query: 3332  EVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRV-SGTDLKVSWYSKDKKIKPSRFF 3390
             EV+S       + P I   ++      GQ  RF   V S    +V WY    +++ S   
Sbjct: 32361 EVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKI 32420

Query: 3391  RMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL---------------EA 3435
               T       LEI + + +D GTY  V +N  G+ S  A L +               E 
Sbjct: 32421 HYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEV 32480

Query: 3436  PESILHERIEQEI----------EMEMKELFSEGESEHSE-RDTRDAFSDSEDIDHKSMA 3484
             P S+  E    E           EME      E +S+ +E R++  ++  S   + KS A
Sbjct: 32481 PRSVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAA 32540

Query: 3485  AKRYASRISSTSSWPEYFKPSFTQKLTFK----YVLEGEPVVFTCRLIACPTPEMTWFHN 3540
              +  +    ST+      K +   ++  K     V EGE   F+C     P P +TW   
Sbjct: 32541 LEEKSLEEKSTT---RKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRK 32597

Query: 3541  NRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQK 3600
              + + T  R  +        + S+ EI  VQ  D G+Y ++  NSEG  E+  +L + + 
Sbjct: 32598 GQVLSTSARHQVTTTK----YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKA 32653

Query: 3601  GQDEKYLEFLKRAERTHENVEA 3622
                EK +    R +     V++
Sbjct: 32654 RVTEKAVTSPPRVKSPEPRVKS 32675



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 62/224 (27%), Positives = 97/224 (43%), Gaps = 10/224 (4%)

Query: 5    APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64
            AP   + ++ + V  G  A F   I   P     WF+ G+ I  S      I  S   + 
Sbjct: 3455 APVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDK--CSIRSSKYISS 3512

Query: 65   LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQ 124
            L I      + G Y+ KA+N  G  + TA L V  E  PP F+ R +S+T   G   +  
Sbjct: 3513 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTV-TEAYPPTFLSRPKSLTTFVGKAAKFI 3571

Query: 125  VRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184
              VTG P     + +DGA +  S +++IS   + + L ++    +D G YS  A+N  G 
Sbjct: 3572 CTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGA 3631

Query: 185  ATSTAELLVQGE-------EEVPAKKTKTIVSTAQISESRQTRI 221
                AEL++  +       E V +   K +    Q+ E R+  +
Sbjct: 3632 DICQAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTV 3675



 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 153/687 (22%), Positives = 250/687 (36%), Gaps = 132/687 (19%)

Query: 1432  MSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCL-----EGQTARFDLKVVGRPMP 1486
             +S AR+S G  +       + ++      + PVS + +     EG   ++  K+      
Sbjct: 31538 VSAARISCGGAIRSQKGVSVAKVKVASIEIGPVSGQIMHAVGEEGGHVKYVCKIENYDQS 31597

Query: 1487  -ETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVIL 1545
              +  W+   +Q+ N   +++   EDG   L +   T  D G +     N  G  S    L
Sbjct: 31598 TQVTWYFGVRQLENSEKYEITY-EDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAEL 31656

Query: 1546  TVEAVEH-----------------------QVKPMFVEKLKNVNIKEGSRLEMKVRATGN 1582
              V+ V                         +  P F   L N     G  +   V  T +
Sbjct: 31657 FVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH 31716

Query: 1583  PNPDIVWLKNSDIIVP-HKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTT 1641
             P P + W K+   I P     K   E  KG   L I+S  + D A YT  A NK G D+ 
Sbjct: 31717 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDS- 31775

Query: 1642  RCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQ 1701
              CK  + V    P  +  L                                         
Sbjct: 31776 -CKAKLTVTLHPPPTDSTL----------------------------------------- 31793

Query: 1702  KPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINE-FGYC 1760
             +P FK+ L +   +      FE R++ I  PT+  +W  DG+PL     + +I+E   Y 
Sbjct: 31794 RPMFKRLLANAECQEGQSVCFEIRVSGIPPPTL--KWEKDGQPLSLGPNIEIIHEGLDYY 31851

Query: 1761  SLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEE--SQLPEGRKGLQRIEE 1818
             +L        D+G     ATN  G+    A L V+  +   +E  S+    R   ++I++
Sbjct: 31852 ALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQIDK 31911

Query: 1819  LERMAHEGALTG-----VTTDQKEKQKPDIVLYPEPV--RVLEGETARFRCRVTGYPQPK 1871
               RMA    L+G     +T   KE  +   VLY   V  + ++GE   FR  +       
Sbjct: 31912 TLRMAE--ILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKGE---FRLEI------- 31959

Query: 1872  VNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVK--LEI 1929
                    +  ++ ++ R+ Y      D+ + + Y    ++      + V    +K   +I
Sbjct: 31960 -------EEKKEERKLRMPY------DVPEPRKYKQTTIEEDQRIKQFVPMSDMKWYKKI 32006

Query: 1930  QQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEK 1989
             + + +    L R  + RP+  +      QF V  + R  D    K  +           K
Sbjct: 32007 RDQYEMPGKLDRVVQKRPK-RIRLSRWEQFYVMPLPRITDQYRPKWRI----------PK 32055

Query: 1990  VPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEE 2049
             + ++  E+    +RRT    Y+       +S   D S EELL    D L     + TEEE
Sbjct: 32056 LSQDDLEIVRPARRRTPSPDYDFYYRPRRRS-LGDISDEELLLPIDDYL---AMKRTEEE 32111

Query: 2050  KKALAEEGKI----TIPTFKPDKIELS 2072
             +  L EE ++    + P+  P   ELS
Sbjct: 32112 RLRLEEELELGFSASPPSRSPPHFELS 32138



 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 108/482 (22%), Positives = 179/482 (37%), Gaps = 74/482 (15%)

Query: 5182 PPSFIEPLTKRKVYE-NTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSL 5240
            PP F++ L   K+ +   +     ++ G P   V W+RN+  L   ++ +M  + +V  +
Sbjct: 5422 PPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVI 5481

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTT 5300
            +++N+   + G+++C A N  G       V I+ +     + PP V      E  LE   
Sbjct: 5482 QMNNLSTEDSGDFICEAQNPAGSTSCSTKV-IVKEPPVFSSFPPIVETLKNAEVSLECEL 5540

Query: 5301 SSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMD 5360
            S  TP P E+V      +K      K+ KI +    T  H   I+++D            
Sbjct: 5541 SG-TP-PFEVVW---YKDKRQLRSSKKYKIASKNFHTSIH---ILNVDTSDIGEYHCKAQ 5592

Query: 5361 SREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWY--KEYM 5418
            +  G D    +     + PPRF+  +    +     A  + S+ G     V+W   KE +
Sbjct: 5593 NEVGSDT--CVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEV 5650

Query: 5419 CIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVN--------------------- 5457
              E +NI+    E     TL+      +++  Y C+  N                     
Sbjct: 5651 IRESENIRITFVENVA--TLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVE 5708

Query: 5458 -------CVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEEL----------VLKSNY 5500
                    VGE         G  E+     K  K+  SS   +           +L    
Sbjct: 5709 KAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVER 5768

Query: 5501 TDS-FFEFQVVEG-----------------PPRFIKGISDCYAPIGTAAYFQCLVRGSPR 5542
             D+  + FQV                    PP F + + +    +G +   +C V GS  
Sbjct: 5769 QDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSP 5828

Query: 5543 PTVYWYKD-GKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAAL 5601
             +V W+ +  K+V G ++    S      L + SL  SD G Y CVA N +G  E  A L
Sbjct: 5829 ISVAWFHEKTKIVSGAKYQTTFS-DNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVL 5887

Query: 5602 TL 5603
            T+
Sbjct: 5888 TV 5889



 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 110/488 (22%), Positives = 182/488 (37%), Gaps = 73/488 (14%)

Query: 3058  IEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIP 3117
             IE    +  + V E+K  M   E  +      W+K   E   T  I+  K +  +  LI 
Sbjct: 31476 IEAMDFVDRLLVKERKSRMTASEALQHP----WLKQKIERVSTKVIRTLKHRRYYHTLIK 31531

Query: 3118  STRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQ------------RAV 3165
                        +  GG + + K  V    V++ SI  E+  +  Q            + V
Sbjct: 31532 KDLNMVVSAARISCGGAIRSQK-GVSVAKVKVASI--EIGPVSGQIMHAVGEEGGHVKYV 31588

Query: 3166  VEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA--- 3222
              + E  +      WY  G+    +  E+++   E  +  +++ +  + D G Y       
Sbjct: 31589 CKIENYDQSTQVTWYF-GVR-QLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVND 31646

Query: 3223  -GRNRSSVTLYVNA--------------------------PEPPQVLQELQPVTVQSGKP 3255
              G + S   L+V                              PP+    L   T   G+ 
Sbjct: 31647 YGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGEN 31706

Query: 3256  ARFCAVISGRPQPKISWYKEEQLLSTGFKCK---FLHDGQEYTLLLIEAFPEDAAVYTCE 3312
              RF   I+  P+P ++WYK  Q +  G   K   F  D   Y L +     +D A YT  
Sbjct: 31707 VRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVV 31766

Query: 3313  AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3372
             A+N YG  +  A L+V     + P        P     L +    EGQ   F+ RVSG  
Sbjct: 31767 ARNKYGEDSCKAKLTV----TLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIP 31822

Query: 3373  LKVSWYSKDKK---IKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTA 3429
                  + KD +   + P+    + +  D Y L I +  PED G Y   A+N  G  S  A
Sbjct: 31823 PPTLKWEKDGQPLSLGPNIEI-IHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQA 31881

Query: 3430  NLSLEA--------PESILHER-IEQEIE--MEMKELFSEGESEHSERDTRDAFSDSEDI 3478
             +L +E              HER ++++I+  + M E+ S  ES    +  ++A  ++  +
Sbjct: 31882 HLQVERLRYKKQEFKSKEEHERHVQKQIDKTLRMAEILSGTESVPLTQVAKEALREAAVL 31941

Query: 3479  DHKSMAAK 3486
                +++ K
Sbjct: 31942 YKPAVSTK 31949



 Score = 80.1 bits (196), Expect = 6e-14
 Identities = 98/454 (21%), Positives = 168/454 (37%), Gaps = 72/454 (15%)

Query: 5152 TEERGSA---YEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEG 5208
            TE++ S    +E+       +    I   D  +PPSF + L K    + + +     V G
Sbjct: 4641 TEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAG 4700

Query: 5209 LPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFA 5268
                 ++W+++   +   E+ K     N   LEIS ++  + G Y C A N  G  +   
Sbjct: 4701 SHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSG 4760

Query: 5269 NVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQV 5328
            ++ +           PP   +     D+   T  +  +     L    +   +K F+   
Sbjct: 4761 HLTVK---------EPPYFVEKPQSQDVNPNTRVQLKA-----LVGGTAPMTIKWFKDNK 4806

Query: 5329 KIVTVPEFTPDHKSMIVSLDVLPFNFVDPN----MDSREGEDKELKIDLEVFEMPPRFIM 5384
            ++ +    +        SL++      D        S +      K  L V E PP+FI 
Sbjct: 4807 ELHSGAARSVWKDDTSTSLELFAAKATDSGTYICQLSNDVGTATSKATLFVKE-PPQFIK 4865

Query: 5385 PICDFKIPENSDA-VFKCSVIGIPTPEVKWY---KEYMCIEPDNIKYVISEEKGSHTLKI 5440
                  +  N  +  F+C + G P   V WY    E   I+   I ++     G  T +I
Sbjct: 4866 KPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFI----DGLATFQI 4921

Query: 5441 RNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNY 5500
                + +S TY C A N  G A C                             + LK   
Sbjct: 4922 SGARVENSGTYVCEARNDAGTASC----------------------------SIELK--- 4950

Query: 5501 TDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQ-GRRF 5559
                     V+ PP FI+ +        +    +C V G+P   V W K+ + ++  +++
Sbjct: 4951 ---------VKEPPTFIRELKPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKY 5001

Query: 5560 TVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
            T+ +  + F NL IT    SD GEY+C+ +N+ G
Sbjct: 5002 TLTDRVSVF-NLHITKCDPSDTGEYQCIVSNEGG 5034



 Score = 80.1 bits (196), Expect = 6e-14
 Identities = 215/1084 (19%), Positives = 385/1084 (35%), Gaps = 156/1084 (14%)

Query: 2458  EGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKL 2517
             + T+ +L   V       VKWY N  +++   ++          L I   H  D G Y+ 
Sbjct: 32389 QNTRFILN--VQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRA 32446

Query: 2518  IV----GRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIK 2573
             +     G       L V               E    VF  EL+ +    + +FK     
Sbjct: 32447 VCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVFP-ELTRTEAYAVSSFKKTS-- 32503

Query: 2574  PSSKYKIEAHGKIYKL-TVLNMMKDDEGKYTFYAGENMTSG----------------KLT 2616
                  ++EA   + ++ + +   ++    Y   A   M S                 K T
Sbjct: 32504 -----EMEASSSVREVKSQMTETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKTT 32558

Query: 2617  VAGGAISKPLTDQTVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNIRSESDGHKRR 2675
             +A   ++KP +  TV E + A F C+    P     WLR G+ L  +   +  +  +K  
Sbjct: 32559 LAARILTKPRS-MTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKST 32617

Query: 2676  LIIAATKLDDIGEYTYKVATS--KTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHP 2733
               I++ +  D G Y+  V  S  K  A+  +   K + T K +T          V+   P
Sbjct: 32618 FEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPPR------VKSPEP 32671

Query: 2734  NVKGVQWIKNGVVLESNEKY---AISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARL 2790
              VK  + +K+   ++S E     A+S   T             +     ++  L  SA  
Sbjct: 32672 RVKSPEAVKSPKRVKSPEPSHPKAVSPTET-------------KPTPTEKVQHLPVSAPP 32718

Query: 2791  HVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRL-VSERKVH 2849
              +      +  K++  L   T   E SV      V W+    ++K +   +   S    +
Sbjct: 32719 KITQFLKAEASKEIAKL---TCVVESSVLR-AKEVTWYKDGKKLKENGHFQFHYSADGTY 32774

Query: 2850  KLMLQNISPSDAGEYTAVVG--------QLECKAKLFVETLH-----ITKTMKNIEVPET 2896
             +L + N++ SD GEY   +          L+   + F +++H     I++T K+ +    
Sbjct: 32775 ELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAF-KSIHEKVSKISETKKSDQKTTE 32833

Query: 2897  KTASFECE--------------------------VSHFNVPS--------MWLKNGVEIE 2922
              T + + E                          V+ F V +        +W K+G  I 
Sbjct: 32834 STVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAIT 32893

Query: 2923  MSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV----CGNDQVSATLTVTPIMITSMLKDI 2978
                K+K+        L I  T T DS  YT       G+   S  LT+  I  T   K  
Sbjct: 32894 QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVS 32953

Query: 2979  NAEEKDTITFEVTVNYEGISYKWLKNGV----EIKSTDKCQMRTK--KLTHSLNIRNVHF 3032
               +  +    +  V  E IS K L++      E KS +K  ++ +  K+  S  ++    
Sbjct: 32954 TQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVKK-SA 33012

Query: 3033  GDAADYTFVAGKATSTATLYVEAR-HIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWM 3091
               + + + V  + T T+    E R H E +     + + E +R + +  ++     V+W+
Sbjct: 33013 ATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT-DVKWV 33071

Query: 3092  KDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAK------LFVEGR 3145
              +  EL  ++  +         L I      D G  T ++       K      L  E  
Sbjct: 33072 LNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQYDLTLSKELS 33131

Query: 3146  DV-RIRSIKKEVQVIEKQRAVVEFEVN-EDDVDAHWYKDGIEINFQVQERHKYVVERRIH 3203
             D     S  +   + E Q  +   E++ E   +  W+K+ + I+  +         R ++
Sbjct: 33132 DAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPIS--ISSNVSISRSRNVY 33189

Query: 3204  RMFISETRQSDAGEYTFVAGRNRSS--------VTLYVNAPEPPQVLQELQPVTVQSGKP 3255
              + I     SD+G+YT  A   R          V   V  P    VL+     ++Q    
Sbjct: 33190 SLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFS 33249

Query: 3256  ARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKN 3315
             ++   + + + +   S +      S+  + KF     +    + E+F E ++       N
Sbjct: 33250 SQSVQMSASKQEASFSSFSSSSA-SSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISN 33308

Query: 3316  DYGV-ATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL- 3373
                + ++TS  L   +  +          PP I     D    EG+     C  +G    
Sbjct: 33309 MTQLESSTSKMLKAGIRGI----------PPKIEALPSDISIDEGKVLTVACAFTGEPTP 33358

Query: 3374  KVSWYSKDKKIKPSRF--FRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANL 3431
             +V+W    +KI       F +   +D   L I +   +D G YT    N  G  S+T N+
Sbjct: 33359 EVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNI 33418

Query: 3432  SLEA 3435
              + +
Sbjct: 33419 HIRS 33422



 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 98/431 (22%), Positives = 158/431 (36%), Gaps = 82/431 (19%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKS-LLEPDERIKMERVGNVCSL 5240
            PP F++ L+         +     +EG     V W+++K  ++   + I +    N+ +L
Sbjct: 7491 PPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATL 7550

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTT 5300
            + S ++    G+Y C   N  G  + FA + ++ +   +V  P  +         LE T 
Sbjct: 7551 QFSRVEPANAGKYTCQIKNDAGMQECFATLSVL-EPATIVEKPESIKVTTGDTCTLECTV 7609

Query: 5301 SSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHK---------SMIVSLDVLP 5351
            +  TP         ELS K  K+ +         E T D+K         S +  ++V P
Sbjct: 7610 AG-TP---------ELSTKWFKDGK---------ELTSDNKYKISFFNKVSGLKIINVAP 7650

Query: 5352 -----FNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGI 5406
                 ++F   N   ++     L++      +PP F   + +      S  V +C V G 
Sbjct: 7651 SDSGVYSFEVQNPVGKDSCTASLQVSDRT--VPPSFTRKLKETNGLSGSSVVMECKVYGS 7708

Query: 5407 PTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRG 5466
            P   V W+ E   I     KY  +    +  L +  +  SDS  Y C A N  G   C  
Sbjct: 7709 PPISVSWFHEGNEISSGR-KYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSA 7767

Query: 5467 FLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAP 5526
             LT                                        V  PP F++        
Sbjct: 7768 PLT----------------------------------------VREPPSFVQKPDPMDVL 7787

Query: 5527 IGTAAYFQCLVRGSPRPTVYWYK-DGKLVQGRRFTVE-ESGTGFHNLFITSLVKSDEGEY 5584
             GT   F  +V+G+P  +V W+K   +LV G R  V  E       LF   +  S  GEY
Sbjct: 7788 TGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAELELF--DVDTSQSGEY 7845

Query: 5585 RCVATNKSGMA 5595
             C+ +N++G A
Sbjct: 7846 TCIVSNEAGKA 7856



 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 86/399 (21%), Positives = 158/399 (39%), Gaps = 80/399 (20%)

Query: 3943 PPSFLQEIESQEVYE-GDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSIL 4001
            PP F++++E+ ++ + GDS    C   G P+  V W+ N+  +P +  + +  +++ +++
Sbjct: 5422 PPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVI 5481

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
             ++++  ++ G   C   N  G+   ++ + VK   +  V +   P+     + E  L  
Sbjct: 5482 QMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVK---EPPVFSSFPPIVETLKNAEVSLEC 5538

Query: 4062 VFD----------------QAKGAHPSMSQEGQTNLHLLKTNPP---------------- 4089
                               ++   +   S+   T++H+L  +                  
Sbjct: 5539 ELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQNEVGSD 5598

Query: 4090 ---------VPPSGDTELLSF------PVEIQ--VTAATPIPEQD-KESKEVFQTEELEP 4131
                      PP   ++L S       P E+Q  +  A PI  Q  KE +EV +  E   
Sbjct: 5599 TCVCTVKLKEPPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIR 5658

Query: 4132 KAMPQDQVT-----QSPKHRFVFLSDITNE-------------PPKMLQEMPKHARCREG 4173
                ++  T       P +   ++  I N+              P ++ E         G
Sbjct: 5659 ITFVENVATLQFAKAEPANAGKYICQIKNDGGMRENMATLMVLEPAVIVEKAGPMTVTVG 5718

Query: 4174 DSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVA 4233
            ++  LEC ++G P+  V W+++G LL  +QK +F   N    L I  V  QD+G Y    
Sbjct: 5719 ETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLRILSVERQDAGTYTFQV 5778

Query: 4234 ENNSG-----AVESVSDLTVEPVTYRENSQFENIGEIYG 4267
            +NN G     AV  VSD  V P   R   + +N G + G
Sbjct: 5779 QNNVGKSSCTAVVDVSDRAVPPSFTR---RLKNTGGVLG 5814



 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 62/183 (33%), Positives = 82/183 (44%), Gaps = 9/183 (4%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPG--VQISFSDG 61
            + P+F Q   SV VL G + TF + I G P  +V WF+     S   +PG    IS  D 
Sbjct: 6832 EPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKG----SRELVPGESCNISLEDF 6887

Query: 62   RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQV 121
              +L +  V    SG YS   TN +G A+ T  L VK    P  FV+RL   +V  GS +
Sbjct: 6888 VTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKE---PATFVKRLADFSVETGSPI 6944

Query: 122  RLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181
             L+   TG P   V + +D   I  S    I+       L I E+  ED   YS    N 
Sbjct: 6945 VLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILEILESTIEDYAQYSCLIENE 7004

Query: 182  VGR 184
             G+
Sbjct: 7005 AGQ 7007



 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 63/232 (27%), Positives = 93/232 (40%), Gaps = 34/232 (14%)

Query: 5373  LEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEP--DNIKYVIS 5430
             + + E PP F +P+ +       +  F  ++   P P V WYK    I+P  ++ KY   
Sbjct: 31683 MRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFE 31742

Query: 5431  EEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSL 5490
              +KG + L I +V   D A Y   A N  GE  C+  LT               VTL   
Sbjct: 31743 SDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLT---------------VTLHPP 31787

Query: 5491  MEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKD 5550
               +  L+                P F + +++     G +  F+  V G P PT+ W KD
Sbjct: 31788 PTDSTLR----------------PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKD 31831

Query: 5551  GK-LVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAAL 5601
             G+ L  G    +   G  ++ L I   +  D G YR  ATN +G     A L
Sbjct: 31832 GQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHL 31883



 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 72/310 (23%), Positives = 124/310 (40%), Gaps = 29/310 (9%)

Query: 3943 PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILT 4002
            PP F++++E  +V  GDS +  C   G P+  V+WY  D  +     + +H   N + L 
Sbjct: 7960 PPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLV 8019

Query: 4003 LSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEE---L 4059
             + V   + G   C   N  G V  ++ L V+ ++         P F   L + +E   L
Sbjct: 8020 FNQVDINDSGEYICKAENSVGEVSASTFLTVQEQK-------LPPSFSRQLRDVQETVGL 8072

Query: 4060 ALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKE 4119
             +VFD A      +S     +   LK +P V  S           +  TA   I + D+ 
Sbjct: 8073 PVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTS----------FLDNTATLNIFKTDRS 8122

Query: 4120 SKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILE 4179
                +      P       +  +     + L++  N P   ++  P  A    G+S   E
Sbjct: 8123 LAGQYSCTATNP-------IGSASSSARLILTEGKNPPFFDIRLAPVDAVV--GESADFE 8173

Query: 4180 CLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGA 4239
            C ++G     V+W ++   ++   K+Q   +  S  L +  V+  DSG+Y C A N  G 
Sbjct: 8174 CHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGK 8233

Query: 4240 VESVSDLTVE 4249
                + L ++
Sbjct: 8234 DSCTAQLNIK 8243



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 94/431 (21%), Positives = 151/431 (35%), Gaps = 63/431 (14%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PP F+  L   +     ++    +V G P   V WY+  + L P    +     NV +L 
Sbjct: 6078 PPYFVTELEPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLV 6137

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
             + +   + GEY C A N IG A S     I  ++     LPP    Q     D+E T  
Sbjct: 6138 FNKVNINDSGEYTCKAENSIGTASSKTVFRIQERQ-----LPPSFARQLK---DIEQTVG 6189

Query: 5302 SRTPSPQEIVLEVELSEK-DVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMD 5360
                 P  +   +  S    V  +   V +             + +L +L  +       
Sbjct: 6190 L----PVTLTCRLNGSAPIQVCWYRDGVLLRDDENLQTSFVDNVATLKILQTDLSHSGQY 6245

Query: 5361 SREGED------KELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWY 5414
            S    +         ++     +  P F +      +     A F+C V G     + W 
Sbjct: 6246 SCSASNPLGTASSSARLTAREPKKSPFFDIKPVSIDVIAGESADFECHVTGAQPMRITWS 6305

Query: 5415 KEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSE 5474
            K+   I P    Y I+    +  L+I  V   DS  Y C+A N VG+ +C   L+     
Sbjct: 6306 KDNKEIRPGG-NYTITCVGNTPHLRILKVGKGDSGQYTCQATNDVGKDMCSAQLS----- 6359

Query: 5475 IFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGI-SDCYAPIGTAAYF 5533
                                               V+ PP+F+K + +   A  G +   
Sbjct: 6360 -----------------------------------VKEPPKFVKKLEASKVAKQGESIQL 6384

Query: 5534 QCLVRGSPRPTVYWYK-DGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKS 5592
            +C + GSP   V W++ D +L +  ++ +    +    L I      D G+Y C A N  
Sbjct: 6385 ECKISGSPEIKVSWFRNDSELHESWKYNMSFINS-VALLTINEASAEDSGDYICEAHNGV 6443

Query: 5593 GMAESFAALTL 5603
            G A    ALT+
Sbjct: 6444 GDASCSTALTV 6454



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 89/473 (18%), Positives = 166/473 (35%), Gaps = 92/473 (19%)

Query: 5151 PTEERGSAYEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLP 5210
            P++    ++E+       +   +++  D  +PPSF   L +      +++    +V G P
Sbjct: 7650 PSDSGVYSFEVQNPVGKDSCTASLQVSDRTVPPSFTRKLKETNGLSGSSVVMECKVYGSP 7709

Query: 5211 VPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANV 5270
               V W+   + +    + +     N C+L ++ +++ + G+Y C A N+ G  +  A +
Sbjct: 7710 PISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGSDECSAPL 7769

Query: 5271 DIMPQEERVVALPPP--------VTHQHVME----FDLEHTTSSRTPSP--------QEI 5310
             +  +    V  P P        VT   +++    F +     S    P        ++ 
Sbjct: 7770 TVR-EPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDS 7828

Query: 5311 VLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELK 5370
            V E+EL + D  +  +   IV                             S E       
Sbjct: 7829 VAELELFDVDTSQSGEYTCIV-----------------------------SNEAGKASCT 7859

Query: 5371 IDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVIS 5430
              L + + P +F+  + D+ I +    + + +  G P   V W K  + + P     + +
Sbjct: 7860 THLYI-KAPAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITT 7918

Query: 5431 EEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSL 5490
             EK S  L+I +  + D+  Y C   N  G+  C                          
Sbjct: 7919 TEK-SAILEIPSSTVEDAGQYNCYIENASGKDSCSA------------------------ 7953

Query: 5491 MEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKD 5550
             + L+L+               PP F+K +      +G +A  QC + G+P   V WYK 
Sbjct: 7954 -QILILE---------------PPYFVKQLEPVKVSVGDSASLQCQLAGTPEIGVSWYKG 7997

Query: 5551 GKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
               ++               L    +  +D GEY C A N  G   +   LT+
Sbjct: 7998 DTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSASTFLTV 8050



 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 293/1478 (19%), Positives = 545/1478 (36%), Gaps = 221/1478 (14%)

Query: 2271  KELQDIEVPESYSGELEC-IVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVT 2329
             KE++D+      + +L C IV     + KWY    EL  + KY ++S      LTV    
Sbjct: 30537 KEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEE 30596

Query: 2330  KEDQGEYSFVIDGK----KTTCKLKMKPRPIAILQGLSDQKV--CEGDIVQLEVKVSLES 2383
             +ED+G Y+ +   +    +T+ KL ++  P         +K     G  ++L V      
Sbjct: 30597 QEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRP 30656

Query: 2384  VEGVWMKDGQEV-QPSDRVHIV-IDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVS 2441
             V  +    GQ++ Q S+ + I   +  +H+++     K  AG Y   +  +  +    + 
Sbjct: 30657 VPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILD 30716

Query: 2442  VYSVDVITPLKDVNVIEG---TKAVLECKVSVPDVTSVKWYLNDEQIKPDDR-------V 2491
             V   D         VIE      AV+  K    D  S  W  N    K + +       V
Sbjct: 30717 VEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGS--WITNYVVEKCEAKEGAEWQLV 30774

Query: 2492  QAIVKGTKQRLVINRTHASDEGPYKLIVGRVET---NCNLSVEKIKIIR---------GL 2539
              + +  T  R+V    + ++   Y   V    T   +  L V  + II+         G 
Sbjct: 30775 SSAISVTTCRIV----NLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGK 30830

Query: 2540  RDLTCTETQN--VVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKD 2597
               +T     +  V ++   S  G  +   + +K  K  +K+ I    +  + TV ++   
Sbjct: 30831 PTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKW-ISVTTEEIRETVFSVKNL 30889

Query: 2598  DEG-KYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVAN----------- 2645
              EG +Y F        G+   +   IS+P+T ++    Q   F+ E+ N           
Sbjct: 30890 IEGLEYEFRVKCENLGGESEWS--EISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATL 30947

Query: 2646  -------PDSKGEWLRDGKHLPLTNNIR---SESDGHKRRLIIAATKLDDIGEYTYKVAT 2695
                    P    +W R GK + + + ++    E  G   +LIIA+   DD   Y  +   
Sbjct: 30948 VCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATN 31006

Query: 2696  SKTS----AKLKVEA---VKIKKTLKNL-TVTETQDAVFTVELTHPNVKG--VQWIKNGV 2745
                S    A L+VE    + + KTL+ +  V   +  V ++++         + W K   
Sbjct: 31007 QGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQD 31066

Query: 2746  VLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVT 2805
             ++++N  Y + V  +  SL   N   V+    GF +        +  +TV++     DV 
Sbjct: 31067 LIDNNGHYQVIVTRSFTSLVFPNG--VERKDAGFYVVCAKNRFGIDQKTVEL-----DVA 31119

Query: 2806  ALENATVAFEVS-VSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEY 2864
              + +     +VS VS D+V + W   + +      + +V +          +  +    Y
Sbjct: 31120 DVPDPPRGVKVSDVSRDSVNLTWTEPASDGGSKITNYIVEKCATTAERWLRVGQARETRY 31179

Query: 2865  TAV--VGQLECKAKLFVET-LHITKTMKNIEVP-----ETKTASFECEVSHFNVPSMW-L 2915
             T +   G+   + ++  E    ++K  +  E       +T+  +++ EV      SM   
Sbjct: 31180 TVINLFGKTSYQFRVIAENKFGLSKPSEPSEPTITKEDKTRAMNYDEEVDETREVSMTKA 31239

Query: 2916  KNGVEIEMSEKFKIVVQ------GKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPI 2969
              +    E+ EK+ I         G +H+ +  ++     A++  V G DQV     ++ +
Sbjct: 31240 SHSSTKELYEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKVKGTDQVLVKKEISIL 31299

Query: 2970  MITSMLKDINAEEKDTITFEVTVNYEGIS----------YKWLKNGVEIKSTDKCQMRTK 3019
              I      ++  E      E+ + +E IS            +  N  EI S         
Sbjct: 31300 NIARHRNILHLHESFESMEELVMIFEFISGLDIFERINTSAFELNEREIVSYVHQVCEAL 31359

Query: 3020  KLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFEC 3079
             +  HS NI   HF    +      + +ST  +      IEF +  + +K  +  R +F  
Sbjct: 31360 QFLHSHNIG--HFDIRPENIIYQTRRSSTIKI------IEFGQ-ARQLKPGDNFRLLFTA 31410

Query: 3080  -EVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTA 3138
              E   P++     + D     TD   +    YV   L+       A     +    ++  
Sbjct: 31411 PEYYAPEVH----QHDVVSTATDMWSLGTLVYV---LLSGINPFLAETNQQIIENIMNAE 31463

Query: 3139  KLFVEG--RDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAH-WYKDGIE------INFQ 3189
               F E   +++ I ++    +++ K+R   +  +   +   H W K  IE      I   
Sbjct: 31464 YTFDEEAFKEISIEAMDFVDRLLVKER---KSRMTASEALQHPWLKQKIERVSTKVIRTL 31520

Query: 3190  VQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVT 3249
                R+ + + ++   M +S  R S  G      G + + V +  +    P   Q +  V 
Sbjct: 31521 KHRRYYHTLIKKDLNMVVSAARISCGGAIRSQKGVSVAKVKV-ASIEIGPVSGQIMHAVG 31579

Query: 3250  VQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVY 3309
              + G     C + +     +++WY   + L    K +  ++     L + +    D   Y
Sbjct: 31580 EEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTY 31639

Query: 3310  TCEAKNDYGVATTSASLSVE-VPEVV--------------SPDQEMPVYPPAIITPLQDT 3354
              C+  NDYG  ++ A L V+ V EV               +    +   PP    PL + 
Sbjct: 31640 RCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNK 31699

Query: 3355  VTSEGQPARFQCRVS-GTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGT 3413
                 G+  RF   ++   +  V+WY   +KIKP                      +++  
Sbjct: 31700 TAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPG---------------------DNDKK 31738

Query: 3414  YTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFS 3473
             YTF +   + Q++                         +  + ++ ++E++    R+ + 
Sbjct: 31739 YTFESDKGLYQLT-------------------------INSVTTDDDAEYTVV-ARNKYG 31772

Query: 3474  DSEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTP 3533
               ED     +    +     ST       +P F + L      EG+ V F  R+   P P
Sbjct: 31773 --EDSCKAKLTVTLHPPPTDST------LRPMFKRLLANAECQEGQSVCFEIRVSGIPPP 31824

Query: 3534  EMTWFHNNRPIPTGLR-RIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAEST 3592
              + W  + +P+  G    II    D +    +L I+     D+G YR+ A N+ GS    
Sbjct: 31825 TLKWEKDGQPLSLGPNIEIIHEGLDYY----ALHIRDTLPEDTGYYRVTATNTAGSTSCQ 31880

Query: 3593  ASLLVIQKGQDEKYLEFLKRAERTHENVEALVERGEDR 3630
             A L V       + L + K+  ++ E  E  V++  D+
Sbjct: 31881 AHLQV-------ERLRYKKQEFKSKEEHERHVQKQIDK 31911



 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 72/311 (23%), Positives = 126/311 (40%), Gaps = 33/311 (10%)

Query: 3941 RCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSI 4000
            R PPSF+Q+ +  +V  G +  F    +G P   V+W+     +       +   ++ + 
Sbjct: 7772 REPPSFVQKPDPMDVLTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGDRCNVSLEDSVAE 7831

Query: 4001 LTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELA 4060
            L L  V     G  TC++ N+ G    T+ L +KA  K       V   +DY  E+ +  
Sbjct: 7832 LELFDVDTSQSGEYTCIVSNEAGKASCTTHLYIKAPAKF------VKRLNDYSIEKGKPL 7885

Query: 4061 LVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKES 4120
            ++     G  P        ++   K    V PS    + +     + +A   IP    E 
Sbjct: 7886 ILEGTFTGTPP-------ISVTWKKNGINVTPSQRCNITT----TEKSAILEIPSSTVED 7934

Query: 4121 KEVFQ--TEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIIL 4178
               +    E    K     Q+             +  EPP  ++++ +  +   GDS  L
Sbjct: 7935 AGQYNCYIENASGKDSCSAQI-------------LILEPPYFVKQL-EPVKVSVGDSASL 7980

Query: 4179 ECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSG 4238
            +C ++G P+  V+W++    L+    ++    N    L    V+  DSG+Y C AEN+ G
Sbjct: 7981 QCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVG 8040

Query: 4239 AVESVSDLTVE 4249
             V + + LTV+
Sbjct: 8041 EVSASTFLTVQ 8051



 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 104/432 (24%), Positives = 162/432 (37%), Gaps = 73/432 (16%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEG-LPVPGVKWYRNKSLLEPDERIKMERVGNVCSL 5240
            PPSFI+ +         T  F   ++G LP+  V W ++   +  D+ I+M    NV SL
Sbjct: 4485 PPSFIKKIESTSSLRGGTAAFQATLKGSLPIT-VTWLKDSDEITEDDNIRMTFENNVASL 4543

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQ----EERV---VALPPPVTHQHVME 5293
             +S I+    G+Y+C A N  G  +  A + +       EE V   V    P T Q V  
Sbjct: 4544 YLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQGDPATLQ-VKF 4602

Query: 5294 FDLEHTTSSRTPSPQEIVL--EVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLP 5351
               +  T+      QE+ L  + ++S  D       +KI++  +      +  V  DV  
Sbjct: 4603 SGTKEITAKWFKDGQELTLGSKYKISVTDTVSI---LKIISTEKKDSGEYTFEVQNDV-- 4657

Query: 5352 FNFVDPNMDSREGEDK-ELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPE 5410
                        G    + +I++    +PP F   +      + S    +C V G     
Sbjct: 4658 ------------GRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDLECIVAGSHPIS 4705

Query: 5411 VKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTM 5470
            ++W+K+   I     KY  S    +  L+I  +  +DS TY C A N  G   C G LT 
Sbjct: 4706 IQWFKDDQEISASE-KYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHNQCSGHLT- 4763

Query: 5471 GDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTA 5530
                                                   V+ PP F++          T 
Sbjct: 4764 ---------------------------------------VKEPPYFVEKPQSQDVNPNTR 4784

Query: 5531 AYFQCLVRGSPRPTVYWYKDGK-LVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVAT 5589
               + LV G+   T+ W+KD K L  G   +V +  T   +L + +   +D G Y C  +
Sbjct: 4785 VQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKDDTST-SLELFAAKATDSGTYICQLS 4843

Query: 5590 NKSGMAESFAAL 5601
            N  G A S A L
Sbjct: 4844 NDVGTATSKATL 4855



 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 58/192 (30%), Positives = 87/192 (45%), Gaps = 6/192 (3%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P F +  QS  V   +    +A + G     + WF+D + + +     V     D   
Sbjct: 4766 EPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTIKWFKDNKELHSGAARSVWKD--DTST 4823

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTV-RQGSQVR 122
             L + A    +SG Y  + +N  G ATS A L VK    PP F+++   + V R G    
Sbjct: 4824 SLELFAAKATDSGTYICQLSNDVGTATSKATLFVKE---PPQFIKKPSPVLVLRNGQSTT 4880

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
             + ++TG P   V +Y DG EI +     IS    L +  I+ A  E+SGTY   A N  
Sbjct: 4881 FECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATFQISGARVENSGTYVCEARNDA 4940

Query: 183  GRATSTAELLVQ 194
            G A+ + EL V+
Sbjct: 4941 GTASCSIELKVK 4952



 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 49/194 (25%), Positives = 92/194 (47%), Gaps = 2/194 (1%)

Query: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD 60
            M  +     +    + V  G T T E  ++G P   V W++DG+++++S     + SF +
Sbjct: 5699 MVLEPAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKH--KFSFYN 5756

Query: 61   GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120
              + L I +V + ++G Y+ +  N  G+++ TA + V     PP+F +RL++     G+ 
Sbjct: 5757 KISSLRILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGAS 5816

Query: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
              L+ +V G     V ++ +  +I S   +Q +   ++ +L +      D G Y+  A N
Sbjct: 5817 CILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAAN 5876

Query: 181  SVGRATSTAELLVQ 194
              G     A L VQ
Sbjct: 5877 VAGSDECRAVLTVQ 5890



 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 104/491 (21%), Positives = 189/491 (38%), Gaps = 103/491 (20%)

Query: 3839 LEEIMANTTIGESSTYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASE 3898
            L+ +  +  +GES T+  +V     +  T    ++ I P  +     +  VE +  +   
Sbjct: 7216 LKPVSVDLALGESGTFKCHVTGTAPIKITWAKDNREIRPGGNYK---MTLVENTATLTVL 7272

Query: 3899 RIKKDDLRELQLSASTRIDEFKTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEG 3958
            ++ K D  +    AS             N+   ++   +   + PP F++++E   + + 
Sbjct: 7273 KVGKGDAGQYTCYAS-------------NIAGKDSCSAQLGVQEPPRFIKKLEPSRIVKQ 7319

Query: 3959 DS-CNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCV 4017
            D    + C   G P+  V WY ++  I  +  F +  +++ ++L + ++  ++ G  TC 
Sbjct: 7320 DEFTRYECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCE 7379

Query: 4018 LFNQYGTVKTTSMLKVK-----AKQKHDVKAHK------------VPVFH-DYLDEEEEL 4059
              N  G+  +++ LKVK      K+ H ++  K             P FH  +  ++ EL
Sbjct: 7380 AHNAAGSASSSTSLKVKEPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKREL 7439

Query: 4060 ALVFDQAKGAHPSMSQEGQTNLHLLKTNP-------------------------PVPP-- 4092
                 ++   +  MS+   T++H+L  +                            PP  
Sbjct: 7440 -----RSGKKYKIMSENFLTSIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKAPPRF 7494

Query: 4093 ----SGDTELLSFPVEIQVT--AATPIP------------EQD------KESKEVFQTEE 4128
                S  + ++   V++Q T   A PI             E D       E+    Q   
Sbjct: 7495 VKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSR 7554

Query: 4129 LEP----KAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECLISG 4184
            +EP    K   Q +     +  F  LS +    P  + E P+  +   GD+  LEC ++G
Sbjct: 7555 VEPANAGKYTCQIKNDAGMQECFATLSVL---EPATIVEKPESIKVTTGDTCTLECTVAG 7611

Query: 4185 EPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSG-----A 4239
             P+    WF++G  L  + K++    N    L I +V   DSG Y    +N  G     A
Sbjct: 7612 TPELSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVAPSDSGVYSFEVQNPVGKDSCTA 7671

Query: 4240 VESVSDLTVEP 4250
               VSD TV P
Sbjct: 7672 SLQVSDRTVPP 7682



 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 57/200 (28%), Positives = 95/200 (47%), Gaps = 3/200 (1%)

Query: 4     QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
             QAP F + L+++ V   S AT    ++G P P V W+R G+ I    L      F  G  
Sbjct: 30926 QAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYH 30985

Query: 64    KLTIPAVTKANSGRYSLKATNGSGQATSTA--ELLVKAETAPPNFVQRLQSMTVRQGSQV 121
             +L I +VT  ++  Y ++ATN  G  + TA  E+ V A+   P  ++ + ++   +G  V
Sbjct: 30986 QLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVV 31045

Query: 122   RLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYP-EDSGTYSVNATN 180
              +++  +G P PV+ + +    I ++  +Q+       SL+       +D+G Y V A N
Sbjct: 31046 SIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKN 31105

Query: 181   SVGRATSTAELLVQGEEEVP 200
               G    T EL V    + P
Sbjct: 31106 RFGIDQKTVELDVADVPDPP 31125



 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 54/191 (28%), Positives = 92/191 (48%), Gaps = 5/191 (2%)

Query: 15   VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
            + V  G  AT E  ++G P  +  W++DG+ +  S     +ISF +  A+L   +    +
Sbjct: 4026 IQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKK--YRISFKNNVAQLKFYSAELHD 4083

Query: 75   SGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPV 134
            SG+Y+ + +N  G ++      V      P F + L+++        RL  ++ G     
Sbjct: 4084 SGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMR 4143

Query: 135  VKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194
            V +++DG EI +S  ++I+      SL I      D+G ++  ATNSVG   S+  L+VQ
Sbjct: 4144 VSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQ 4203

Query: 195  GEEEVPAKKTK 205
               E P+  TK
Sbjct: 4204 ---EPPSFVTK 4211



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 95/425 (22%), Positives = 158/425 (37%), Gaps = 61/425 (14%)

Query: 5182 PPSFIEPLTKRKVYEN-TTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSL 5240
            PP FI+  +   V  N  +  F  ++ G P   V WY + + +   ++  +  +  + + 
Sbjct: 4860 PPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATF 4919

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTT 5300
            +IS  +    G Y+C A N  G A     + +      +  L  PV      + +LE   
Sbjct: 4920 QISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIREL-KPVEVVKYSDVELECEV 4978

Query: 5301 SSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPN-- 5358
            +   P              +V   +   +I +  ++T   +  + +L +   +  D    
Sbjct: 4979 TGTPPF-------------EVTWLKNNREIRSSKKYTLTDRVSVFNLHITKCDPSDTGEY 5025

Query: 5359 --MDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKE 5416
              + S EG        + + E PP FI  I +      S A F+ +V G P   + W K+
Sbjct: 5026 QCIVSNEGGSCSCSTRVALKE-PPSFIKKIENTTTVLKSSATFQSTVAGSPPISITWLKD 5084

Query: 5417 YMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIF 5476
               ++ D+  Y IS      TL+IR+V    S  Y C+A N  G   C  FL + +    
Sbjct: 5085 DQILDEDDNVY-ISFVDSVATLQIRSVDNGHSGRYTCQAKNESGVERCYAFLLVQEP--- 5140

Query: 5477 AVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCL 5536
            A I +K+K                        V E  P  +                +C+
Sbjct: 5141 AQIVEKAK---------------------SVDVTEKDPMTL----------------ECV 5163

Query: 5537 VRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAE 5596
            V G+P   V W KDGK +   R+          +  I S++K D G+Y     N  G + 
Sbjct: 5164 VAGTPELKVKWLKDGKQIVPSRYFSMSFENNVASFRIQSVMKQDSGQYTFKVENDFGSSS 5223

Query: 5597 SFAAL 5601
              A L
Sbjct: 5224 CDAYL 5228



 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 97/426 (22%), Positives = 159/426 (37%), Gaps = 72/426 (16%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKS-LLEPDERIKMERVGNVCSL 5240
            PP F+  L    V           +EG     V+W + K  ++   E I++  V NV +L
Sbjct: 5609 PPRFVSKLNSLTVVAGEPAELQASIEGAQPIFVQWLKEKEEVIRESENIRITFVENVATL 5668

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTT 5300
            + +  +    G+Y+C   N  G  ++ A + ++ +   +V    P+T        LE   
Sbjct: 5669 QFAKAEPANAGKYICQIKNDGGMRENMATLMVL-EPAVIVEKAGPMTVTVGETCTLECKV 5727

Query: 5301 SSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHK----SMIVSLDVLPFNFVD 5356
            +  TP         ELS     E+ K  K++T  +    HK    + I SL +L     D
Sbjct: 5728 AG-TP---------ELSV----EWYKDGKLLTSSQ---KHKFSFYNKISSLRILSVERQD 5770

Query: 5357 PNMDSREGEDKELK------IDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPE 5410
                + + ++   K      +D+    +PP F   + +      +  + +C V G     
Sbjct: 5771 AGTYTFQVQNNVGKSSCTAVVDVSDRAVPPSFTRRLKNTGGVLGASCILECKVAGSSPIS 5830

Query: 5411 VKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTM 5470
            V W+ E   I     KY  +      TL++ ++  SD   Y C A N  G   CR  LT 
Sbjct: 5831 VAWFHEKTKIV-SGAKYQTTFSDNVCTLQLNSLDSSDMGNYTCVAANVAGSDECRAVLT- 5888

Query: 5471 GDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTA 5530
                                                   V+ PP F+K         G  
Sbjct: 5889 ---------------------------------------VQEPPSFVKEPEPLEVLPGKN 5909

Query: 5531 AYFQCLVRGSPRPTVYWYKDGK-LVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVAT 5589
              F  ++RG+P   V W++  + LV+G R  +    T    L + ++  S  GEY CV +
Sbjct: 5910 VTFTSVIRGTPPFKVNWFRGARELVKGDRCNIYFEDT-VAELELFNIDISQSGEYTCVVS 5968

Query: 5590 NKSGMA 5595
            N +G A
Sbjct: 5969 NNAGQA 5974



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 95/443 (21%), Positives = 155/443 (34%), Gaps = 81/443 (18%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PP  ++ L    V       F   + G P P + WY+ + LL    + K    G   +L 
Sbjct: 3238 PPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLL 3297

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVD------IMPQEERVVALPPPVTHQHVMEFD 5295
            +      +   Y C A N  G A + A++       + P +E  V  P  +T        
Sbjct: 3298 LIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIIT-------P 3350

Query: 5296 LEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKI-----VTVPEFTPDHKSMIVSL--- 5347
            L+ T +S    P      V  ++  V  + K  KI       + +F   ++  I      
Sbjct: 3351 LQDTVTSE-GQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPE 3409

Query: 5348 DVLPFNFVDPNMDSR-----------------EGEDKELKIDLEVFEMPPRFIMPICDFK 5390
            D   + FV  N   +                 E  ++E++++++   +  R I P+   +
Sbjct: 3410 DEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKAAPVIKRKIEPL---E 3466

Query: 5391 IPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSAT 5450
            +     A F C +   P    +W+K    I  ++ K  I   K   +L+I    + D   
Sbjct: 3467 VALGHLAKFTCEIQSAPNVRFQWFKAGREIY-ESDKCSIRSSKYISSLEILRTQVVDCGE 3525

Query: 5451 YRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVV 5510
            Y C+A N  G   C   LT+                              T+++      
Sbjct: 3526 YTCKASNEYGSVSCTATLTV------------------------------TEAY------ 3549

Query: 5511 EGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHN 5570
              PP F+         +G AA F C V G+P     W KDG  +              H 
Sbjct: 3550 --PPTFLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRISDAENKHI 3607

Query: 5571 LFITSLVKSDEGEYRCVATNKSG 5593
            L +++L   D G Y C A+NK G
Sbjct: 3608 LELSNLTIQDRGVYSCKASNKFG 3630



 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 239/1151 (20%), Positives = 401/1151 (34%), Gaps = 189/1151 (16%)

Query: 104   PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI 163
             P    R++S  V  G   R  + V   PT  VK+Y +G E+Q S     +    + +L I
Sbjct: 32374 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEI 32433

Query: 164   AEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEK 223
              + + +DSGTY    TN  G A+  A L V G +            T   S+ R   + +
Sbjct: 32434 LDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGD-----------YTTYASQRRDEEVPR 32482

Query: 224   KI-------EAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQ 276
              +       EA+  +    T EM    +  +     T  R     +S S    S +A+ +
Sbjct: 32483 SVFPELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETR-----ESLSSYEHSASAEMK 32537

Query: 277   LARQQSPSPIRHSPSPVRHVRAPTPSPVRSVSPAARISTSPIRSVRSPLLMRKTQA--ST 334
              A  +  S      S  R ++          + AARI T P    RS  +     A  S 
Sbjct: 32538 SAALEEKS--LEEKSTTRKIK---------TTLAARILTKP----RSMTVYEGESARFSC 32582

Query: 335   VATGPEVPP-PWKQEGYVASSSEAEMRETTLTTST-QIRT-EERWEGRYGVQEQVTISGA 391
                G  VP   W ++G V S+S      TT   ST +I + +   EG Y V  +    G 
Sbjct: 32583 DTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVE-NSEGK 32641

Query: 392   AGAAASVSASASYAAEAVATGAKEVKQDADKSAAVATVVAAVDMARVREPVIS---AVEQ 448
               A  +++   +   E   T    VK    +   V +  A     RV+ P  S   AV  
Sbjct: 32642 QEAEFTLTIQKARVTEKAVTSPPRVKSPEPR---VKSPEAVKSPKRVKSPEPSHPKAVSP 32698

Query: 449   TAQRTTTT------AVHIQPAQEQVRKEAEKTAVTKVVVAAD----KAKEQELKSRTKEV 498
             T  + T T       V   P   Q  K      + K+    +    +AKE       K++
Sbjct: 32699 TETKPTPTEKVQHLPVSAPPKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKL 32758

Query: 499   ITTKQEQMHVTHE--------------------QIRKE--TEKTFVPKVVISAAKAKEQE 536
                   Q H + +                    +I  E  T KT +  +  +     E+ 
Sbjct: 32759 KENGHFQFHYSADGTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKV 32818

Query: 537   TRISEEITKKQKQVTQEA-IRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMH 595
             ++ISE  TKK  Q T E+ + ++TE  A   +      S+K   V G Q +TT   D + 
Sbjct: 32819 SKISE--TKKSDQKTTESTVTRKTEPKAPEPI------SSKPVIVTGLQ-DTTVSSDSVA 32869

Query: 596   LSYEKIMKETRKTVV----PKVIVATPKVK-------------EQDLVSRGREGITTKRE 638
                 K   E R T +     K I    K K             + D    G    T K  
Sbjct: 32870 KFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNS 32929

Query: 639   QVQITQE-----KMRKEAEKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKV 693
                ++       K  K+ E   +ST   +    +++  +       A R E+I+++  K 
Sbjct: 32930 AGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKS 32989

Query: 694   D--VGKKAEAVATVVAAVDQARVREPREPGHLEE-----SYAQQTTLEYGYKERISAAKV 746
                +  K EA   +++   +       E   + E     S A +    +   +  S    
Sbjct: 32990 QEKLALKEEASKVLISEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMS 33049

Query: 747   AEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTTDQKGMHISSQIKKTTDLTTERLVHVD 806
                 QR   + ++        V+     T+ +   + G+  S Q      LT ++  H D
Sbjct: 33050 INEGQRLVLKANIAGATDVKWVLNGVELTNSEEY-RYGVSGSDQ-----TLTIKQASHRD 33103

Query: 807   KRPRTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSS--AQKITKSVKAPTV 864
             +   T           + KT+ G    +      TL KELS   +  +Q  ++++     
Sbjct: 33104 EGILTC----------ISKTKEGI---VKCQYDLTLSKELSDAPAFISQPRSQNINEGQN 33150

Query: 865   KPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREA 924
                   +  EP+P  ++        +K+   + +   V +S      R      L  R A
Sbjct: 33151 VLFTCEISGEPSPEIEW--------FKNNLPISISSNVSIS------RSRNVYSLEIRNA 33196

Query: 925   KVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIE 984
              V+++ +     +      +  + L  + ++E  S  +    SG  S   ++  +  Q+ 
Sbjct: 33197 SVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMS 33256

Query: 985   SS---IDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKE 1041
             +S     F  +F S  A  M    FA  S +   S       +S+S ++ +    + E  
Sbjct: 33257 ASKQEASFS-SFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQLESS 33315

Query: 1042  TTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAG-PGEPAAPYFITKPVVQKLVEGGSVV 1100
             T+ +                           +AG  G P  P     P    + EG  + 
Sbjct: 33316 TSKML--------------------------KAGIRGIP--PKIEALPSDISIDEGKVLT 33347

Query: 1101  FGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRN 1160
               C   G P P V W   G  + +  + +           L+I      D G YT+ + N
Sbjct: 33348 VACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGN 33407

Query: 1161  KHGETSASASL 1171
             + G  SA+ ++
Sbjct: 33408 EFGSDSATVNI 33418



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 54/181 (29%), Positives = 82/181 (45%), Gaps = 5/181 (2%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P+F +  + + VL G   TF + I G P  +V+WFR  + +         I F D  A
Sbjct: 5891 EPPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWFRGARELVKGDR--CNIYFEDTVA 5948

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
            +L +  +  + SG Y+   +N +GQA+ T  L VK    P  F++RL   +V  G  + L
Sbjct: 5949 ELELFNIDISQSGEYTCVVSNNAGQASCTTRLFVKE---PAAFLKRLSDHSVEPGKSIIL 6005

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
            +   TG     V + +DG  I +S    I        L I  +   D+G YS    N  G
Sbjct: 6006 ESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAG 6065

Query: 184  R 184
            R
Sbjct: 6066 R 6066



 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 89/358 (24%), Positives = 136/358 (37%), Gaps = 61/358 (17%)

Query: 942   PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIE-SSIDFQITFQS--GIA 998
             PP     L N T   GE+V     I+ +P P VTWY+   +I+    D + TF+S  G+ 
Sbjct: 31689 PPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLY 31748

Query: 999   RLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVE 1058
             +L I     +D   +T  A N+ G  S    L V +                        
Sbjct: 31749 QLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPP--------------------- 31787

Query: 1059  SRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKS 1118
                   TD++L            P F       +  EG SV F  +V G P P + W+K 
Sbjct: 31788 -----PTDSTLR-----------PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKD 31831

Query: 1119  GVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASL----LEE 1174
             G PL+ G   ++  ++      L I  T  +D G Y +   N  G TS  A L    L  
Sbjct: 31832 GQPLSLGPNIEI-IHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRY 31890

Query: 1175  ADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTV 1234
                E   K + E   Q Q+   ++  ++         ++  KE  +E A++ K       
Sbjct: 31891 KKQEFKSKEEHERHVQKQIDKTLRMAEILSGTESVPLTQVAKEALREAAVLYKP------ 31944

Query: 1235  VVRTYVEDQEFHISSFEERLIKEI-------EYRIIKTTLEELLEEDGEEKMAVDISE 1285
              V T     EF +   E++  +++       E R  K T    +EED   K  V +S+
Sbjct: 31945 AVSTKTVKGEFRLEIEEKKEERKLRMPYDVPEPRKYKQT---TIEEDQRIKQFVPMSD 31999



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 82/323 (25%), Positives = 135/323 (41%), Gaps = 27/323 (8%)

Query: 3941 RCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSI 4000
            R PPSF+++IES     G +  F    +G     VTW  +   I  + N  +    N + 
Sbjct: 4483 REPPSFIKKIESTSSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVAS 4542

Query: 4001 LTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELA 4060
            L LS +  +++G   C   N  G  + +++L VK       +A  + V      +   L 
Sbjct: 4543 LYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKEPATITEEAVSIDVTQG---DPATLQ 4599

Query: 4061 LVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKES 4120
            + F   K       ++GQ  L L          G    +S  V   V+    I  + K+S
Sbjct: 4600 VKFSGTKEITAKWFKDGQ-ELTL----------GSKYKIS--VTDTVSILKIISTEKKDS 4646

Query: 4121 KEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILEC 4180
             E   T E++      D    S K R   L  I   PP   +++ K    + G  I LEC
Sbjct: 4647 GEY--TFEVQ-----NDVGRSSCKARINVLDLII--PPSFTKKLKKMDSIK-GSFIDLEC 4696

Query: 4181 LISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAV 4240
            +++G     + WF++   +  ++K++F   + +  L I  +   DSG Y C A N +G  
Sbjct: 4697 IVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEISQLEGTDSGTYTCSATNKAGHN 4756

Query: 4241 ESVSDLTV-EPVTYRENSQFENI 4262
            +    LTV EP  + E  Q +++
Sbjct: 4757 QCSGHLTVKEPPYFVEKPQSQDV 4779



 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 55/208 (26%), Positives = 91/208 (43%), Gaps = 6/208 (2%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P F +    +  L+G+    E  + G P   VSW++D + + +      +I   +   
Sbjct: 7397 EPPIFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKK--YKIMSENFLT 7454

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             + I  V  A+ G Y  KATN  G  T    + +KA   PP FV++L  ++   G +V+L
Sbjct: 7455 SIHILNVDAADIGEYQCKATNDVGSDTCVGSIALKA---PPRFVKKLSDISTVVGKEVQL 7511

Query: 124  QVRVTGI-PTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
            Q  + G  P  VV F   G  ++ S +  IS   ++ +L  +   P ++G Y+    N  
Sbjct: 7512 QTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIATLQFSRVEPANAGKYTCQIKNDA 7571

Query: 183  GRATSTAELLVQGEEEVPAKKTKTIVST 210
            G     A L V     +  K     V+T
Sbjct: 7572 GMQECFATLSVLEPATIVEKPESIKVTT 7599



 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 101/475 (21%), Positives = 171/475 (36%), Gaps = 77/475 (16%)

Query: 5139 REDGTPNEHFYTPTEERGSAYEIWRSDSFGTPNEAI----EPKDNEMPPSFIEPLTKRKV 5194
            +EDGT +      T      + +   +  G  + ++    E  ++++ P F+E L    +
Sbjct: 1508 KEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNI 1567

Query: 5195 YENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDE--RIKMERVGNVCSLEISNIQKGEGGE 5252
             E + L   V   G P P + W +N  ++ P +  +I++E      +L+I +    +   
Sbjct: 1568 KEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAW 1627

Query: 5253 YMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVL 5312
            Y   A+N  G   +   V++                   +EF          P P+  ++
Sbjct: 1628 YTATAINKAGRDTTRCKVNVE------------------VEF--------AEPEPERKLI 1661

Query: 5313 EVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKID 5372
                    +     + K +  PE  P H             +     +  +  DKE    
Sbjct: 1662 --------IPRGTYRAKEIAAPELEPLH-----------LRYGQEQWEEGDLYDKEK--- 1699

Query: 5373 LEVFEMPPRFIMPICDFKIPENSDAVFKCSV--IGIPTPEVKWYKEYMCIEPDNIKYVIS 5430
                +  P F   +   ++     A F+C +  IG PT  V+W  +   +E  N   +I+
Sbjct: 1700 ----QQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMIN 1755

Query: 5431 EEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSK------ 5484
            E  G  +L        DS    CRA N  G       L + D +     ++  +      
Sbjct: 1756 EF-GYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQ 1814

Query: 5485 --VTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPR 5542
                L  +  E  L    TD     Q  +  P  +          G  A F+C V G P+
Sbjct: 1815 RIEELERMAHEGALTGVTTD-----QKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQ 1869

Query: 5543 PTVYWYKDGKLV-QGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAE 5596
            P V WY +G+L+ + +RF V     G H L I      D GE +  A N  G+ E
Sbjct: 1870 PKVNWYLNGQLIRKSKRFRVRYD--GIHYLDIVDCKSYDTGEVKVTAENPEGVIE 1922



 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 86/431 (19%), Positives = 157/431 (36%), Gaps = 69/431 (16%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PPSF+     + V   + +      +G     ++W++    L       + +     SLE
Sbjct: 4205 PPSFVTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLE 4264

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            +  ++  + G Y C   N+ G  +  AN+ +      V  L P    Q + + D      
Sbjct: 4265 LYLVKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPS---QLLKKGDATQLAC 4321

Query: 5302 SRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFV------ 5355
              T +P  I +    +++++KE  K               S + S  VL    V      
Sbjct: 4322 KVTGTPP-IKITWFANDREIKESSKH------------RMSFVESTAVLRLTDVGIEDSG 4368

Query: 5356 DPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYK 5415
            +   +++     +    + + +  P F       ++ +  D +    V G P  E+ W+K
Sbjct: 4369 EYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFK 4428

Query: 5416 EYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEI 5475
            +   +     KY    +    +L+I     +D+  Y+CR  N VG +IC   +T+ +   
Sbjct: 4429 DNTILRSGR-KYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTLRE--- 4484

Query: 5476 FAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQC 5535
                                                 PP FIK I    +  G  A FQ 
Sbjct: 4485 -------------------------------------PPSFIKKIESTSSLRGGTAAFQA 4507

Query: 5536 LVRGSPRPTVYWYKDGKLV---QGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKS 5592
             ++GS   TV W KD   +      R T E +     +L+++ +    +G+Y C A N +
Sbjct: 4508 TLKGSLPITVTWLKDSDEITEDDNIRMTFENN---VASLYLSGIEVKHDGKYVCQAKNDA 4564

Query: 5593 GMAESFAALTL 5603
            G+    A L++
Sbjct: 4565 GIQRCSALLSV 4575



 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 93/431 (21%), Positives = 157/431 (36%), Gaps = 56/431 (12%)

Query: 5202  FIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNII 5261
             FI+ V+  P   VKWY N   L+   +I       V +LEI +    + G Y     N  
Sbjct: 32393 FILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYK 32452

Query: 5262  GEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDV 5321
             GEA  +A +D+   +    A            F     T +   S  +   E+E S   V
Sbjct: 32453 GEASDYATLDVTGGDYTTYASQRRDEEVPRSVFPELTRTEAYAVSSFKKTSEMEAS-SSV 32511

Query: 5322  KEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPR 5381
             +E + Q+        T   +S+               ++ +  E+K     ++   +  R
Sbjct: 32512 REVKSQM--------TETRESLSSYEHSASAEMKSAALEEKSLEEKSTTRKIKT-TLAAR 32562

Query: 5382  FIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIR 5441
              +       + E   A F C   G P P V W ++   +   + ++ ++  K   T +I 
Sbjct: 32563 ILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLS-TSARHQVTTTKYKSTFEIS 32621

Query: 5442  NVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKS--- 5498
             +V  SD   Y     N  G+              F +  +K++VT  ++     +KS   
Sbjct: 32622 SVQASDEGNYSVVVENSEGK----------QEAEFTLTIQKARVTEKAVTSPPRVKSPEP 32671

Query: 5499  --NYTDSFFEFQVVEGP-PRFIKGISDC-----------YAPIGT--------------- 5529
                  ++    + V+ P P   K +S             + P+                 
Sbjct: 32672 RVKSPEAVKSPKRVKSPEPSHPKAVSPTETKPTPTEKVQHLPVSAPPKITQFLKAEASKE 32731

Query: 5530  AAYFQCLVRGS--PRPTVYWYKDG-KLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRC 5586
              A   C+V  S      V WYKDG KL +   F    S  G + L I +L +SD+GEY C
Sbjct: 32732 IAKLTCVVESSVLRAKEVTWYKDGKKLKENGHFQFHYSADGTYELKINNLTESDQGEYVC 32791

Query: 5587  VATNKSGMAES 5597
               + + G +++
Sbjct: 32792 EISGEGGTSKT 32802



 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 65/319 (20%), Positives = 126/319 (39%), Gaps = 26/319 (8%)

Query: 3938 RPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLEN 3997
            + ++ PP F ++++      G    F C   G     V+WY + + +  + N     + N
Sbjct: 7110 KARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWYKDGVLLKDDANLQTSFVHN 7169

Query: 3998 YSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEE 4057
             + L +      + G   C   N  GT  +++ L +          H+VP F D      
Sbjct: 7170 VATLQILQTDQSHIGQYNCSASNPLGTASSSAKLILSE--------HEVPPFFDLKPVSV 7221

Query: 4058 ELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQD 4117
            +LAL        H  ++      +   K N  + P G+ ++    VE   T       + 
Sbjct: 7222 DLALGESGTFKCH--VTGTAPIKITWAKDNREIRPGGNYKMTL--VENTATLTVLKVGKG 7277

Query: 4118 KESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSII 4177
               +       +  K     Q+                EPP+ ++++      ++ +   
Sbjct: 7278 DAGQYTCYASNIAGKDSCSAQLG-------------VQEPPRFIKKLEPSRIVKQDEFTR 7324

Query: 4178 LECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNS 4237
             EC I G P+  V W+++   ++++ KF+   V+    L + +++ +DSG Y C A N +
Sbjct: 7325 YECKIGGSPEIKVLWYKDETEIQESSKFRMSFVDSVAVLEMHNLSVEDSGDYTCEAHNAA 7384

Query: 4238 GAVESVSDLTV-EPVTYRE 4255
            G+  S + L V EP  +R+
Sbjct: 7385 GSASSSTSLKVKEPPIFRK 7403



 Score = 72.8 bits (177), Expect = 9e-12
 Identities = 99/418 (23%), Positives = 151/418 (36%), Gaps = 59/418 (14%)

Query: 5193 KVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGE 5252
            KV E     F  EV   P   V+W ++   L+  +RIK+++   V  L I + +  + G+
Sbjct: 3068 KVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGK 3126

Query: 5253 YMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVL 5312
            Y   A   +  AK F        E R V +        V+E              Q  V+
Sbjct: 3127 YTVVAGGNVSTAKLFV-------EGRDVRIRSIKKEVQVIE-------------KQRAVV 3166

Query: 5313 EVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGE------D 5366
            E E++E DV     +  I    +    HK ++     +   F+     S  GE       
Sbjct: 3167 EFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR--IHRMFISETRQSDAGEYTFVAGR 3224

Query: 5367 KELKIDLEV-FEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNI 5425
                + L V    PP+ +  +    +     A F   + G P P++ WYKE   +     
Sbjct: 3225 NRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLS-TGF 3283

Query: 5426 KYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKV 5485
            K     +   +TL +      D+A Y C A N  G A     L++   E+  V++   ++
Sbjct: 3284 KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV---EVPEVVSPDQEM 3340

Query: 5486 TLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTV 5545
             +                         PP  I  + D     G  A FQC V G+    V
Sbjct: 3341 PVY------------------------PPAIITPLQDTVTSEGQPARFQCRVSGTDL-KV 3375

Query: 5546 YWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
             WY   K ++  RF         + L I      DEG Y  VA+N  G   S A L+L
Sbjct: 3376 SWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3433



 Score = 72.8 bits (177), Expect = 9e-12
 Identities = 58/229 (25%), Positives = 100/229 (43%), Gaps = 9/229 (3%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P+FT+ L  +  + GS+   E  +SG       WF+DG+ ISTS     ++   +    L
Sbjct: 5237 PSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAK--YRLVCHERSVSL 5294

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             +  +   ++  Y+ K +N +G    +  L VK    PP+F+ +         S V  + 
Sbjct: 5295 EVNNLELEDTANYTCKVSNVAGDDACSGILTVKE---PPSFLVKPGRQQAIPDSTVEFKA 5351

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             + G P   +K+++D  E+ S     I  EG    L +       +G Y+ + TN VG  
Sbjct: 5352 ILKGTPPFKIKWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKTGQYTCHVTNDVGSD 5411

Query: 186  TSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSI 234
            + T  LLV      P K  K + ++  +     +R+E KI    + R +
Sbjct: 5412 SCTTMLLV----TEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVV 5456



 Score = 72.8 bits (177), Expect = 9e-12
 Identities = 105/457 (22%), Positives = 177/457 (38%), Gaps = 77/457 (16%)

Query: 5180  EMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCS 5239
             E  P F   L  +   E   +    EV    VP VKW+++   + P  +  ++  G    
Sbjct: 11660 EADPYFTVKLHDKTAVEKDEITLKCEVSK-DVP-VKWFKDGEEIVPSPKYSIKADGLRRI 11717

Query: 5240  LEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHT 5299
             L+I      + GEY+C      G  K+ ANV +   E R++ +  P+    V   +  H 
Sbjct: 11718 LKIKKADLKDKGEYVCDC----GTDKTKANVTV---EARLIKVEKPLYGVEVFVGETAH- 11769

Query: 5300  TSSRTPSPQEIVLEVELSEKDVK-EFEKQVKIVTVP---EFTPDHKSMIVSLDVLPFNFV 5355
                          E+ELSE DV  +++ + + +T     E   D K  I+ L        
Sbjct: 11770 ------------FEIELSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMT 11817

Query: 5356  DPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYK 5415
                  S +  + +   +L+V E+P  FI P+ D K+ E  +A F+C V   P    +W K
Sbjct: 11818 GEV--SFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREP-KTFRWLK 11874

Query: 5416  EYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRA--VNCVGEAICRG----FLT 5469
                 I  D+ ++ + ++   H++ I++    D A Y   A   +  G+ I  G    FLT
Sbjct: 11875 GTQEITGDD-RFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLT 11933

Query: 5470  --------MGDSEIFAV----------------------------IAKKSKVTLSSL--- 5490
                       +S +F V                              K   +T   L   
Sbjct: 11934 PLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSID 11993

Query: 5491  -MEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYK 5549
                ++ +++    S  +  V+EG P F   + D           QC +  +  P V W+K
Sbjct: 11994 DTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP-VKWFK 12052

Query: 5550  DGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRC 5586
             DGK ++  +  V ++      L +   +KSD G+Y C
Sbjct: 12053 DGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC 12089



 Score = 72.8 bits (177), Expect = 9e-12
 Identities = 58/200 (29%), Positives = 89/200 (44%), Gaps = 20/200 (10%)

Query: 5410  EVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLT 5469
             +V WY     +E ++ KY I+ E G   L ++++   D  TYRC+ VN  GE        
Sbjct: 31599 QVTWYFGVRQLE-NSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGE-------- 31649

Query: 5470  MGDSEIFAVIAKKSKVTLSSLMEELVLK-SNYTDSFFEFQVVEGPPRFIKGISDCYAPIG 5528
               DS    +  K  +          + K    TD+    +++E PP F   + +  A +G
Sbjct: 31650 --DSSYAELFVKGVREVYDYYCRRTMKKIKRRTDT---MRLLERPPEFTLPLYNKTAYVG 31704

Query: 5529  TAAYFQCLVRGSPRPTVYWYKDGKLVQ----GRRFTVEESGTGFHNLFITSLVKSDEGEY 5584
                 F   +   P P V WYK G+ ++     +++T  ES  G + L I S+   D+ EY
Sbjct: 31705 ENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTF-ESDKGLYQLTINSVTTDDDAEY 31763

Query: 5585  RCVATNKSGMAESFAALTLT 5604
               VA NK G     A LT+T
Sbjct: 31764 TVVARNKYGEDSCKAKLTVT 31783



 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 91/430 (21%), Positives = 153/430 (35%), Gaps = 64/430 (14%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PP F +  +     + + +    E+ G P   V W +++  +   ++ K+       SL 
Sbjct: 6457 PPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLH 6516

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            I N++  + GEY C A N +G      +V        V  L                 TS
Sbjct: 6517 ILNLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSD---------------TS 6561

Query: 5302 SRTPSPQEIVLEVE-LSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMD 5360
            +      E+   VE      V   + + +++   E T    S I ++  L     + +  
Sbjct: 6562 TLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENT--RISFIDNIATLQLGSPEASNS 6619

Query: 5361 SR-------EGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKW 5413
             +       +   +E    L V E P R I       +   +    +C V G P    KW
Sbjct: 6620 GKYICQIKNDAGMRECSAVLTVLE-PARIIEKPEPMTVTTGNPFALECVVTGTPELSAKW 6678

Query: 5414 YKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDS 5473
            +K+   +  D+  ++    K + +LKI    +SD   Y     N VG++ C   + + D 
Sbjct: 6679 FKDGRELSADSKHHITFINKVA-SLKIPCAEMSDKGLYSFEVKNSVGKSNCTVSVHVSDR 6737

Query: 5474 EIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYF 5533
             +                                     PP FI+ + D  A +G +   
Sbjct: 6738 IV-------------------------------------PPSFIRKLKDVNAILGASVVL 6760

Query: 5534 QCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
            +C V GS   +V W++DG  +                L ++ L  SD G Y CVA N +G
Sbjct: 6761 ECRVSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSLLEPSDTGIYTCVAANVAG 6820

Query: 5594 MAESFAALTL 5603
              E  A LT+
Sbjct: 6821 SDECSAVLTV 6830



 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 152/797 (19%), Positives = 307/797 (38%), Gaps = 140/797 (17%)

Query: 3957  EGDSCNFVCHFQGYPQPI-VTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSIT 4015
             EG    +VC  + Y Q   VTWY     +  ++ + I   +  +IL +  +   ++G+  
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 31640

Query: 4016  CVLFNQYGTVKTTSMLKVKA-KQKHDVKAHK----------------------VPVFHD- 4051
             C + N YG   + + L VK  ++ +D    +                      +P+++  
Sbjct: 31641 CKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKT 31700

Query: 4052  -YLDEEEELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVE---IQV 4107
              Y+ E     +        H +  + GQ           + P  + +  +F  +    Q+
Sbjct: 31701 AYVGENVRFGVTITVHPEPHVTWYKSGQK----------IKPGDNDKKYTFESDKGLYQL 31750

Query: 4108  TAATPIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKH 4167
             T  +   + D E   V + +  E     +  VT  P       +D T  P  M + +  +
Sbjct: 31751 TINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPP-----TDSTLRP--MFKRLLAN 31803

Query: 4168  ARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQ-FEEVNCSHQLYIKDVNSQDS 4226
             A C+EG S+  E  +SG P P + W ++G  L      +   E    + L+I+D   +D+
Sbjct: 31804 AECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDT 31863

Query: 4227  GKYKCVAENNSGAVESVSDLTVEPVTYRENSQFENIGEIYGKYSRDQQLQDQGESVRAHF 4286
             G Y+  A N +G+    + L VE + Y++        E   K   ++ +Q Q +      
Sbjct: 31864 GYYRVTATNTAGSTSCQAHLQVERLRYKKQ-------EFKSKEEHERHVQKQIDKTLRMA 31916

Query: 4287  YDYPAGPFTPWTNVKEYSVRDY------FQSLETIE-----QIDQKEQVRCIPSREKIPR 4335
                      P T V + ++R+         S +T++     +I++K++ R +     +P 
Sbjct: 31917 EILSGTESVPLTQVAKEALREAAVLYKPAVSTKTVKGEFRLEIEEKKEERKLRMPYDVPE 31976

Query: 4336  FVHGASRTIKISKPIRAEFIQCQAEGKERHVSEKSKLHQAEGTVYPFVDDFSDVTIKKEI 4395
                                     + K+  + E  ++ Q       FV   SD+   K+I
Sbjct: 31977 ----------------------PRKYKQTTIEEDQRIKQ-------FV-PMSDMKWYKKI 32006

Query: 4396  RNNF---GKLGRSEKENVQECAQS--DYLPNIHSERISDSYNTKDSSAIVYEESLGEEIH 4450
             R+ +   GKL R  ++  +    S  +    +   RI+D Y  K     + ++ L  EI 
Sbjct: 32007 RDQYEMPGKLDRVVQKRPKRIRLSRWEQFYVMPLPRITDQYRPKWRIPKLSQDDL--EIV 32064

Query: 4451  YPGKKVKHRIIEFEKLHVEKGVLEKRPTRTSIVNPPQKKI---DDKAFSLKQRESRSSNL 4507
              P ++ +    +++  +        RP R S+ +   +++    D   ++K+ E     L
Sbjct: 32065 RPARR-RTPSPDYDFYY--------RPRRRSLGDISDEELLLPIDDYLAMKRTEEERLRL 32115

Query: 4508  NANMYQAEKMSPNTESDSSNIAINLKLLSSQTHKEFDAQEREQQEKISLIDKPAISKRAE 4567
                +      SP + S       +L+  S Q H +   +E  +  + S    P    +AE
Sbjct: 32116 EEELELGFSASPPSRSPPHFELSSLRYSSPQAHVK--VEETRKDFRYSTYHIPT---KAE 32170

Query: 4568  HESPITFDLKQFHTQIKHTDVKFQELDSGQPEEAYFKIQHPADTENIVFDLKQMYSHIGD 4627
               +    +L++ H Q  +   K ++    + E+   ++  P  T   + + K        
Sbjct: 32171 ASTSYA-ELRERHAQAAYRQPKQRQRIMAEREDE--ELLRPVTTTQHLSEYKS------- 32220

Query: 4628  PALEFQGQETREQQEIHYKEKIPSPETLQPDTHNISKSVQNNVFASQEISSSQELSNRTM 4687
               L+F  +E + +++   + ++     ++ + + ISK  Q      +E SSS   ++R +
Sbjct: 32221 -ELDFMSKEEKSRKKSRRQREVTEITEIE-EEYEISKHAQ------RESSSS---ASRLL 32269

Query: 4688  VEKSSIDENSISLEKEV 4704
               + S+    I L + V
Sbjct: 32270 RRRRSLSPTYIELMRPV 32286



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 49/192 (25%), Positives = 93/192 (48%), Gaps = 6/192 (3%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            + P+F         +  ST  F+A + G P  ++ WF+D   +   + P   I      +
Sbjct: 5328 EPPSFLVKPGRQQAIPDSTVEFKAILKGTPPFKIKWFKDD--VELVSGPKCFIGLEGSTS 5385

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQ-SMTVRQGSQVR 122
             L + +V  + +G+Y+   TN  G  + T  LLV   T PP FV++L+ S  V+ G   R
Sbjct: 5386 FLNLYSVDASKTGQYTCHVTNDVGSDSCTTMLLV---TEPPKFVKKLEASKIVKAGDSSR 5442

Query: 123  LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
            L+ ++ G P   V ++R+  E+ +S  ++++    +  + +     EDSG +   A N  
Sbjct: 5443 LECKIAGSPEIRVVWFRNEHELPASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPA 5502

Query: 183  GRATSTAELLVQ 194
            G  + + +++V+
Sbjct: 5503 GSTSCSTKVIVK 5514



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 60/201 (29%), Positives = 85/201 (42%), Gaps = 15/201 (7%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P F Q L  V V EG       H+ G     + W + G+ I  S       SF+ G A L
Sbjct: 8346 PVFDQHLTPVTVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDR--CSFSFASGTAVL 8403

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAE--TAPPN----------FVQRLQSM 113
             +  V KA+SG Y  KA+N +G  T+ +++ +K +   AP            FV   QS+
Sbjct: 8404 ELRDVAKADSGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSEPQSI 8463

Query: 114  TVRQGSQVRLQVRVTGIPTPVVKFYRDG-AEIQSSLDFQISQEGDLYSLLIAEAYPEDSG 172
             V + +      +V G P P VK+ +    ++       I Q+GD   L I +    DSG
Sbjct: 8464 RVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSG 8523

Query: 173  TYSVNATNSVGRATSTAELLV 193
             Y   A N  G   S   L V
Sbjct: 8524 LYRCVAFNEHGEIESNVNLQV 8544



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 49/186 (26%), Positives = 91/186 (48%), Gaps = 5/186 (2%)

Query: 19    EGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRY 78
             EG     +A+I+G    +V W  +G  ++ S      +S SD    LTI   +  + G  
Sbjct: 33052 EGQRLVLKANIAG--ATDVKWVLNGVELTNSEEYRYGVSGSD--QTLTIKQASHRDEGIL 33107

Query: 79    SLKATNGSGQATSTAELLVKAETAP-PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKF 137
             +  +    G      +L +  E +  P F+ + +S  + +G  V     ++G P+P +++
Sbjct: 33108 TCISKTKEGIVKCQYDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEW 33167

Query: 138   YRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEE 197
             +++   I  S +  IS+  ++YSL I  A   DSG Y++ A N  G+ ++TA L+V    
Sbjct: 33168 FKNNLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLV 33227

Query: 198   EVPAKK 203
             E P+++
Sbjct: 33228 EEPSRE 33233



 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 61/219 (27%), Positives = 98/219 (44%), Gaps = 9/219 (4%)

Query: 3     TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
             + AP F    +S  + EG    F   ISG P PE+ WF++   IS S+   V IS S   
Sbjct: 33131 SDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISS--NVSISRSRNV 33188

Query: 63    AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPN--FVQRLQSMTVRQG-- 118
               L I   + ++SG+Y++KA N  GQ ++TA L+V      P+   V R    T  QG  
Sbjct: 33189 YSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSF 33248

Query: 119   SQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNA 178
             S   +Q+  +        F    A   + + F       + S+   E++ E S +  +  
Sbjct: 33249 SSQSVQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSM--QESFVEMSSSSFMGI 33306

Query: 179   TNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESR 217
             +N     +ST+++L  G   +P  K + + S   I E +
Sbjct: 33307 SNMTQLESSTSKMLKAGIRGIP-PKIEALPSDISIDEGK 33344



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 92/428 (21%), Positives = 156/428 (36%), Gaps = 65/428 (15%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            PP+F++ +         T+     V G     V W + + ++  D +IKM     V  L 
Sbjct: 3923 PPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLI 3982

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            I ++Q   GG+Y C A N  G   S   + I+ +  +++     +         LE+T +
Sbjct: 3983 IPDVQISFGGKYTCLAENEAGSQTSVGEL-IVKEPAKIIERAELIQVTAGDPATLEYTVA 4041

Query: 5302 SRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDS 5361
              TP         EL  K  K+      +V   ++    K+ +  L        D    +
Sbjct: 4042 G-TP---------ELKPKWYKDGRP---LVASKKYRISFKNNVAQLKFYSAELHDSGQYT 4088

Query: 5362 REGEDKELKIDLEVF------EMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYK 5415
             E  ++      E        ++ P F  P+ +     N      C + G     V W+K
Sbjct: 4089 FEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFK 4148

Query: 5416 EYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEI 5475
            +   I   + +Y I+  +G+ +L+I  V ++D+  + CRA N VG     G L       
Sbjct: 4149 DGKEIAASD-RYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSSGAL------- 4200

Query: 5476 FAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQC 5535
                                             +V+ PP F+          G+A   + 
Sbjct: 4201 ---------------------------------IVQEPPSFVTKPGSKDVLPGSAVCLKS 4227

Query: 5536 LVRGSPRPTVYWYKDGK-LVQGRR-FTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
              +GS   T+ W+K  K LV G   +  +E+      L++     SD G Y C  +N +G
Sbjct: 4228 TFQGSTPLTIRWFKGNKELVSGGSCYITKEALESSLELYLVK--TSDSGTYTCKVSNVAG 4285

Query: 5594 MAESFAAL 5601
              E  A L
Sbjct: 4286 GVECSANL 4293



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 53/226 (23%), Positives = 101/226 (44%), Gaps = 10/226 (4%)

Query: 4    QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
            ++P FT+  + + VL+       A ++G P  E++WF+D  ++ +      +    D   
Sbjct: 4391 ESPYFTKEFKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGR--KYKTFIQDHLV 4448

Query: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             L I     A++G Y  + TN  G +  +A + ++    PP+F+++++S +  +G     
Sbjct: 4449 SLQILKFVAADAGEYQCRVTNEVGSSICSARVTLR---EPPSFIKKIESTSSLRGGTAAF 4505

Query: 124  QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
            Q  + G     V + +D  EI    + +++ E ++ SL ++    +  G Y   A N  G
Sbjct: 4506 QATLKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAG 4565

Query: 184  RATSTAELLVQ-----GEEEVPAKKTKTIVSTAQISESRQTRIEKK 224
                +A L V+      EE V    T+   +T Q+  S    I  K
Sbjct: 4566 IQRCSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAK 4611



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 52/216 (24%), Positives = 101/216 (46%), Gaps = 6/216 (2%)

Query: 1    MTTQAPTFTQPLQ-SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS 59
            + T+ P F + L+ S +V  G ++  E  I+G P   V WFR+   +  S     +++F 
Sbjct: 5418 LVTEPPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRVVWFRNEHELPASDK--YRMTFI 5475

Query: 60   DGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGS 119
            D  A + +  ++  +SG +  +A N +G  + + +++VK    PP F      +   + +
Sbjct: 5476 DSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVKE---PPVFSSFPPIVETLKNA 5532

Query: 120  QVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNAT 179
            +V L+  ++G P   V +Y+D  +++SS  ++I+ +    S+ I      D G Y   A 
Sbjct: 5533 EVSLECELSGTPPFEVVWYKDKRQLRSSKKYKIASKNFHTSIHILNVDTSDIGEYHCKAQ 5592

Query: 180  NSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISE 215
            N VG  T    + ++      +K     V   + +E
Sbjct: 5593 NEVGSDTCVCTVKLKEPPRFVSKLNSLTVVAGEPAE 5628



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 57/217 (26%), Positives = 102/217 (47%), Gaps = 9/217 (4%)

Query: 8    FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTI 67
            F + L    V  G +   E+  +G     V+W +DG  I+TS      I  ++    L I
Sbjct: 5988 FLKRLSDHSVEPGKSIILESTYTGTLPISVTWKKDGFNITTSEK--CNIVTTEKTCILEI 6045

Query: 68   PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRV 127
               TK ++G+YS +  N +G+    A   + +   PP FV  L+ +    G  V LQ +V
Sbjct: 6046 LNSTKRDAGQYSCEIENEAGRDVCGA---LVSTLEPPYFVTELEPLEAAVGDSVSLQCQV 6102

Query: 128  TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATS 187
             G P   V +Y+   +++ + +++     ++ +L+  +    DSG Y+  A NS+G A+S
Sbjct: 6103 AGTPEITVSWYKGDTKLRPTPEYRTYFTNNVATLVFNKVNINDSGEYTCKAENSIGTASS 6162

Query: 188  TAELLVQGEEEVP---AKKTKTIVSTAQISESRQTRI 221
                 +Q E ++P   A++ K I  T  +  +   R+
Sbjct: 6163 KTVFRIQ-ERQLPPSFARQLKDIEQTVGLPVTLTCRL 6198



 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 94/436 (21%), Positives = 160/436 (36%), Gaps = 74/436 (16%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            P  F++ L    + +   L       G P   V W +N   + P +R  +        LE
Sbjct: 7867 PAKFVKRLNDYSIEKGKPLILEGTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILE 7926

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            I +    + G+Y C+  N  G+    A + I+     V  L P       ++  +  + S
Sbjct: 7927 IPSSTVEDAGQYNCYIENASGKDSCSAQILILEPPYFVKQLEP-------VKVSVGDSAS 7979

Query: 5302 SRTPSPQEIVLEVELS---EKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPN 5358
                      L+ +L+   E  V  ++   K+     +    ++ + +L    FN VD N
Sbjct: 7980 ----------LQCQLAGTPEIGVSWYKGDTKLRPTTTYKMHFRNNVATL---VFNQVDIN 8026

Query: 5359 MDSRE----GEDKELKIDLEVF------EMPPRFIMPICDFKIPENSDAVFKCSVIGIPT 5408
             DS E     E+   ++    F      ++PP F   + D +       VF C++ G   
Sbjct: 8027 -DSGEYICKAENSVGEVSASTFLTVQEQKLPPSFSRQLRDVQETVGLPVVFDCAISGSEP 8085

Query: 5409 PEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFL 5468
              V WYK+   ++ D+     S    + TL I     S +  Y C A N +G A      
Sbjct: 8086 ISVSWYKDGKPLK-DSPNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSA------ 8138

Query: 5469 TMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIG 5528
                                S    L+L       FF+ +           ++   A +G
Sbjct: 8139 --------------------SSSARLILTEGKNPPFFDIR-----------LAPVDAVVG 8167

Query: 5529 TAAYFQCLVRGSPRPTVYWYKDGKLVQ-GRRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
             +A F+C V G+    V W KD + ++ G ++ +       H L +  + K D G+Y C 
Sbjct: 8168 ESADFECHVTGTQPIKVSWAKDSREIRSGGKYQISYLENSAH-LTVLKVDKGDSGQYTCY 8226

Query: 5588 ATNKSGMAESFAALTL 5603
            A N+ G     A L +
Sbjct: 8227 AVNEVGKDSCTAQLNI 8242



 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 59/224 (26%), Positives = 85/224 (37%), Gaps = 40/224 (17%)

Query: 5380 PRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYV-ISEEKGSHTL 5438
            P F  P+    + E S A F+  + G P PEV W+++   I    +  V IS   G   L
Sbjct: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65

Query: 5439 KIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKS 5498
             I  V  ++S  Y  +A N  G+A                              EL++K+
Sbjct: 66   TIPAVTKANSGRYSLKATNGSGQATSTA--------------------------ELLVKA 99

Query: 5499 NYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGR- 5557
                          PP F++ +       G+    Q  V G P P V +Y+DG  +Q   
Sbjct: 100  E-----------TAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSL 148

Query: 5558 RFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAAL 5601
             F + + G   ++L I      D G Y   ATN  G A S A L
Sbjct: 149  DFQISQEG-DLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAEL 191



 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 54/213 (25%), Positives = 92/213 (43%), Gaps = 12/213 (5%)

Query: 3224  RNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3283
             R   S+   + + E P + +E++ VT + G+ A+    I GRP P I WY+  + L    
Sbjct: 30518 RTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSR 30577

Query: 3284  KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEM-PV 3342
             K K   DG+ +TL ++    ED  VYTC A N+ G   TS+ L ++      P   +   
Sbjct: 30578 KYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEK 30637

Query: 3343  YPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLE 3402
             Y  A+ + L+  V   G+P             ++W+   K ++ S    +   E    L 
Sbjct: 30638 YYGAVGSTLRLHVMYIGRPVP----------AMTWFHGQKLLQNSENITIENTEHYTHLV 30687

Query: 3403  IAEAYPEDE-GTYTFVASNAVGQVSSTANLSLE 3434
             +     +   G Y    SN  G V +  ++ ++
Sbjct: 30688 MKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQ 30720



 Score = 69.7 bits (169), Expect = 8e-11
 Identities = 90/438 (20%), Positives = 165/438 (37%), Gaps = 64/438 (14%)

Query: 5177 KDNEMPPSFIEPLTKRKVYENTTLGFIVE--VEGLPVPGVKWYRNKSLLEPDERIKMERV 5234
            ++ ++PPSF   L  R V E   L  + +  + G     V WY++   L+    ++   +
Sbjct: 8051 QEQKLPPSFSRQL--RDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDSPNVQTSFL 8108

Query: 5235 GNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEF 5294
             N  +L I    +   G+Y C A N IG A S A + +   +       PP     +   
Sbjct: 8109 DNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARLILTEGKN------PPFFDIRLAPV 8162

Query: 5295 DLEHTTSSRTPSPQEIVLEVELS-EKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFN 5353
            D     S+           +++S  KD +E     K      +   +      L VL  +
Sbjct: 8163 DAVVGESADFECHVTGTQPIKVSWAKDSREIRSGGK------YQISYLENSAHLTVLKVD 8216

Query: 5354 FVDPNMDS-----REGEDK-ELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCS--VIG 5405
              D    +       G+D    +++++   +PP F   + +  + E     FK    V G
Sbjct: 8217 KGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKRLSE-TVEETEGNSFKLEGRVAG 8275

Query: 5406 IPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICR 5465
                 V WYK  + I+P +    I+ +  +  L++R   ++D+  Y C+  N  G A+C 
Sbjct: 8276 SQPITVAWYKNNIEIQPTS-NCEITFKNNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCT 8334

Query: 5466 GFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYA 5525
                       +++ K+ K                            PP F + ++    
Sbjct: 8335 S----------SIVIKEPKK---------------------------PPVFDQHLTPVTV 8357

Query: 5526 PIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYR 5585
              G      C V+GS    + W K G+ ++          +G   L +  + K+D G+Y 
Sbjct: 8358 SEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYV 8417

Query: 5586 CVATNKSGMAESFAALTL 5603
            C A+N +G   + + +T+
Sbjct: 8418 CKASNVAGSDTTKSKVTI 8435



 Score = 69.7 bits (169), Expect = 8e-11
 Identities = 73/317 (23%), Positives = 116/317 (36%), Gaps = 34/317 (10%)

Query: 3944  PSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTL 4003
             P     + S  V  G +  F+ + Q  P   V WY+N + +  +    IH      +LTL
Sbjct: 32374 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSK--IHYTNTSGVLTL 32431

Query: 4004  SSV--HHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
               +  H  + G+   V  N  G     + L        DV       +     +EE    
Sbjct: 32432 EILDCHTDDSGTYRAVCTNYKGEASDYATL--------DVTGGDYTTYASQRRDEEVPRS 32483

Query: 4062  VFDQAKGAHPSMSQ-EGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKES 4120
             VF       P +++ E        KT+     S   E+ S   E + + ++       E 
Sbjct: 32484 VF-------PELTRTEAYAVSSFKKTSEMEASSSVREVKSQMTETRESLSSYEHSASAEM 32536

Query: 4121  KEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILEC 4180
             K       LE K++ +   T+  K         T    ++L + P+     EG+S    C
Sbjct: 32537 KSA----ALEEKSLEEKSTTRKIK---------TTLAARILTK-PRSMTVYEGESARFSC 32582

Query: 4181  LISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAV 4240
                GEP P VTW + G +L  + + Q           I  V + D G Y  V EN+ G  
Sbjct: 32583 DTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVENSEGKQ 32642

Query: 4241  ESVSDLTVEPVTYRENS 4257
             E+   LT++     E +
Sbjct: 32643 EAEFTLTIQKARVTEKA 32659



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 86/423 (20%), Positives = 168/423 (39%), Gaps = 65/423 (15%)

Query: 5178 DNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNV 5237
            D  +PPSF + LTK      +++    +V G      +W+++   +    + ++      
Sbjct: 5232 DQNIPPSFTKKLTKMDKVLGSSIHMECKVSGSLPISAQWFKDGKEISTSAKYRLVCHERS 5291

Query: 5238 CSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLE 5297
             SLE++N++  +   Y C   N+ G+    A   I+  +E    L  P   Q + +  +E
Sbjct: 5292 VSLEVNNLELEDTANYTCKVSNVAGDD---ACSGILTVKEPPSFLVKPGRQQAIPDSTVE 5348

Query: 5298 HTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSM-----IVSLDVLPF 5352
                 +   P +I           K F+  V++V+ P+     +       + S+D    
Sbjct: 5349 FKAILKGTPPFKI-----------KWFKDDVELVSGPKCFIGLEGSTSFLNLYSVDASKT 5397

Query: 5353 NFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAV-FKCSVIGIPTPEV 5411
                 ++ +  G D    + L V E PP+F+  +   KI +  D+   +C + G P   V
Sbjct: 5398 GQYTCHVTNDVGSDSCTTM-LLVTE-PPKFVKKLEASKIVKAGDSSRLECKIAGSPEIRV 5455

Query: 5412 KWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMG 5471
             W++    + P + KY ++       +++ N+   DS  + C A N  G   C   + + 
Sbjct: 5456 VWFRNEHEL-PASDKYRMTFIDSVAVIQMNNLSTEDSGDFICEAQNPAGSTSCSTKVIVK 5514

Query: 5472 DSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAA 5531
            +  +F+                         SF         P  ++ + +    +    
Sbjct: 5515 EPPVFS-------------------------SF---------PPIVETLKNAEVSL---- 5536

Query: 5532 YFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFH-NLFITSLVKSDEGEYRCVATN 5590
              +C + G+P   V WYKD + ++  +   + +   FH ++ I ++  SD GEY C A N
Sbjct: 5537 --ECELSGTPPFEVVWYKDKRQLRSSK-KYKIASKNFHTSIHILNVDTSDIGEYHCKAQN 5593

Query: 5591 KSG 5593
            + G
Sbjct: 5594 EVG 5596



 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 9/131 (6%)

Query: 77    RYSLKATNGSGQATSTAELLVKAETAP---PNFVQRLQSMTVRQGSQVRLQVRVTGIPTP 133
             R   +   G  + +  +E +      P   P+F + L+++ VR  S   L  +VTG P P
Sbjct: 30898 RVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKP 30957

Query: 134   VVKFYRDGAEI-QSSLDFQISQ-EGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAEL 191
             +VK+YR G EI    L ++I + +G  + L+IA    +D+  Y V ATN  G  + TA L
Sbjct: 30958 IVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASL 31017

Query: 192   LVQGEEEVPAK 202
                 E EVPAK
Sbjct: 31018 ----EVEVPAK 31024



 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 100/483 (20%), Positives = 173/483 (35%), Gaps = 81/483 (16%)

Query: 5182 PPSFIEPLTKRKVY-ENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSL 5240
            PPSF++ +    +     +     +++G PV  V W++N   L     ++M  V +   L
Sbjct: 3736 PPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAIL 3795

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTT 5300
            +I++++  + G Y C AVN +G       + I      +  L P          D+   T
Sbjct: 3796 DITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEPA---------DIVRGT 3846

Query: 5301 SSRTPSPQEIVLEVELSEK---DVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDP 5357
            ++        +L+ E+S     ++  F+ + +I +  ++    +  +V L++  FN  D 
Sbjct: 3847 NA--------LLQCEVSGTGPFEISWFKDKKQIRSSKKYRLFSQKSLVCLEIFSFNSADV 3898

Query: 5358 NMDSREGEDKELK---IDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWY 5414
                    ++  K   +   + + PP F+  + D           + +V G     V W 
Sbjct: 3899 GEYECVVANEVGKCGCMATHLLKEPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWM 3958

Query: 5415 KEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVN------CVGEAICRG-- 5466
            K    I  D  K  +S   G   L I +V +S    Y C A N       VGE I +   
Sbjct: 3959 KGQEVIREDG-KIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAGSQTSVGELIVKEPA 4017

Query: 5467 ---------FLTMGD---------------------------SEIFAVIAKKSKVTLSSL 5490
                      +T GD                           S+ + +  K +   L   
Sbjct: 4018 KIIERAELIQVTAGDPATLEYTVAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFY 4077

Query: 5491 MEELVLKSNYT------------DSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVR 5538
              EL     YT            ++ F     +  P F K + +  + +       C + 
Sbjct: 4078 SAELHDSGQYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVVNGTCRLDCKIA 4137

Query: 5539 GSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESF 5598
            GS    V W+KDGK +            G  +L I  +  +D G + C ATN  G  +S 
Sbjct: 4138 GSLPMRVSWFKDGKEIAASDRYRIAFVEGTASLEIIRVDMNDAGNFTCRATNSVGSKDSS 4197

Query: 5599 AAL 5601
             AL
Sbjct: 4198 GAL 4200



 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 60/258 (23%), Positives = 110/258 (42%), Gaps = 41/258 (15%)

Query: 6     PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DGRAK 64
             P  TQ L++    E +  T     S     EV+W++DG+ +  +     Q  +S DG  +
Sbjct: 32718 PKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKDGKKLKENG--HFQFHYSADGTYE 32775

Query: 65    LTIPAVTKANSGRY------------------------------SLKATNGSGQATSTAE 94
             L I  +T+++ G Y                               +  T  S Q T+ + 
Sbjct: 32776 LKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKTTEST 32835

Query: 95    LLVKAE-------TAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSS 147
             +  K E       ++ P  V  LQ  TV   S  +  V+ TG P P   + +DG  I   
Sbjct: 32836 VTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG 32895

Query: 148   LDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTI 207
               +++S++   + L I +    DSG Y+    NS G  +S+ +L ++  ++  A+K  T 
Sbjct: 32896 GKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVST- 32954

Query: 208   VSTAQISESRQTRIEKKI 225
               T++I+  ++  ++++I
Sbjct: 32955 QKTSEITPQKKAVVQEEI 32972



 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 65/293 (22%), Positives = 112/293 (38%), Gaps = 36/293 (12%)

Query: 5183  PSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEI 5242
             P+FI     + + E   + F  E+ G P P ++W++N   +     + + R  NV SLEI
Sbjct: 33134 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEI 33193

Query: 5243  SNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSS 5302
              N    + G+Y   A N  G+  + A++ ++P  E           + V+      T+  
Sbjct: 33194 RNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEE--------PSREVVLRTSGDTSLQ 33245

Query: 5303  RTPSPQEIVLEVELSEKDVKEF-EKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDS 5361
              + S Q + +     E     F       +T  +F         S+  +  +FV+ +  S
Sbjct: 33246 GSFSSQSVQMSASKQEASFSSFSSSSASSMTEMKFA---SMSAQSMSSMQESFVEMSSSS 33302

Query: 5362  REGEDKELKIDLEVFEM--------PPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKW 5413
               G     +++    +M        PP+      D  I E       C+  G PTPEV W
Sbjct: 33303 FMGISNMTQLESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTW 33362

Query: 5414  -----------YKEYMCIEPDNIKYVI-----SEEKGSHTLKIRNVCLSDSAT 5450
                           +     D++  +I      ++ G +TL + N   SDSAT
Sbjct: 33363 SCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSAT 33415



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 70/326 (21%), Positives = 139/326 (42%), Gaps = 43/326 (13%)

Query: 3941 RCPPSFLQEIE-SQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYS 3999
            R PPSF+++++ S  +  G+S    C  +G P   VTW+ N+  +  +    ++ + + +
Sbjct: 3734 REPPSFVKKVDPSYLMLPGESARLHCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEA 3793

Query: 4000 ILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEEL 4059
            IL ++ V  ++ GS +C   N  G+   ++ + +K          + P F   L+     
Sbjct: 3794 ILDITDVKVEDSGSYSCEAVNDVGSDSCSTEIVIK----------EPPSFIKTLEPA--- 3840

Query: 4060 ALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKE 4119
                D  +G +  +  E             V  +G  E+  F  + Q+ ++       ++
Sbjct: 3841 ----DIVRGTNALLQCE-------------VSGTGPFEISWFKDKKQIRSSKKYRLFSQK 3883

Query: 4120 SK---EVFQTEEL---EPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREG 4173
            S    E+F        E + +  ++V +         + +  EPP  ++++        G
Sbjct: 3884 SLVCLEIFSFNSADVGEYECVVANEVGKCG----CMATHLLKEPPTFVKKVDDLIALG-G 3938

Query: 4174 DSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVA 4233
             ++ L+  + G     VTW +   +++++ K +    N    L I DV     GKY C+A
Sbjct: 3939 QTVTLQAAVRGSEPISVTWMKGQEVIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLA 3998

Query: 4234 ENNSGAVESVSDLTV-EPVTYRENSQ 4258
            EN +G+  SV +L V EP    E ++
Sbjct: 3999 ENEAGSQTSVGELIVKEPAKIIERAE 4024



 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 78/325 (24%), Positives = 123/325 (37%), Gaps = 45/325 (13%)

Query: 3943 PPSFLQEI-ESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSIL 4001
            PPSF + + E+ E  EG+S        G     V WY N++ I    N  I    N  +L
Sbjct: 8248 PPSFTKRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVL 8307

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLD----EEE 4057
             +      + G  TC + N  G+   TS + +K       +  K PVF  +L      E 
Sbjct: 8308 QVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIK-------EPKKPPVFDQHLTPVTVSEG 8360

Query: 4058 ELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQD 4117
            E   +    +G+ P         +  LK    + PS D    SF     V     + + D
Sbjct: 8361 EYVQLSCHVQGSEP-------IRIQWLKAGREIKPS-DRCSFSFASGTAVLELRDVAKAD 8412

Query: 4118 K-----ESKEVFQTEELEPKAMPQDQVTQSP-------KHRFVFLSDITNEPPKMLQEMP 4165
                  ++  V  ++  + K   +D+   +P         R  F+S+            P
Sbjct: 8413 SGDYVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLFFVSE------------P 8460

Query: 4166 KHARCREGDSIILECLISGEPQPVVTWFQ-NGVLLKQNQKFQFEEVNCSHQLYIKDVNSQ 4224
            +  R  E  +      + G+P P V W +     L Q  +    +     +L I+D    
Sbjct: 8461 QSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKT 8520

Query: 4225 DSGKYKCVAENNSGAVESVSDLTVE 4249
            DSG Y+CVA N  G +ES  +L V+
Sbjct: 8521 DSGLYRCVAFNEHGEIESNVNLQVD 8545



 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 105/494 (21%), Positives = 181/494 (36%), Gaps = 99/494 (20%)

Query: 5182 PPSFIEPLTKRKVYEN-TTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSL 5240
            P +F+E L   ++ +         +V G P   + W+ N   ++   + +M  V +   L
Sbjct: 4298 PATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVL 4357

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTT 5300
             ++++   + GEYMC A N  G +   +++ I+ +         P+  + + E+D+    
Sbjct: 4358 RLTDVGIEDSGEYMCEAQNEAG-SDHCSSIVIVKESPYFTKEFKPI--EVLKEYDVMLLA 4414

Query: 5301 SSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMD 5360
                  P EI       +  +    ++ K      F  DH   +VSL +L F   D    
Sbjct: 4415 EVAGTPPFEITW---FKDNTILRSGRKYKT-----FIQDH---LVSLQILKFVAADAG-- 4461

Query: 5361 SREGEDKELKIDLEV----------FEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPE 5410
                 + + ++  EV             PP FI  I          A F+ ++ G     
Sbjct: 4462 -----EYQCRVTNEVGSSICSARVTLREPPSFIKKIESTSSLRGGTAAFQATLKGSLPIT 4516

Query: 5411 VKWYKEYMCI-EPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLT 5469
            V W K+   I E DNI+        S  L +  + +     Y C+A N  G   C   L+
Sbjct: 4517 VTWLKDSDEITEDDNIRMTFENNVAS--LYLSGIEVKHDGKYVCQAKNDAGIQRCSALLS 4574

Query: 5470 M----------------------------GDSEIFA---------VIAKKSKVTLSSLME 5492
            +                            G  EI A          +  K K++++  + 
Sbjct: 4575 VKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVS 4634

Query: 5493 ELVL----KSNYTDSFFEFQVVEG---------------PPRFIKGISDCYAPIGTAAYF 5533
             L +    K +  +  FE Q   G               PP F K +    +  G+    
Sbjct: 4635 ILKIISTEKKDSGEYTFEVQNDVGRSSCKARINVLDLIIPPSFTKKLKKMDSIKGSFIDL 4694

Query: 5534 QCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHN----LFITSLVKSDEGEYRCVAT 5589
            +C+V GS   ++ W+KD + +       E+    FH+    L I+ L  +D G Y C AT
Sbjct: 4695 ECIVAGSHPISIQWFKDDQEISAS----EKYKFSFHDNTAFLEISQLEGTDSGTYTCSAT 4750

Query: 5590 NKSGMAESFAALTL 5603
            NK+G  +    LT+
Sbjct: 4751 NKAGHNQCSGHLTV 4764



 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 51/183 (27%), Positives = 89/183 (48%), Gaps = 9/183 (4%)

Query: 1479  KVVGRPMPETFWFHDGQQIVND-YTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAG 1537
             KV G P P   W+  G++I+ D   +++   + G   LII   T  D+  + V A N+ G
Sbjct: 30950 KVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGG 31009

Query: 1538  RSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIV 1597
               S +  L VE       P  +E +  V+   G  + +K+  +G P+P I W K  D+I 
Sbjct: 31010 SVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLID 31069

Query: 1598  PHKYPKIRIEGTKGEAALKIDSTVS-QDSAWYTATAINKAGRDTTRCKVNVEVEFAE-PE 1655
              + + ++ +  T+   +L   + V  +D+ +Y   A N+ G D    +  VE++ A+ P+
Sbjct: 31070 NNGHYQVIV--TRSFTSLVFPNGVERKDAGFYVVCAKNRFGID----QKTVELDVADVPD 31123

Query: 1656  PER 1658
             P R
Sbjct: 31124 PPR 31126



 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 70/312 (22%), Positives = 118/312 (37%), Gaps = 32/312 (10%)

Query: 3943 PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPI-VTWYNNDMPIPRNQNFIIHSLENYSIL 4001
            PP F   +   +   G+S +F CH  G  QPI V+W  +   I     + I  LEN + L
Sbjct: 8152 PPFFDIRLAPVDAVVGESADFECHVTG-TQPIKVSWAKDSREIRSGGKYQISYLENSAHL 8210

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
            T+  V   + G  TC   N+ G    T+ L +K +          P F   L E  E   
Sbjct: 8211 TVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERL-------IPPSFTKRLSETVE--- 8260

Query: 4062 VFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESK 4121
                            +T  +  K    V  S    +  +   I++   +      K + 
Sbjct: 8261 ----------------ETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNT 8304

Query: 4122 EVFQTEE--LEPKAMPQDQVTQSPKHRFVFLSDITNEP--PKMLQEMPKHARCREGDSII 4177
             V Q  +  +    +   +V+          S +  EP  P +  +        EG+ + 
Sbjct: 8305 LVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKKPPVFDQHLTPVTVSEGEYVQ 8364

Query: 4178 LECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNS 4237
            L C + G     + W + G  +K + +  F   + +  L ++DV   DSG Y C A N +
Sbjct: 8365 LSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGDYVCKASNVA 8424

Query: 4238 GAVESVSDLTVE 4249
            G+  + S +T++
Sbjct: 8425 GSDTTKSKVTIK 8436



 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 51/208 (24%), Positives = 97/208 (46%), Gaps = 10/208 (4%)

Query: 7    TFTQPLQ-SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            TF + L+ S ++ +G        ++G P  +++WF + + I  S+    ++SF +  A L
Sbjct: 4300 TFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKH--RMSFVESTAVL 4357

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             +  V   +SG Y  +A N +G    ++ ++VK     P F +  + + V +   V L  
Sbjct: 4358 RLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKES---PYFTKEFKPIEVLKEYDVMLLA 4414

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             V G P   + +++D   ++S   ++   +  L SL I +    D+G Y    TN VG +
Sbjct: 4415 EVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILKFVAADAGEYQCRVTNEVGSS 4474

Query: 186  TSTAELLVQGEEEVPAKKTKTIVSTAQI 213
              +A + ++     P    K I ST+ +
Sbjct: 4475 ICSARVTLR----EPPSFIKKIESTSSL 4498



 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 82/391 (20%), Positives = 143/391 (36%), Gaps = 90/391 (23%)

Query: 5182 PPSFIEPLTKRKVY-ENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSL 5240
            PP F++ L   KV  +  ++    ++ G P   V W+RN S L    +  M  + +V  L
Sbjct: 6363 PPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALL 6422

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTT 5300
             I+     + G+Y+C A N +G+A     +         V  PP  T +           
Sbjct: 6423 TINEASAEDSGDYICEAHNGVGDASCSTAL--------TVKAPPVFTQK----------- 6463

Query: 5301 SSRTPSP------QEIVLEVELSEK---DVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLP 5351
                PSP       +++L+ E+S     +V   + + ++    +F    K    SL +L 
Sbjct: 6464 ----PSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHIL- 6518

Query: 5352 FNFVDPNMDSREGEDKELKIDLEV----------FEMPPRFIMPICDFKIPENSDAVFKC 5401
                  N+++ +  +   K   EV          F+ PPRF+  + D           + 
Sbjct: 6519 ------NLEASDVGEYHCKATNEVGSDTCSCSVKFKEPPRFVKKLSDTSTLIGDAVELRA 6572

Query: 5402 SVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGE 5461
             V G     V W K+   +  ++    IS      TL++ +   S+S  Y C+  N  G 
Sbjct: 6573 IVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKNDAGM 6632

Query: 5462 AICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGIS 5521
              C   LT+   E   +I K   +T+++                                
Sbjct: 6633 RECSAVLTV--LEPARIIEKPEPMTVTT-------------------------------- 6658

Query: 5522 DCYAPIGTAAYFQCLVRGSPRPTVYWYKDGK 5552
                  G     +C+V G+P  +  W+KDG+
Sbjct: 6659 ------GNPFALECVVTGTPELSAKWFKDGR 6683



 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 66/312 (21%), Positives = 118/312 (37%), Gaps = 36/312 (11%)

Query: 3943 PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILT 4002
            PPSF ++++      G S    C   G P   V+W++    I   + +     +N   LT
Sbjct: 7681 PPSFTRKLKETNGLSGSSVVMECKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALT 7740

Query: 4003 LSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALV 4062
            ++ +   + G  TC+  N  G+ + ++ L V+       K   + V              
Sbjct: 7741 VNMLEESDSGDYTCIATNMAGSDECSAPLTVREPPSFVQKPDPMDV-------------- 7786

Query: 4063 FDQAKGAHPSMSQEGQTNLHLLKTNPPVPPS---GDTELLSFPVEIQVTAATPIPEQDKE 4119
                      ++    T   ++K  PP   S   G +EL+       V+    + E +  
Sbjct: 7787 ----------LTGTNVTFTSIVKGTPPFSVSWFKGSSELVPGD-RCNVSLEDSVAELELF 7835

Query: 4120 SKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILE 4179
              +  Q+ E       +        H ++        P K ++ +  ++   +G  +ILE
Sbjct: 7836 DVDTSQSGEYTCIVSNEAGKASCTTHLYI------KAPAKFVKRLNDYS-IEKGKPLILE 7888

Query: 4180 CLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGA 4239
               +G P   VTW +NG+ +  +Q+        S  L I     +D+G+Y C  EN SG 
Sbjct: 7889 GTFTGTPPISVTWKKNGINVTPSQRCNITTTEKSAILEIPSSTVEDAGQYNCYIENASGK 7948

Query: 4240 VE-SVSDLTVEP 4250
               S   L +EP
Sbjct: 7949 DSCSAQILILEP 7960



 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 247/1234 (20%), Positives = 427/1234 (34%), Gaps = 203/1234 (16%)

Query: 470   EAEKTAVTKVVVAADKAKEQELK-----SRTKEVITTKQEQMHVTHEQIRKETEKTFVPK 524
             EA K  V +  V A   K+ E+         KEV+  K+  +    +     T+   VPK
Sbjct: 10583 EAPKEVVPEKKVPAAPPKKPEVTPVKVPEAPKEVVPEKKVPVPPPKKPEVPPTKVPEVPK 10642

Query: 525   VVISAAKAKEQETRISE----EITKKQKQVTQEA----IRQETEITAASMVVVATAKSTK 576
             V +   K  E      E    E+ ++ ++V  E     + +E E  A   V V   K   
Sbjct: 10643 VAVPEKKVPEAIPPKPESPPPEVFEEPEEVALEEPPAEVVEEPEPAAPPQVTVPPKKPVP 10702

Query: 577   LETVPG--AQEETTTQQDQMHLSYEKIMKETRKTVVPKVIVATP-KVKE--QDLVSRGRE 631
              +  P   A++          +  E + ++    VVPK   A P KV E  +++V   + 
Sbjct: 10703 EKKAPAVVAKKPELPPVKVPEVPKEVVPEKKVPLVVPKKPEAPPAKVPEVPKEVVPEKKV 10762

Query: 632   GITTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHG 691
              +  K E       ++ K+        + V          +    E +A  +E       
Sbjct: 10763 AVPKKPEVPPAKVPEVPKKPVLEEKPAVPVPERAESPPPEVYEEPEEIAPEEEIAPEEEK 10822

Query: 692   KVDVGKKAEAVATVVAAVDQARVREPREPGHL--EESYAQQTTLEYGYKERISAAKVAEP 749
              V V ++ E      A         P EP  +  E+        E    +     KV E 
Sbjct: 10823 PVPVAEEEEPEVPPPAV--------PEEPKKIIPEKKVPVIKKPEAPPPKEPEPEKVIEK 10874

Query: 750   PQ---RPASEPHVVPKA-VKPRVIQAPSETHIKTTDQKGMHISSQIKKTTDLTTERLVHV 805
             P+   RP   P   PK  VK ++ Q      +K   +K +    Q+ +  +LT  ++   
Sbjct: 10875 PKLKPRPPPPPPAPPKEDVKEKIFQ------LKAIPKKKVPEKPQVPEKVELTPLKVPGG 10928

Query: 806   DKRPRTASPHF-------TVSKISVPKTEHGYEASIAGSAIATLQKELSATSSAQKITKS 858
             +K+ R   P          V K  + K     E  +    +  ++K         K  + 
Sbjct: 10929 EKKVRKLLPERKPEPKEEVVLKSVLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEE 10988

Query: 859   VKAPTVKPSETRVRAEPTPLPQF----PFADTPDTYKSEAGVEVKKEVGVSITGTTVREE 914
             V+ PTV   E ++  EPT +P+     P        K EA V+  K   V    T +   
Sbjct: 10989 VEVPTVTKRERKI-PEPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAP 11047

Query: 915   RFEVLHGREAKVT----ETAR-----------VPAPVE---------------------- 937
                 + G++A+      E A+            P+P+E                      
Sbjct: 11048 VTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPSPIEAERRKLRPGSGGEKPPDEAPFT 11107

Query: 938   --IPVTPPTLVSGLKNVTVIE----GESVTLECHISGYPSPTVT-WYREDYQIESSIDFQ 990
               +   P   V  +K++ + E    G S   EC +S  PS  +T W ++   I  S   +
Sbjct: 11108 YQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVS--PSTAITTWMKDGSNIRESPKHR 11165

Query: 991   ITFQSGIARLMIREAFAEDSGRFTC--SAVNEAGTVSTSCY---LAVQVSEEFEKETTAV 1045
                     +L I +    D+G +TC     N+  T +       L V+  +  E+E T V
Sbjct: 11166 FIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVV 11225

Query: 1046  TEKFTTEEKRFVESRDVV-MTDTSLTEEQAG---PG---------------EPAAPYFIT 1086
               +         + RDVV   D  +  E+ G   PG                 A  Y +T
Sbjct: 11226 KGQPLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVT 11285

Query: 1087  ------------------------KPVVQKLVE-GGSVVFGCQVGGNPKPHVYWKKSGVP 1121
                                     KP+  + V+  G+ +F C +     P++ W K    
Sbjct: 11286 VENANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFACDI-AKDTPNIKWFKGYDE 11344

Query: 1122  LTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLM 1181
             +      K    +      L I     +D  EY + +  K      +   L E + ELL 
Sbjct: 11345 IPAEPNDKTEILRDGNHLYLKIKNAMPEDIAEYAVEIEGKRYPAKLT---LGEREVELLK 11401

Query: 1182  KSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVE 1241
               +   +Y+ +  +F  E    +  PG    + E         I+ +  K  + +     
Sbjct: 11402 PIEDVTIYEKESASFDAEISEAD-IPGQWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKL 11460

Query: 1242  DQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYR 1301
             DQ             E+ Y+ +      +L               + +E  F   +K+  
Sbjct: 11461 DQ-----------AGEVLYQALNAITTAIL-------------TVKEIELDFAVPLKDVT 11496

Query: 1302  ILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRAS-LRIPVVLPEDEG 1360
             + E     F C ++      + W K    IK  +++  D + DG+   L I     +DEG
Sbjct: 11497 VPERRQARFECVLTRE--ANVIWSKGPDIIKSSDKF--DIIADGKKHILVINDSQFDDEG 11552

Query: 1361  IYTAFASNIKGNA-ICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSV--------- 1410
             +YTA     K +A +    + ++  +PL   T +   E  + +  LS   +         
Sbjct: 11553 VYTAEVEGKKTSARLFVTGIRLKFMSPLEDQT-VKEGETATFVCELSHEKMHVVWFKNDA 11611

Query: 1411  ----SRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERL-YKPVFVLKPVS 1465
                 SR+ +  S  +     M    +        +  E +  +QL+ L   P F +K   
Sbjct: 11612 KLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHD 11671

Query: 1466  FKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI-IVPATPSD 1524
                +E        + V + +P   WF DG++IV   + K  IK DG + ++ I  A   D
Sbjct: 11672 KTAVEKDEITLKCE-VSKDVP-VKWFKDGEEIVP--SPKYSIKADGLRRILKIKKADLKD 11727

Query: 1525  SGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMF 1558
              GE+         +++++V   +  VE   KP++
Sbjct: 11728 KGEYVCDCGTDKTKANVTVEARLIKVE---KPLY 11758



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 67/285 (23%), Positives = 114/285 (40%), Gaps = 20/285 (7%)

Query: 5172 EAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKM 5231
            + IE   +   P   E +  + V + +   F V V G P P  +WY+N   +E  +RI  
Sbjct: 2067 DKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYW 2126

Query: 5232 E-RVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQH 5290
                 NVC L I ++   +    M  A+NI GE  S A   ++ Q ++++     +    
Sbjct: 2127 YWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHA--FLLVQAKQLITFTQELQDVV 2184

Query: 5291 VMEFDLEHTTSSRTPSPQEIVL----EVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVS 5346
              E D   T    T  P   V      +E+ E D        K+         H   I++
Sbjct: 2185 AKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKV---------HFLSILT 2235

Query: 5347 LDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGI 5406
            +D    +  D +    E E+ +    L V      F+  + D ++PE+     +C ++  
Sbjct: 2236 IDT--SDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELEC-IVSP 2292

Query: 5407 PTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATY 5451
               E KWY   + ++  N KY I+  +G   L +++V   D   Y
Sbjct: 2293 ENIEGKWYHNDVELK-SNGKYTITSRRGRQNLTVKDVTKEDQGEY 2336



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 72/349 (20%), Positives = 141/349 (40%), Gaps = 46/349 (13%)

Query: 3943 PPSFLQEIE-SQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSIL 4001
            P +F++++E SQ + +GD+    C   G P   +TW+ ND  I  +    +  +E+ ++L
Sbjct: 4298 PATFVEKLEPSQLLKKGDATQLACKVTGTPPIKITWFANDREIKESSKHRMSFVESTAVL 4357

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
             L+ V  ++ G   C   N+ G+   +S++ VK       +   + V  +Y        +
Sbjct: 4358 RLTDVGIEDSGEYMCEAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEY------DVM 4411

Query: 4062 VFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESK 4121
            +  +  G  P      + N  +L++           L+S  + ++  AA     Q + + 
Sbjct: 4412 LLAEVAGTPPFEITWFKDNT-ILRSGRKYKTFIQDHLVSLQI-LKFVAADAGEYQCRVTN 4469

Query: 4122 EVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECL 4181
            EV         ++   +VT               EPP  ++++   +  R G +   +  
Sbjct: 4470 EV-------GSSICSARVT-------------LREPPSFIKKIESTSSLR-GGTAAFQAT 4508

Query: 4182 ISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVE 4241
            + G     VTW ++   + ++   +    N    LY+  +  +  GKY C A+N++G   
Sbjct: 4509 LKGSLPITVTWLKDSDEITEDDNIRMTFENNVASLYLSGIEVKHDGKYVCQAKNDAGIQR 4568

Query: 4242 SVSDLTV-EPVTYRENS---------------QFENIGEIYGKYSRDQQ 4274
              + L+V EP T  E +               +F    EI  K+ +D Q
Sbjct: 4569 CSALLSVKEPATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQ 4617



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 92/426 (21%), Positives = 159/426 (37%), Gaps = 77/426 (18%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            P   +E      V    T     +V G P   V+WY++  LL   ++ K      + SL 
Sbjct: 5703 PAVIVEKAGPMTVTVGETCTLECKVAGTPELSVEWYKDGKLLTSSQKHKFSFYNKISSLR 5762

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            I ++++ + G Y     N +G++   A VD+  +     A+PP  T +      L++T  
Sbjct: 5763 ILSVERQDAGTYTFQVQNNVGKSSCTAVVDVSDR-----AVPPSFTRR------LKNTGG 5811

Query: 5302 SRTPSPQEIVLEVEL---SEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPN 5358
                S    +LE ++   S   V  F ++ KIV+  ++       + +L +   +  D  
Sbjct: 5812 VLGAS---CILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQLNSLDSSDMG 5868

Query: 5359 ----MDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWY 5414
                + +      E +  L V E PP F+      ++    +  F   + G P  +V W+
Sbjct: 5869 NYTCVAANVAGSDECRAVLTVQE-PPSFVKEPEPLEVLPGKNVTFTSVIRGTPPFKVNWF 5927

Query: 5415 ---KEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMG 5471
               +E +  +  NI +    E     L++ N+ +S S  Y C   N  G+A C       
Sbjct: 5928 RGARELVKGDRCNIYF----EDTVAELELFNIDISQSGEYTCVVSNNAGQASC------- 5976

Query: 5472 DSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAA 5531
                                         T   F    V+ P  F+K +SD     G + 
Sbjct: 5977 -----------------------------TTRLF----VKEPAAFLKRLSDHSVEPGKSI 6003

Query: 5532 YFQCLVRGSPRPTVYWYKDGKLVQGRR----FTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
              +    G+   +V W KDG  +         T E++      L I +  K D G+Y C 
Sbjct: 6004 ILESTYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCI----LEILNSTKRDAGQYSCE 6059

Query: 5588 ATNKSG 5593
              N++G
Sbjct: 6060 IENEAG 6065



 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 62/307 (20%), Positives = 119/307 (38%), Gaps = 23/307 (7%)

Query: 3943 PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILT 4002
            PP F++ +E  E   G+     C   G P+  ++WY     +     + +    N + L 
Sbjct: 7019 PPYFIEPLEHVEAVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLV 7078

Query: 4003 LSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALV 4062
            ++ V H + G  +C   N  G V ++++L +KA++     A K+   H+ L         
Sbjct: 7079 INKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECR 7138

Query: 4063 FDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESKE 4122
             + ++    S  ++G     LLK +  +  S           +   A   I + D+    
Sbjct: 7139 INGSEPLQVSWYKDGV----LLKDDANLQTS----------FVHNVATLQILQTDQSHIG 7184

Query: 4123 VFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECLI 4182
             +      P        T S   + + LS+  +E P      P       G+S   +C +
Sbjct: 7185 QYNCSASNPLG------TASSSAKLI-LSE--HEVPPFFDLKPVSVDLALGESGTFKCHV 7235

Query: 4183 SGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVES 4242
            +G     +TW ++   ++    ++   V  +  L +  V   D+G+Y C A N +G    
Sbjct: 7236 TGTAPIKITWAKDNREIRPGGNYKMTLVENTATLTVLKVGKGDAGQYTCYASNIAGKDSC 7295

Query: 4243 VSDLTVE 4249
             + L V+
Sbjct: 7296 SAQLGVQ 7302



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/189 (25%), Positives = 85/189 (44%), Gaps = 5/189 (2%)

Query: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
            P+FT+ L++   + G++   E  ++G     V+WF +   I +      Q +FSD    L
Sbjct: 5800 PSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAK--YQTTFSDNVCTL 5857

Query: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQV 125
             + ++  ++ G Y+  A N +G     A L V+    PP+FV+  + + V  G  V    
Sbjct: 5858 QLNSLDSSDMGNYTCVAANVAGSDECRAVLTVQE---PPSFVKEPEPLEVLPGKNVTFTS 5914

Query: 126  RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             + G P   V ++R   E+       I  E  +  L +       SG Y+   +N+ G+A
Sbjct: 5915 VIRGTPPFKVNWFRGARELVKGDRCNIYFEDTVAELELFNIDISQSGEYTCVVSNNAGQA 5974

Query: 186  TSTAELLVQ 194
            + T  L V+
Sbjct: 5975 SCTTRLFVK 5983



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 91/431 (21%), Positives = 160/431 (37%), Gaps = 68/431 (15%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            P +F++ L    V   + +       G P   V W +++ L+   ER  +        LE
Sbjct: 6926 PATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLISQSERCSITMTEKSTILE 6985

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTS 5301
            I      +  +Y C   N  G+       DI   E  V  L PP   +      LEH   
Sbjct: 6986 ILESTIEDYAQYSCLIENEAGQ-------DIC--EALVSVLEPPYFIE-----PLEH-VE 7030

Query: 5302 SRTPSPQEIVLEVE-LSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMD 5360
            +    P  +  +V+   E  +  +++  K+ + P +    K+ + SL +   +  D    
Sbjct: 7031 AVIGEPATLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEY 7090

Query: 5361 SREGED------KELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWY 5414
            S + ++          + ++  ++PP F   + D          F+C + G    +V WY
Sbjct: 7091 SCKADNSVGAVASSAVLVIKARKLPPFFARKLKDVHETLGFPVAFECRINGSEPLQVSWY 7150

Query: 5415 KEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSE 5474
            K+ + ++ D+     S      TL+I     S    Y C A N +G A            
Sbjct: 7151 KDGVLLK-DDANLQTSFVHNVATLQILQTDQSHIGQYNCSASNPLGTA------------ 7197

Query: 5475 IFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQ 5534
                          S   +L+L  +    FF+          +K +S   A +G +  F+
Sbjct: 7198 --------------SSSAKLILSEHEVPPFFD----------LKPVSVDLA-LGESGTFK 7232

Query: 5535 CLVRGSPRPTVYWYKDGKLVQG----RRFTVEESGTGFHNLFITSLVKSDEGEYRCVATN 5590
            C V G+    + W KD + ++     +   VE + T    L +  + K D G+Y C A+N
Sbjct: 7233 CHVTGTAPIKITWAKDNREIRPGGNYKMTLVENTAT----LTVLKVGKGDAGQYTCYASN 7288

Query: 5591 KSGMAESFAAL 5601
             +G     A L
Sbjct: 7289 IAGKDSCSAQL 7299



 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 77/326 (23%), Positives = 133/326 (40%), Gaps = 39/326 (11%)

Query: 738   KERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETHIKTTDQKGMHISSQIKKTTDL 797
             +E ++      PP+ P++ P V+    K  V    S +  +  D  G  ++    +  + 
Sbjct: 30317 EEPVTPKTPLNPPEPPSNPPEVLD-VTKSSV----SLSWSRPKDDGGSRVTGYYIERKET 30371

Query: 798   TTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSSAQKITK 857
             +T++ V  +K   T +  +TV+ + VP  E+ +        IA     LS TS A +   
Sbjct: 30372 STDKWVRHNKTQITTTM-YTVTGL-VPDAEYQFRI------IAQNDVGLSETSPASEPVV 30423

Query: 858   SVKAPTVKPSET------RVRAEPTPL----PQ-----------FPFADTPDTYKSEAGV 896
               K P  KPS+        +  +   L    P+             +  + D+   ++  
Sbjct: 30424 C-KDPFDKPSQPGELEILSISKDSVTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNK 30482

Query: 897   EVKKEVGVSITGTT-VREERFEVLHGREAKVTETARVPAPVEIPVTP---PTLVSGLKNV 952
             E  K+   +I G     E  F V    E  ++   R    ++  +T    P +   +K+V
Sbjct: 30483 ERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDV 30542

Query: 953   TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGR 1012
             T   GE+  L C I G P P + WYR   ++  S  ++++       L +     ED G 
Sbjct: 30543 TTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGV 30602

Query: 1013  FTCSAVNEAGTVSTSCYLAVQVSEEF 1038
             +TC A NE G V TS  L +Q + +F
Sbjct: 30603 YTCIATNEVGEVETSSKLLLQATPQF 30628



 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 51/170 (30%), Positives = 85/170 (50%), Gaps = 12/170 (7%)

Query: 10    QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK-LTIP 68
             +PL+ V V  G TATF+  +S   +P V W+  G+ +  S      +  S+G+   LT+ 
Sbjct: 12200 RPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKV---VPRSEGKVHTLTLR 12255

Query: 69    AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128
              V   ++G   L A +      + A L VK    P  F + L+  TV +G+   L+  V+
Sbjct: 12256 DVKLEDAGEVQLTAKDFK----THANLFVKEP--PVEFTKPLEDQTVEEGATAVLECEVS 12309

Query: 129   GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNA 178
                   VK++++G EI  S  ++I  +G +  L+I +  PED  TY+ +A
Sbjct: 12310 R-ENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDA 12358



 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 50/186 (26%), Positives = 76/186 (40%), Gaps = 30/186 (16%)

Query: 36    EVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAEL 95
             +V+W+   + +  S     +I++ DG A L +  +TK + G Y  K  N  G+ +S AEL
Sbjct: 31599 QVTWYFGVRQLENSEK--YEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAEL 31656

Query: 96    LVKAE-------------------------TAPPNFVQRLQSMTVRQGSQVRLQVRVTGI 130
              VK                             PP F   L + T   G  VR  V +T  
Sbjct: 31657 FVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVH 31716

Query: 131   PTPVVKFYRDGAEIQ---SSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATS 187
             P P V +Y+ G +I+   +   +    +  LY L I     +D   Y+V A N  G  + 
Sbjct: 31717 PEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSC 31776

Query: 188   TAELLV 193
              A+L V
Sbjct: 31777 KAKLTV 31782



 Score = 63.5 bits (153), Expect = 6e-09
 Identities = 69/315 (21%), Positives = 124/315 (39%), Gaps = 28/315 (8%)

Query: 3941 RCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPR-NQNFIIHSLENYS 3999
            + PP F++++       G         +G     V W+ +   I R + N  I   EN +
Sbjct: 7489 KAPPRFVKKLSDISTVVGKEVQLQTTIEGAEPISVVWFKDKGEIVRESDNIWISYSENIA 7548

Query: 4000 ILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEEL 4059
             L  S V   N G  TC + N  G  +  + L V                   +++ E +
Sbjct: 7549 TLQFSRVEPANAGKYTCQIKNDAGMQECFATLSVLEPAT-------------IVEKPESI 7595

Query: 4060 ALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKE 4119
             +          +++   + +    K    +  S +   +SF  ++       +   D  
Sbjct: 7596 KVTTGDTCTLECTVAGTPELSTKWFKDGKELT-SDNKYKISFFNKVSGLKIINVAPSDSG 7654

Query: 4120 SKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILE 4179
               V+  E   P  + +D  T S +     +SD T  PP   +++ K      G S+++E
Sbjct: 7655 ---VYSFEVQNP--VGKDSCTASLQ-----VSDRT-VPPSFTRKL-KETNGLSGSSVVME 7702

Query: 4180 CLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGA 4239
            C + G P   V+WF  G  +   +K+Q    + +  L +  +   DSG Y C+A N +G+
Sbjct: 7703 CKVYGSPPISVSWFHEGNEISSGRKYQTTLTDNTCALTVNMLEESDSGDYTCIATNMAGS 7762

Query: 4240 VESVSDLTV-EPVTY 4253
             E  + LTV EP ++
Sbjct: 7763 DECSAPLTVREPPSF 7777



 Score = 63.2 bits (152), Expect = 7e-09
 Identities = 71/308 (23%), Positives = 127/308 (41%), Gaps = 31/308 (10%)

Query: 3943 PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENY-SIL 4001
            PPSF Q  +S EV  G S  F    +G P   V W+     +   ++  I SLE++ + L
Sbjct: 6833 PPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNI-SLEDFVTEL 6891

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
             L  V     G  +C++ N  G+   T+ L VK        A  V    D+   E    +
Sbjct: 6892 ELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKE------PATFVKRLADF-SVETGSPI 6944

Query: 4062 VFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESK 4121
            V +      P +S     + +L+               S    I +T  + I E  + + 
Sbjct: 6945 VLEATYTGTPPISVSWIKDEYLISQ-------------SERCSITMTEKSTILEILESTI 6991

Query: 4122 EVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECL 4181
            E    +  +   + +++  Q      V + +    PP  ++ + +H     G+   L+C 
Sbjct: 6992 E----DYAQYSCLIENEAGQDICEALVSVLE----PPYFIEPL-EHVEAVIGEPATLQCK 7042

Query: 4182 ISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVE 4241
            + G P+  ++W++    L+    ++ +  N    L I  V+  D G+Y C A+N+ GAV 
Sbjct: 7043 VDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVA 7102

Query: 4242 SVSDLTVE 4249
            S + L ++
Sbjct: 7103 SSAVLVIK 7110



 Score = 63.2 bits (152), Expect = 7e-09
 Identities = 38/137 (27%), Positives = 68/137 (49%), Gaps = 8/137 (5%)

Query: 64    KLTIPAVTKANSGRYSLKATNGSG------QATSTAELLVKAETAPPNFVQRLQSMTVRQ 117
             + TI  + +A    + + A N +G       A S    L   E   P   + ++ +T + 
Sbjct: 30489 QFTIGGLLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGEA--PGIRKEMKDVTTKL 30546

Query: 118   GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVN 177
             G   +L  ++ G P P +K+YR G E+  S  +++S +G  ++L +     ED G Y+  
Sbjct: 30547 GEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCI 30606

Query: 178   ATNSVGRATSTAELLVQ 194
             ATN VG   ++++LL+Q
Sbjct: 30607 ATNEVGEVETSSKLLLQ 30623



 Score = 62.8 bits (151), Expect = 9e-09
 Identities = 57/270 (21%), Positives = 102/270 (37%), Gaps = 56/270 (20%)

Query: 5381  RFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKI 5440
             R ++P+ D ++ E  + VF C V      + KW++    I  D+ KY+I ++   +TL+I
Sbjct: 12641 RIVVPLKDTRVKEQQEVVFNCEV-NTEGAKAKWFRNEEAIF-DSSKYIILQKDLVYTLRI 12698

Query: 5441  RNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVI--------AKKSKVTLSSLME 5492
             R+  L D A Y     N  GE +      + + E   ++         +K  VT    + 
Sbjct: 12699 RDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVN 12758

Query: 5493  EL-------------------------------------------VLKSNYTDSFFEFQV 5509
              L                                           ++ +    S  E  +
Sbjct: 12759 RLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLI 12818

Query: 5510  VEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGK-LVQGRRFTVEESGTGF 5568
             +E P  F++ + D        A F C +    +  V WY++G+ + +G+++  E+ G+  
Sbjct: 12819 IEAPTEFVEHLEDQTVTEFDDAVFSCQL-SREKANVKWYRNGREIKEGKKYKFEKDGS-I 12876

Query: 5569  HNLFITSLVKSDEGEYRCVATNKSGMAESF 5598
             H L I      DE EY C   ++   A  F
Sbjct: 12877 HRLIIKDCRLDDECEYACGVEDRKSRARLF 12906



 Score = 62.8 bits (151), Expect = 9e-09
 Identities = 53/215 (24%), Positives = 94/215 (43%), Gaps = 8/215 (3%)

Query: 4     QAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA 63
             +AP   + ++ V    G  A     I G P+P++ W+R G+ +  S    +    SDGR 
Sbjct: 30531 EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMS---SDGRT 30587

Query: 64    -KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
               LT+    + + G Y+  ATN  G+  ++++LL++A           +      GS +R
Sbjct: 30588 HTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLR 30647

Query: 123   LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPE-DSGTYSVNATNS 181
             L V   G P P + ++     +Q+S +  I        L++     +  +G Y V  +N 
Sbjct: 30648 LHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNV 30707

Query: 182   VGRATSTAELLVQGEEEVPAKKTKTIVSTAQISES 216
              G   +  ++ +Q   + P K T  IV  A +  S
Sbjct: 30708 FGTVDAILDVEIQ---DKPDKPTGPIVIEALLKNS 30739



 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 51/180 (28%), Positives = 76/180 (42%), Gaps = 13/180 (7%)

Query: 1214  YEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEE 1273
             Y  EY +      KK  K+ +      +D++F I    E    E E+R+     E  L  
Sbjct: 30465 YWVEYRQSGDSAWKKSNKERI------KDKQFTIGGLLEAT--EYEFRVFAEN-ETGLSR 30515

Query: 1274  DGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKH 1333
                  M++    +     G    +K+     G      C++ G PLP I WY+ GK +  
Sbjct: 30516 PRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQ 30575

Query: 1334  GERYQMDFLQDGRA-SLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTY 1392
               +Y+M    DGR  +L +     EDEG+YT  A+N  G    S KL ++ A P   P Y
Sbjct: 30576 SRKYKMS--SDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQ-ATPQFHPGY 30632



 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 65/324 (20%), Positives = 135/324 (41%), Gaps = 42/324 (12%)

Query: 3943 PPSFLQEIESQEVY-EGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSIL 4001
            PP F++++E+ +V  +G+S    C   G P+  V+W+ ND  +  +  + +  + + ++L
Sbjct: 6363 PPKFVKKLEASKVAKQGESIQLECKISGSPEIKVSWFRNDSELHESWKYNMSFINSVALL 6422

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
            T++    ++ G   C   N  G    ++ L VKA      K   V               
Sbjct: 6423 TINEASAEDSGDYICEAHNGVGDASCSTALTVKAPPVFTQKPSPVGAL------------ 6470

Query: 4062 VFDQAKGAHPSMSQEGQTNLHLLKTNPP--VPPSGDTELLSFPVEIQVTAA---TPIPEQ 4116
                 KG+   +  E       +   PP  V    D + +    + ++T+    T +   
Sbjct: 6471 -----KGSDVILQCE-------ISGTPPFEVVWVKDRKQVRNSKKFKITSKHFDTSLHIL 6518

Query: 4117 DKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSI 4176
            + E+ +V +        +  D  + S K +         EPP+ ++++        GD++
Sbjct: 6519 NLEASDVGEYHCKATNEVGSDTCSCSVKFK---------EPPRFVKKL-SDTSTLIGDAV 6568

Query: 4177 ILECLISGEPQPVVTWFQN-GVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAEN 4235
             L  ++ G     V W ++ G ++++++  +   ++    L +    + +SGKY C  +N
Sbjct: 6569 ELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATLQLGSPEASNSGKYICQIKN 6628

Query: 4236 NSGAVESVSDLTV-EPVTYRENSQ 4258
            ++G  E  + LTV EP    E  +
Sbjct: 6629 DAGMRECSAVLTVLEPARIIEKPE 6652



 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 82/358 (22%), Positives = 136/358 (37%), Gaps = 50/358 (13%)

Query: 1854  EGETARFRCRVTGYPQP-KVNWYLNGQLIRKSKRFRVRY-DGIHYLDIVDCKSYDTGEVK 1911
             EG   ++ C++  Y Q  +V WY   + +  S+++ + Y DG+  L + D    D G  +
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYR 31640

Query: 1912  VTAENPEGVIEHKVKLEIQQ---------REDFRSVLRRAPEPR-----PEFHVHEPGKL 1957
                 N  G      +L ++          R   + + RR    R     PEF +    K 
Sbjct: 31641 CKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKT 31700

Query: 1958  QFEVQKVDRPVDTTETKE--VVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITA 2015
              +  + V   V  T   E  V   K  ++I     P ++++   K+   +++G Y+    
Sbjct: 31701 AYVGENVRFGVTITVHPEPHVTWYKSGQKIK----PGDNDK---KYTFESDKGLYQL--T 31751

Query: 2016  VELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSM 2075
             +   +   D  Y  + R           +  E+  KA     K+T+    P     + S 
Sbjct: 31752 INSVTTDDDAEYTVVARN----------KYGEDSCKA-----KLTVTLHPPP----TDST 31792

Query: 2076  EAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCE 2135
               P     + +    +G    F +RV G P P  +W K+G  +     I       +   
Sbjct: 31793 LRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYA 31852

Query: 2136  LVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ----AKQLITFTQELQDVVAKEKD 2189
             L IRD   ED+    V A N AG TS  A L V+     KQ     +E +  V K+ D
Sbjct: 31853 LHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQKQID 31910



 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 69/319 (21%), Positives = 119/319 (37%), Gaps = 44/319 (13%)

Query: 1095  EGGSVVFGCQVGG-NPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGE 1153
             EGG V + C++   +    V W      L    +Y+++Y  + G   L +      D G 
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITY--EDGVAILYVKDITKLDDGT 31638

Query: 1154  YTIVVRNKHGETSASASLLEEADYELL----MKSQQEMLYQTQVTAFVQEPKVGETAPGF 1209
             Y   V N +GE S+ A L  +   E+      ++ +++  +T     ++ P      P F
Sbjct: 31639 YRCKVVNDYGEDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERP------PEF 31692

Query: 1210  VYSEYEKEYEKEQALIRKKMAKDTVV-------VRTYVEDQEFHISSFEERLIKEIEYRI 1262
                 Y K      A + + +     +       V  Y   Q+      +++   E +  +
Sbjct: 31693 TLPLYNKT-----AYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGL 31747

Query: 1263  IKTTLEELLEEDGEE----------------KMAVDISE---SEAVESGFDSRIKNYRIL 1303
              + T+  +  +D  E                K+ V +        +   F   + N    
Sbjct: 31748 YQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQ 31807

Query: 1304  EGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYT 1363
             EG  V F  ++SG P P + W KDG+ +  G   ++        +L I   LPED G Y 
Sbjct: 31808 EGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYR 31867

Query: 1364  AFASNIKGNAICSGKLYVE 1382
               A+N  G+  C   L VE
Sbjct: 31868 VTATNTAGSTSCQAHLQVE 31886



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 57/233 (24%), Positives = 93/233 (39%), Gaps = 23/233 (9%)

Query: 5372 DLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISE 5431
            D E+   PP  I P+ D    E   A F+C V G    +V WY +   I+P    + +++
Sbjct: 3337 DQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRF-FRMTQ 3394

Query: 5432 EKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLM 5491
             + ++ L+I      D  TY   A N VG+      L++   E              S++
Sbjct: 3395 FEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPE--------------SIL 3440

Query: 5492 EELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDG 5551
             E +      +   E ++ +  P   + I      +G  A F C ++ +P     W+K G
Sbjct: 3441 HERI------EQEIEMEM-KAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAG 3493

Query: 5552 KLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT 5604
            + +         S     +L I      D GEY C A+N+ G     A LT+T
Sbjct: 3494 REIYESDKCSIRSSKYISSLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVT 3546



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 68/317 (21%), Positives = 123/317 (38%), Gaps = 32/317 (10%)

Query: 3943 PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPR-NQNFIIHSLENYSIL 4001
            PP F++++       GD+       +G+    V W  +   + R ++N  I  ++N + L
Sbjct: 6550 PPRFVKKLSDTSTLIGDAVELRAIVEGFQPISVVWLKDRGEVIRESENTRISFIDNIATL 6609

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
             L S    N G   C + N  G  + +++L V    +              +++ E + +
Sbjct: 6610 QLGSPEASNSGKYICQIKNDAGMRECSAVLTVLEPAR-------------IIEKPEPMTV 6656

Query: 4062 VFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESK 4121
                       ++   + +    K    +       +      I   A+  IP  +   K
Sbjct: 6657 TTGNPFALECVVTGTPELSAKWFKDGRELSADSKHHITF----INKVASLKIPCAEMSDK 6712

Query: 4122 EVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILECL 4181
             ++  E           V+     R V        PP  ++++ K      G S++LEC 
Sbjct: 6713 GLYSFEVKNSVGKSNCTVSVHVSDRIV--------PPSFIRKL-KDVNAILGASVVLECR 6763

Query: 4182 ISGEPQPVVTWFQNGVLLKQNQKFQ--FEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGA 4239
            +SG     V WFQ+G  +    K Q  F E  C+  L +  +   D+G Y CVA N +G+
Sbjct: 6764 VSGSAPISVGWFQDGNEIVSGPKCQSSFSENVCTLNLSL--LEPSDTGIYTCVAANVAGS 6821

Query: 4240 VESVSDLTV-EPVTYRE 4255
             E  + LTV EP ++ +
Sbjct: 6822 DECSAVLTVQEPPSFEQ 6838



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 74/288 (25%), Positives = 117/288 (40%), Gaps = 48/288 (16%)

Query: 2197  ETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKT 2256
             E  +   +V WY    ++   +KY +  +  V  L +  I   D   Y C +V D    +
Sbjct: 31592 ENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDS 31651

Query: 2257  T-AKLIVEGA----------VVEFVKELQD----IEVPE----------SYSGE-----L 2286
             + A+L V+G            ++ +K   D    +E P           +Y GE     +
Sbjct: 31652 SYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGV 31711

Query: 2287  ECIVSPENIEGKWYHNDVELK---SNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGK 2343
                V PE     WY +  ++K   ++ KYT  S +G   LT+  VT +D  EY+ V   K
Sbjct: 31712 TITVHPEP-HVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNK 31770

Query: 2344  --KTTCKLK----MKPRPI------AILQGLSDQKVCEGDIVQLEVKVS-LESVEGVWMK 2390
               + +CK K    + P P          + L++ +  EG  V  E++VS +      W K
Sbjct: 31771 YGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEK 31830

Query: 2391  DGQEVQPSDRVHIVIDKQSHMLL-IEDMTKEDAGNYSFTIPALGLSTS 2437
             DGQ +     + I+ +   +  L I D   ED G Y  T      STS
Sbjct: 31831 DGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTS 31878



 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 31/92 (33%), Positives = 52/92 (56%), Gaps = 1/92 (1%)

Query: 3345  PAIITPLQDTVTSEGQPARFQCRVSGTDLK-VSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403
             P I   ++D  T  G+ A+  C++ G  L  + WY   K++  SR ++M+    T+ L +
Sbjct: 30533 PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTV 30592

Query: 3404  AEAYPEDEGTYTFVASNAVGQVSSTANLSLEA 3435
                  EDEG YT +A+N VG+V +++ L L+A
Sbjct: 30593 MTEEQEDEGVYTCIATNEVGEVETSSKLLLQA 30624



 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 88/448 (19%), Positives = 164/448 (36%), Gaps = 61/448 (13%)

Query: 3814 VKESLPKDHLYGEILVNENTQARGQLEEIMANTTIGESSTYITNVCEKEEVY------ET 3867
            ++ +  KD    +IL+ E      QLE +    ++G+S++    +    E+       +T
Sbjct: 7942 IENASGKDSCSAQILILEPPYFVKQLEPV--KVSVGDSASLQCQLAGTPEIGVSWYKGDT 7999

Query: 3868 PENVSQAITPHASESFGTLVNVEESEEIASERIKKDDLRELQLSASTRIDEFKTEQKEEN 3927
                +     H   +  TLV  +     + E I K +    ++SAST    F T Q+   
Sbjct: 8000 KLRPTTTYKMHFRNNVATLVFNQVDINDSGEYICKAENSVGEVSAST----FLTVQE--- 8052

Query: 3928 MRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRN 3987
                        Q+ PPSF +++   +   G    F C   G     V+WY +  P+  +
Sbjct: 8053 ------------QKLPPSFSRQLRDVQETVGLPVVFDCAISGSEPISVSWYKDGKPLKDS 8100

Query: 3988 QNFIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVP 4047
             N     L+N + L +        G  +C   N  G+  +++ L         +   K P
Sbjct: 8101 PNVQTSFLDNTATLNIFKTDRSLAGQYSCTATNPIGSASSSARL--------ILTEGKNP 8152

Query: 4048 VFHDYLDEEEELALVFDQAKGAHPSMSQEGQTNLHLLKTNP-PVPPSGDTELLSFPVEIQ 4106
             F D       LA V D   G      +      H+  T P  V  + D+  +    + Q
Sbjct: 8153 PFFDI-----RLAPV-DAVVG------ESADFECHVTGTQPIKVSWAKDSREIRSGGKYQ 8200

Query: 4107 V-----TAATPIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKML 4161
            +     +A   + + DK     +    +            + K R +        PP   
Sbjct: 8201 ISYLENSAHLTVLKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLI--------PPSFT 8252

Query: 4162 QEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDV 4221
            + + +     EG+S  LE  ++G     V W++N + ++     +    N +  L ++  
Sbjct: 8253 KRLSETVEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFKNNTLVLQVRKA 8312

Query: 4222 NSQDSGKYKCVAENNSGAVESVSDLTVE 4249
               D+G Y C   N++G+    S + ++
Sbjct: 8313 GMNDAGLYTCKVSNDAGSALCTSSIVIK 8340



 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 145/697 (20%), Positives = 288/697 (41%), Gaps = 99/697 (14%)

Query: 2705  EAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSL 2764
             EA  I+K +K++T    + A  + ++    +  ++W + G  L  + KY +S  G  ++L
Sbjct: 30531 EAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTL 30590

Query: 2765  RIKNCAIVDESVYGF----RLGRLGASARLHVETVKIIK-----KPKDVTALENATVAFE 2815
              +      DE VY       +G +  S++L ++           K K   A+ +      
Sbjct: 30591 TVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHV 30650

Query: 2816  VSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNIS-PSDAGEY----TAVVGQ 2870
             + +      + WFH    ++ S+   + +      L+++N+   + AG+Y    + V G 
Sbjct: 30651 MYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGT 30710

Query: 2871  LECKAKLFVE--------TLHITKTMKNIEVPETKTASFE--CEVSHFNVPSMWLKNGVE 2920
             ++    + ++         + I   +KN  V   K  + +    ++++ V     K G E
Sbjct: 30711 VDAILDVEIQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAE 30770

Query: 2921  IEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQ--VSATLTVTP-IMITSMLKD 2977
              ++      V   ++  L      TE++  Y  V   +   +S  L V+  ++I S  + 
Sbjct: 30771 WQLVSSAISVTTCRIVNL------TENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEK 30824

Query: 2978  INAEEKDTITFEVTV-------------------NY-----EGISYKWLK-NGVEIKST- 3011
               A  K TIT  VT                    NY     E    KW+     EI+ T 
Sbjct: 30825 PGAPGKPTIT-AVTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETV 30883

Query: 3012  DKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLE 3071
                +   + L +   ++  + G  ++++ ++   T  + + ++A H  F++ ++++ V  
Sbjct: 30884 FSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVPIQAPH--FKEELRNLNVRY 30941

Query: 3072  KKRAMFECEVS-EPDITVQWMKDDQELQITDRIKIQKEKY---VHRLLIPSTRMSDAGKY 3127
             +  A   C+V+  P   V+W +  +E+ I D +K + +++    H+L+I S    DA  Y
Sbjct: 30942 QSNATLVCKVTGHPKPIVKWYRQGKEI-IADGLKYRIQEFKGGYHQLIIASVTDDDATVY 31000

Query: 3128  TVVA---GGNVS-TAKLFVE-GRDVRIRSIKKEVQVIEKQRA-VVEFEV---NEDDVDAH 3178
              V A   GG+VS TA L VE    + +    + +  +   R  VV  ++    + D    
Sbjct: 31001 QVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVIT 31060

Query: 3179  WYK--DGIEINFQVQERHKYVVERRIHRM-FISETRQSDAGEYTFVA----GRNRSSVTL 3231
             W K  D I+ N      ++ +V R    + F +   + DAG Y   A    G ++ +V L
Sbjct: 31061 WQKGQDLIDNN----GHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNRFGIDQKTVEL 31116

Query: 3232  YV-NAPEPPQVLQ----ELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCK 3286
              V + P+PP+ ++        V +   +PA            KI+ Y  E+  +T  +  
Sbjct: 31117 DVADVPDPPRGVKVSDVSRDSVNLTWTEPA-------SDGGSKITNYIVEKCATTAERWL 31169

Query: 3287  FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTS 3323
              +   +E    +I  F + +  +   A+N +G++  S
Sbjct: 31170 RVGQARETRYTVINLFGKTSYQFRVIAENKFGLSKPS 31206



 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 2/91 (2%)

Query: 5514  PRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGK-LVQGRRFTVEESGTGFHNLF 5572
             P   K + D    +G AA   C + G P P + WY+ GK L+Q R++ +   G   H L 
Sbjct: 30533 PGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRT-HTLT 30591

Query: 5573  ITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
             + +  + DEG Y C+ATN+ G  E+ + L L
Sbjct: 30592 VMTEEQEDEGVYTCIATNEVGEVETSSKLLL 30622



 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 107/460 (23%), Positives = 172/460 (37%), Gaps = 63/460 (13%)

Query: 1527  EWTVVAQNRAGRSSIS----VILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGN 1582
             E+ V AQN+ G    +     I   E +E     +     K V ++ G  + +     G 
Sbjct: 18574 EFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGR 18633

Query: 1583  PNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTR 1642
             P P + W K   + + +   K +++     A L I ++   DS  Y+ T +N AG     
Sbjct: 18634 PAPKVTWRK---VGIDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVF 18690

Query: 1643  CKVNVEVEFAEPEPERKLIIPRGTYRAKEI--AAPELEPLHLRYGQEQWEEGDLYDKEKQ 1700
               V V      P P   L +   T  +  +  A PE +      G  Q     +  +E  
Sbjct: 18691 VNVRV---LDTPGPVSDLKVSDVTKTSCHVSWAPPEND------GGSQVTHYIVEKREAD 18741

Query: 1701  QKPFF----KKKLTSLRLKRFGPAH-FECRLTPI-----GDPTMVVEWLHDGKPLEAANR 1750
             +K +     + K TS  +    P + +  R+T +     G PT V + +    PL   + 
Sbjct: 18742 RKTWSTVTPEVKKTSFHVTNLVPGNEYYFRVTAVNEYGPGVPTDVPKPVLASDPLSEPDP 18801

Query: 1751  LRMINEFGYCSLDYGVAY--------SRDSGIITCRATNKYGTDHTSATLIVKDEKSLVE 1802
              R +           +A+        ++  G IT     +   D  +   +VKD   +V 
Sbjct: 18802 PRKLEVTEMTKNSATLAWLPPLRDGGAKIDGYITSYREEEQPADRWTEYSVVKDLSLVV- 18860

Query: 1803  ESQLPEGRKGLQRIE-------ELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEG 1855
              + L EG+K   R+         L R A EG       + KE+  P  +L PE + +  G
Sbjct: 18861 -TGLKEGKKYKFRVAARNAVGVSLPREA-EGVY-----EAKEQLLPPKILMPEQITIKAG 18913

Query: 1856  ETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTA 1914
             +  R    V G P P   W      +  S    V + D    L I D    D+G   +TA
Sbjct: 18914 KKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTA 18973

Query: 1915  ENPEGVIEHKVKLEIQQREDFRSVLRRAP-EPRPEFHVHE 1953
             EN  G    K+K+          V+  AP  P+P F + +
Sbjct: 18974 ENSSGTDTQKIKV----------VVMDAPGPPQPPFDISD 19003



 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 42/157 (26%), Positives = 76/157 (48%), Gaps = 19/157 (12%)

Query: 897   EVKKEVGVSITGTTVREERFEV---LHGREAKV----------TETARVPAPV----EIP 939
             E K+   +S+T   +RE  F V   + G E +           +E + +  P+    ++P
Sbjct: 30865 EKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEWSEISEPITPKSDVP 30924

Query: 940   VTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ-IESSIDFQI-TFQSGI 997
             +  P     L+N+ V    + TL C ++G+P P V WYR+  + I   + ++I  F+ G 
Sbjct: 30925 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGY 30984

Query: 998   ARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 1034
              +L+I     +D+  +   A N+ G+VS +  L V+V
Sbjct: 30985 HQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEV 31021



 Score = 60.1 bits (144), Expect = 6e-08
 Identities = 39/138 (28%), Positives = 62/138 (44%), Gaps = 12/138 (8%)

Query: 3504 PSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSS 3563
            P+FTQ L    VLEG    F   +   P PE++WF + + I T    +   +       +
Sbjct: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTS--TLPGVQISFSDGRA 63

Query: 3564 SLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLKRAERTHENVEAL 3623
             L I  V   +SG Y L A N  G A STA LLV  +     ++          + ++++
Sbjct: 64   KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFV----------QRLQSM 113

Query: 3624 VERGEDRIKVDLRFTGSP 3641
              R   ++++ +R TG P
Sbjct: 114  TVRQGSQVRLQVRVTGIP 131



 Score = 60.1 bits (144), Expect = 6e-08
 Identities = 41/166 (24%), Positives = 73/166 (43%), Gaps = 5/166 (3%)

Query: 1491  FHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV 1550
             + + +Q  + +T   V+K+    SL++         ++ V A+N  G S       V   
Sbjct: 18837 YREEEQPADRWTEYSVVKD---LSLVVTGLKEGKKYKFRVAARNAVGVSLPREAEGVYEA 18893

Query: 1551  EHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTK 1610
             + Q+ P  +   + + IK G +L ++    G P+P   W K  D +V   +  + +    
Sbjct: 18894 KEQLLPPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSH--LAVHKAD 18951

Query: 1611  GEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEP 1656
               + L I     +DS +Y+ TA N +G DT + KV V      P+P
Sbjct: 18952 SSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQP 18997



 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 73/326 (22%), Positives = 120/326 (36%), Gaps = 35/326 (10%)

Query: 3943 PPSFLQEIESQEVYE-GDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSIL 4001
            PP F+++     V   G S  F C   G P+  V+WY +   I   Q   I  ++  +  
Sbjct: 4860 PPQFIKKPSPVLVLRNGQSTTFECQITGTPKIRVSWYLDGNEITAIQKHGISFIDGLATF 4919

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELAL 4061
             +S    +N G+  C   N  GT   +  LKVK       +   V V   Y D E E   
Sbjct: 4920 QISGARVENSGTYVCEARNDAGTASCSIELKVKEPPTFIRELKPVEVVK-YSDVELEC-- 4976

Query: 4062 VFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESK 4121
               +  G  P         +  LK N  +  S    L                  D+ S 
Sbjct: 4977 ---EVTGTPPF-------EVTWLKNNREIRSSKKYTLT-----------------DRVSV 5009

Query: 4122 EVFQTEELEPKAMPQDQVTQSPKHRFVFLSD--ITNEPPKMLQEMPKHARCREGDSIILE 4179
                  + +P    + Q   S +      S      EPP  ++++       +  S   +
Sbjct: 5010 FNLHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKS-SATFQ 5068

Query: 4180 CLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGA 4239
              ++G P   +TW ++  +L ++       V+    L I+ V++  SG+Y C A+N SG 
Sbjct: 5069 STVAGSPPISITWLKDDQILDEDDNVYISFVDSVATLQIRSVDNGHSGRYTCQAKNESGV 5128

Query: 4240 VESVSDLTV-EPVTYRENSQFENIGE 4264
                + L V EP    E ++  ++ E
Sbjct: 5129 ERCYAFLLVQEPAQIVEKAKSVDVTE 5154



 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 119/580 (20%), Positives = 221/580 (38%), Gaps = 88/580 (15%)

Query: 101   TAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYS 160
             T     + + +SMTV +G   R      G P P V + R G  + +S   Q++      +
Sbjct: 32558 TLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKST 32617

Query: 161   LLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTR 220
               I+     D G YSV   NS G+  +   L +Q      A+ T+  V++    +S + R
Sbjct: 32618 FEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQ-----KARVTEKAVTSPPRVKSPEPR 32672

Query: 221   IEKKIEAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ 280
             + K  EA    + + + E                   P  PK+ SPT            +
Sbjct: 32673 V-KSPEAVKSPKRVKSPE-------------------PSHPKAVSPT------------E 32700

Query: 281   QSPSP---IRHSPSPVRHVRAPTPSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVAT 337
               P+P   ++H P     V AP P   + +   A    + +  V    ++R  + +    
Sbjct: 32701 TKPTPTEKVQHLP-----VSAP-PKITQFLKAEASKEIAKLTCVVESSVLRAKEVTWYKD 32754

Query: 338   GPEVPPPWKQEGYVASSSEAEMRETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAAS 397
             G ++      + + ++    E++   LT S Q        G Y  +    ISG  G + +
Sbjct: 32755 GKKLKENGHFQFHYSADGTYELKINNLTESDQ--------GEYVCE----ISGEGGTSKT 32802

Query: 398   VSASASYAAEAVATGAKEVKQ--DADKSAAVATVVAAVDMARVREP------VISAVEQT 449
                    A +++     ++ +   +D+    +TV    +  +  EP      +++ ++ T
Sbjct: 32803 NLQFMGQAFKSIHEKVSKISETKKSDQKTTESTVTRKTE-PKAPEPISSKPVIVTGLQDT 32861

Query: 450   AQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVAADKAKEQELKSR-TKEVITTKQEQMHV 508
                + + A     A  + R  A  T   K +    K K  E K     E+  T      +
Sbjct: 32862 TVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQGGKYKLSEDKGGFFLEIHKTDTSDSGL 32921

Query: 509   THEQIRKETEKTFVP-KVVISAAK---AKEQETRISEEITKKQKQVTQEAIRQETEITAA 564
                 ++          K+ I A K   A++  T+ + EIT ++K V QE I Q+     +
Sbjct: 32922 YTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQEEISQKA--LRS 32979

Query: 565   SMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEKIMKETRKTVVPKVIVATPKVKEQD 624
               + ++ AKS         QE+   +++   +   + +K++  T + K IV     +E  
Sbjct: 32980 EEIKMSEAKS---------QEKLALKEEASKVLISEEVKKSAATSLEKSIVH----EEIT 33026

Query: 625   LVSRGREGITTKREQVQITQEKMRKEAEKTAL-STIAVAT 663
               S+  E + T  E    + +    E ++  L + IA AT
Sbjct: 33027 KTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAGAT 33066



 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 8/172 (4%)

Query: 4150  LSDITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEE 4209
             LS   ++ P  + + P+     EG +++  C ISGEP P + WF+N + +  +       
Sbjct: 33126 LSKELSDAPAFISQ-PRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISR 33184

Query: 4210  VNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPVTYRENSQ--FENIGE--I 4265
                 + L I++ +  DSGKY   A+N  G   + + L V P+    + +      G+  +
Sbjct: 33185 SRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSL 33244

Query: 4266  YGKYSRDQQLQDQGESVRAHFYDYPAGPFTPWTNVKEYSVRDYFQSLETIEQ 4317
              G +S  Q +Q       A F  + +   +  T +K  S+    QS+ ++++
Sbjct: 33245 QGSFS-SQSVQMSASKQEASFSSFSSSSASSMTEMKFASMS--AQSMSSMQE 33293



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 99/480 (20%), Positives = 173/480 (36%), Gaps = 88/480 (18%)

Query: 3179  WYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYV----- 3233
             W K+G +I+    +R           + I E  + D+G Y  V         +Y+     
Sbjct: 30170 WTKEGQDIS----KRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRVI 30225

Query: 3234  ---NAPEPPQVLQELQPVTVQ--------SGKPARFCAVISGRPQPKISWYK-EEQLLST 3281
                N+PE P    ++Q  +V+         G       ++  R  PK +WY  + ++  T
Sbjct: 30226 GSPNSPEGPLEYDDIQVRSVRVSWRPPADDGGADILGYILERREVPKAAWYTIDSRVRGT 30285

Query: 3282  GFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMP 3341
                 K L +  EY              +   A+N +G++    S     P+      E P
Sbjct: 30286 SLVVKGLKENVEYH-------------FRVSAENQFGISKPLKSEEPVTPKTPLNPPEPP 30332

Query: 3342  VYPPAIITPLQDTVTSEGQPARFQ--CRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTY 3399
               PP ++   + +V+      +     RV+G  ++    S DK ++ ++    TQ   T 
Sbjct: 30333 SNPPEVLDVTKSSVSLSWSRPKDDGGSRVTGYYIERKETSTDKWVRHNK----TQITTT- 30387

Query: 3400  QLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEM------- 3452
                +    P+ E  +  +A N VG +S T+  S         ++  Q  E+E+       
Sbjct: 30388 MYTVTGLVPDAEYQFRIIAQNDVG-LSETSPASEPVVCKDPFDKPSQPGELEILSISKDS 30446

Query: 3453  -------------KELFSEGESEHSERDTRDAFSDSEDIDHKS------MAAKRYASRIS 3493
                          KE+           D+    S+ E I  K       + A  Y  R+ 
Sbjct: 30447 VTLQWEKPECDGGKEILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVF 30506

Query: 3494  STS----SWPEYFKPSFTQKLT----------FKYVLE--GEPVVFTCRLIACPTPEMTW 3537
             + +    S P     S   KLT           K V    GE    +C+++  P P++ W
Sbjct: 30507 AENETGLSRPRRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKW 30566

Query: 3538  FHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLV 3597
             +   + +     R  K  SD   H  +L +   +  D G Y  +A N  G  E+++ LL+
Sbjct: 30567 YRFGKELIQS--RKYKMSSDGRTH--TLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLL 30622



 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 63/253 (24%), Positives = 97/253 (38%), Gaps = 17/253 (6%)

Query: 1762  LDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELER 1821
             L Y V Y R SG    + +NK        T+    E +  E     E   GL R      
Sbjct: 30463 LGYWVEY-RQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRVFAENETGLSRPRR--- 30518

Query: 1822  MAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLI 1881
                      + T     + P I    + V    GE A+  C++ G P P + WY  G+ +
Sbjct: 30519 -----TAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKEL 30573

Query: 1882  RKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLR 1940
              +S+++++  DG  H L ++  +  D G     A N  G +E   KL +Q    F     
Sbjct: 30574 IQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQATPQF----- 30628

Query: 1941  RAPEPRPEFHVHEPGK-LQFEVQKVDRPVDTTETKEVVK-LKRAERITHEKVPEESEELR 1998
                 P  E +    G  L+  V  + RPV         K L+ +E IT E     +  + 
Sbjct: 30629 HPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVM 30688

Query: 1999  SKFKRRTEEGYYE 2011
                +R+T  G Y+
Sbjct: 30689 KNVQRKTHAGKYK 30701



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 91/416 (21%), Positives = 144/416 (34%), Gaps = 64/416 (15%)

Query: 5188 PLTKRKVYE-NTTLG----FIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEI 5242
            P+ KRK+      LG    F  E++  P    +W++    +   ++  +     + SLEI
Sbjct: 3456 PVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEI 3515

Query: 5243 SNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSS 5302
               Q  + GEY C A N  G     A + +           P      V +      T +
Sbjct: 3516 LRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPTFLSRPKSLTTFVGKAAKFICTVT 3575

Query: 5303 RTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSR 5362
             TP     V+E  + +KD            + +    H   + +L +           ++
Sbjct: 3576 GTP-----VIET-IWQKDGAALSPSPNW-RISDAENKHILELSNLTIQDRGVYSCKASNK 3628

Query: 5363 EGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEP 5422
             G D   + +L + + P  FI  +   +   N     +C V       V W K+   + P
Sbjct: 3629 FGADI-CQAELIIIDKP-HFIKELEPVQSAINKKVHLECQVDEDRKVTVTWSKDGQKLPP 3686

Query: 5423 DNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKK 5482
                 +  E+K + TL+I    L DS TY C A N  G + C   +T             
Sbjct: 3687 GKDYKICFEDKIA-TLEIPLAKLKDSGTYVCTASNEAGSSSCSATVT------------- 3732

Query: 5483 SKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPI-GTAAYFQCLVRGSP 5541
                                       V  PP F+K +   Y  + G +A   C ++GSP
Sbjct: 3733 ---------------------------VREPPSFVKKVDPSYLMLPGESARLHCKLKGSP 3765

Query: 5542 RPTVYWYKDGKLVQG----RRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
               V W+K+ K +      R + V         L IT +   D G Y C A N  G
Sbjct: 3766 VIQVTWFKNNKELSESNTVRMYFVNSEAI----LDITDVKVEDSGSYSCEAVNDVG 3817



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 38/157 (24%), Positives = 67/157 (42%), Gaps = 2/157 (1%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             + GD+I +E  + G P+P VTW +   +LKQ Q+  FE    S  L I +    DSG Y 
Sbjct: 21078 KAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYP 21137

Query: 4231  CVAENNSGAVESVSDLTVEPVTYRENS--QFENIGEIYGKYSRDQQLQDQGESVRAHFYD 4288
               A N  G V  V  + V  +        +F+ +   +  +S D    D G  +  +  +
Sbjct: 21138 LTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVPISNYVVE 21197

Query: 4289  YPAGPFTPWTNVKEYSVRDYFQSLETIEQIDQKEQVR 4325
                   T W  +    +R  +++      ++ + +V+
Sbjct: 21198 MRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFRVK 21234



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 31/142 (21%), Positives = 68/142 (47%), Gaps = 3/142 (2%)

Query: 67    IPAVTKANSGRYSLKATNGSGQA---TSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
             I  +T+     + + A N  G++   +    ++ K     P+      S +V+ G  +++
Sbjct: 23190 ITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKI 23249

Query: 124   QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
             +V ++G P P + + +DG  ++ +    ++   DL +L I E + +D G Y +   N VG
Sbjct: 23250 EVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVG 23309

Query: 184   RATSTAELLVQGEEEVPAKKTK 205
             + T++ E++   + + P    K
Sbjct: 23310 QKTASIEIVTLDKPDPPKGPVK 23331



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 49/194 (25%), Positives = 85/194 (43%), Gaps = 10/194 (5%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDG-TQSLIIVPATPSDSGEWT 1529
             G+ A+   ++VGRP+P+  W+  G++++    +K  +  DG T +L ++     D G +T
Sbjct: 30547 GEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYK--MSSDGRTHTLTVMTEEQEDEGVYT 30604

Query: 1530  VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1589
              +A N  G    S  L ++A   Q  P +  K K      GS L + V   G P P + W
Sbjct: 30605 CIATNEVGEVETSSKLLLQATP-QFHPGYPLKEKYYG-AVGSTLRLHVMYIGRPVPAMTW 30662

Query: 1590  LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAW-YTATAINKAGRDTTRCKVNVE 1648
                  ++       I IE T+    L + +   +  A  Y     N  G  T    ++VE
Sbjct: 30663 FHGQKLL--QNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFG--TVDAILDVE 30718

Query: 1649  VEFAEPEPERKLII 1662
             ++    +P   ++I
Sbjct: 30719 IQDKPDKPTGPIVI 30732



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 60/221 (27%), Positives = 92/221 (41%), Gaps = 35/221 (15%)

Query: 2023  KDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFE 2082
             +D SY EL  K   E+  +    T ++ K   +  ++         +E  P    P    
Sbjct: 31649 EDSSYAELFVKGVREVYDYYCRRTMKKIKRRTDTMRL---------LERPPEFTLP---- 31695

Query: 2083  RIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIE--RSDRIYWYWPEDNVCELVIRD 2140
              + ++T   G +  F V +   P+P   WYK+G KI+   +D+ Y +  +  + +L I  
Sbjct: 31696 -LYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINS 31754

Query: 2141  VTAEDSASIMVKAINIAGETSSHAFLLVQAKQLIT-------FTQELQDVVAKEKDTMAT 2193
             VT +D A   V A N  GE S  A L V      T       F + L +   +E  ++  
Sbjct: 31755 VTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVC- 31813

Query: 2194  FECETSE-PFVKVKWYKDGME---------VHEG-DKYRMH 2223
             FE   S  P   +KW KDG           +HEG D Y +H
Sbjct: 31814 FEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 31854



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 70/291 (24%), Positives = 117/291 (40%), Gaps = 29/291 (9%)

Query: 5186  IEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNI 5245
             + PL    V    T  F  E+    +P V+WY     LEP +++     G V +L + ++
Sbjct: 12199 LRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDV 12257

Query: 5246  QKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTP 5305
             +  + GE    A +     K+ AN+ +   +E  V    P+  Q V E            
Sbjct: 12258 KLEDAGEVQLTAKDF----KTHANLFV---KEPPVEFTKPLEDQTVEE------------ 12298

Query: 5306  SPQEIVLEVELSEKD--VKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSRE 5363
                  VLE E+S ++  VK F+   +I+   ++       +  L +      D    + +
Sbjct: 12299 -GATAVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCD 12357

Query: 5364  GEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPD 5423
              +D +   +L V      F+ P+ D ++ E   A F+C  +     +VKW+K+   I+  
Sbjct: 12358 AKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECE-LSRENAKVKWFKDGAEIKKG 12416

Query: 5424  NIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSE 5474
               KY I  +     L I    L D A Y C     V  A   G LT+ + E
Sbjct: 12417 K-KYDIISKGAVRILVINKCLLDDEAEYSCE----VRTARTSGMLTVLEEE 12462



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 105/476 (22%), Positives = 170/476 (35%), Gaps = 94/476 (19%)

Query: 5186  IEPLTKRKVYENTTLGFIVEV--EGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEIS 5243
             + PL   +V E   + F  EV  EG      KW+RN+  +    +  + +   V +L I 
Sbjct: 12643 VVPLKDTRVKEQQEVVFNCEVNTEGAKA---KWFRNEEAIFDSSKYIILQKDLVYTLRIR 12699

Query: 5244  NIQKGEGGEYMCHAVNIIGE-AKSFANVDIMPQEERVVALPPPVTHQHVME--------- 5293
             +    +   Y     N  GE  KS AN+ +  ++ R+V    P+     ME         
Sbjct: 12700 DAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVE---PLKDIETMEKKSVTFWCK 12756

Query: 5294  FDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFT-PDHKSMIVSLDVLPF 5352
              +  + T   T + +E+  +  +S +     +K   ++T+ +   PD    IV+      
Sbjct: 12757 VNRLNVTLKWTKNGEEVPFDNRVSYR----VDKYKHMLTIKDCGFPDEGEYIVTA----- 12807

Query: 5353  NFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVK 5412
                        G+DK +  +L + E P  F+  + D  + E  DAVF C  +      VK
Sbjct: 12808 -----------GQDKSVA-ELLIIEAPTEFVEHLEDQTVTEFDDAVFSCQ-LSREKANVK 12854

Query: 5413  WYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFL---- 5468
             WY+    I+ +  KY   ++   H L I++  L D   Y C   +    A  R F+    
Sbjct: 12855 WYRNGREIK-EGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRA--RLFVEEIP 12911

Query: 5469  ------------TMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVV------ 5510
                           G   +F     K KV +  L   +V+             +      
Sbjct: 12912 VEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQIC 12971

Query: 5511  ------EGPPRFIKGISDCYAPIGTAA------YFQCLV-------------RGSPRPTV 5545
                   +G  RFI    +  A +  AA        Q LV                P+   
Sbjct: 12972 DIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEA 13031

Query: 5546  YWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAAL 5601
              W+K+ + +  +        T F    I    K D+G Y+ V  NK G AE F  L
Sbjct: 13032 EWFKENEPLSTKTIDTTAEQTSFR---ILEAKKGDKGRYKIVLQNKHGKAEGFINL 13084



 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 178/888 (20%), Positives = 315/888 (35%), Gaps = 127/888 (14%)

Query: 2388  WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV 2447
             W +D  E    D+  I       +L++ ++ + D+G Y  T+     S S  V+V  +D 
Sbjct: 21894 WARDHGE--SLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRVLDT 21951

Query: 2448  ITPLKDVNVIEGTKAVLECKVSVPDV---TSVKWYLNDEQIKPDDRVQAIVKGTKQRLVI 2504
               P +D+ V E TK  +      P +   + +K Y+ ++  +   R       T      
Sbjct: 21952 PGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEK--RESTRKAYSTVATNCHKTS 22009

Query: 2505  NRTHASDEGP--YKLIVGRVETNCNLSVEKIKIIRG-----------LRDLTCTETQNVV 2551
              +     EG   Y  ++   E    L  E  + ++            L D+T   + ++ 
Sbjct: 22010 WKVDQLQEGCSYYFRVLAENEYGIGLPAETAESVKASERPLPPGKITLMDVT-RNSVSLS 22068

Query: 2552  FEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA-GENM 2610
             +E      G  +L    + + K S K+   A  K+ + T+  +++ +E  +   A  E  
Sbjct: 22069 WEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKG 22128

Query: 2611  TSGKLTVAGGAISKPL-----------TDQTVAESQEAVFECEVANPDSKGEWLRDGKHL 2659
              S    ++   I+K L           T   +A     V    +  P     W +D   L
Sbjct: 22129 ISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPL 22188

Query: 2660  PLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKT---LKNL 2716
               T  + +ES  +   L I     +D+G Y  K+  S   A   +  + + K       +
Sbjct: 22189 KQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPV 22248

Query: 2717  TVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAI--SVKGTIYSLRIKNCAIVDE 2774
              + E      T+    P   G   I N +V + +        V  T+    IK C +   
Sbjct: 22249 KMDEVTADSITLSWGPPKYDGGSSINNYIVEKRDTSTTTWQIVSATVARTTIKACRLKTG 22308

Query: 2775  SVYGFRLG---RLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKS 2831
               Y FR+    R G S  L+ E   + + P  V       V      S D++ V+W    
Sbjct: 22309 CEYQFRIAAENRYGKSTYLNSEPT-VAQYPFKVPGPPGTPVV--TLSSRDSMEVQW---- 22361

Query: 2832  VEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVG-QLECKAKLFVETLHITKTMKN 2890
                                    N   SD G  + V+G  LE K +  +  + + KT   
Sbjct: 22362 -----------------------NEPISDGG--SRVIGYHLERKERNSILWVKLNKT--- 22393

Query: 2891  IEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQ-GKLHQLIIMNTSTEDSA 2949
               +P+TK              +  L+ GVE E     + +V  GK  ++     + +   
Sbjct: 22394 -PIPQTK------------FKTTGLEEGVEYEFRVSAENIVGIGKPSKVSECYVARDP-- 22438

Query: 2950  EYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIK 3009
                  C        + VT   +T   K    +    IT  +    E    +W+K      
Sbjct: 22439 -----CDPPGRPEAIIVTRNSVTLQWKKPTYDGGSKITGYIVEKKELPEGRWMKASFTNI 22493

Query: 3010  STDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATS-TATLYVEARHIEFRKHIKDIK 3068
                  ++      H    R +    A  ++  +    + TA   V+   I      KD  
Sbjct: 22494 IDTHFEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTI 22553

Query: 3069  VLEKKRAM-FECEV-SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGK 3126
             V+    +   + ++  +P  T+QW+K DQEL  T R++I+   +   L +      D+G 
Sbjct: 22554 VVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLSVKDAVRVDSGN 22613

Query: 3127  YTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEK----QRAVVEFEVNEDDVDAHW--- 3179
             Y ++   NV+             RS+   V+V+++    +  VV   V  +     W   
Sbjct: 22614 Y-ILKAKNVAGE-----------RSVTVNVKVLDRPGPPEGPVVISGVTAEKCTLAWKPP 22661

Query: 3180  YKDGIE--INFQVQERHK-----YVVERRIHRMFISETRQSDAGEYTF 3220
              +DG    IN+ V+ R        VV+  +  +    T+  +  EYTF
Sbjct: 22662 LQDGGSDIINYIVERRETSRLVWTVVDANVQTLSCKVTKLLEGNEYTF 22709



 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 89/429 (20%), Positives = 150/429 (34%), Gaps = 78/429 (18%)

Query: 5182 PPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLE 5241
            P +  E      V +       V+  G      KW+++   L    + K+     V  L+
Sbjct: 4578 PATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQELTLGSKYKISVTDTVSILK 4637

Query: 5242 ISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQ-HVME------F 5294
            I + +K + GEY     N +G +   A ++++      + +PP  T +   M+       
Sbjct: 4638 IISTEKKDSGEYTFEVQNDVGRSSCKARINVLD-----LIIPPSFTKKLKKMDSIKGSFI 4692

Query: 5295 DLEHTTSSRTPSPQEIVL---EVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLP 5351
            DLE   +   P   +      E+  SEK    F      + +        S +   D   
Sbjct: 4693 DLECIVAGSHPISIQWFKDDQEISASEKYKFSFHDNTAFLEI--------SQLEGTDSGT 4744

Query: 5352 FNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEV 5411
            +     N          L +     + PP F+       +  N+    K  V G     +
Sbjct: 4745 YTCSATNKAGHNQCSGHLTV-----KEPPYFVEKPQSQDVNPNTRVQLKALVGGTAPMTI 4799

Query: 5412 KWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMG 5471
            KW+K+   +     + V  ++  S +L++     +DS TY C+  N VG A         
Sbjct: 4800 KWFKDNKELHSGAARSVWKDDT-STSLELFAAKATDSGTYICQLSNDVGTAT-------- 4850

Query: 5472 DSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYA-PIGTA 5530
                       SK TL                      V+ PP+FIK  S       G +
Sbjct: 4851 -----------SKATL---------------------FVKEPPQFIKKPSPVLVLRNGQS 4878

Query: 5531 AYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVK----SDEGEYRC 5586
              F+C + G+P+  V WY DG  +      +++ G  F +   T  +      + G Y C
Sbjct: 4879 TTFECQITGTPKIRVSWYLDGNEIT----AIQKHGISFIDGLATFQISGARVENSGTYVC 4934

Query: 5587 VATNKSGMA 5595
             A N +G A
Sbjct: 4935 EARNDAGTA 4943



 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 93/435 (21%), Positives = 167/435 (38%), Gaps = 46/435 (10%)

Query: 3197  VVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQEL---QPVTVQSG 3253
             + E + +++ I        GE   V G  ++   +      PP++  +    + VT+++ 
Sbjct: 21821 LTENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRML-----PPEIELDADLRKVVTIRAC 21875

Query: 3254  KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPE-DAAVYTCE 3312
                R    I GRP P++ W ++            +     YTLL++      D+  Y   
Sbjct: 21876 CTLRLFVPIKGRPAPEVKWARDH---GESLDKASIESTSSYTLLIVGNVNRFDSGKYILT 21932

Query: 3313  AKNDYGVATTSASLSVEVPEVVSPDQEMPV-----------YPPAII---TPLQDTVTSE 3358
              +N  G  + SA ++V V +   P Q++ V           + P ++   + +++ +  +
Sbjct: 21933 VENSSG--SKSAFVNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKIKNYIVEK 21990

Query: 3359  GQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQL----EIAEAYPEDEGT 3413
              +  R       T+  K SW     +   S +FR+   E+ Y +    E AE+    E  
Sbjct: 21991 RESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLPAETAESVKASERP 22049

Query: 3414  YTFVASNAVGQVSSTANLSLEAPESILHERIEQEI-EMEMK--ELFSEGESEHSERDTRD 3470
                     +    ++ +LS E PE     RI   I EM+ K  + ++   +      T  
Sbjct: 22050 LPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTKGSDKWATCATVKVTEATIT 22109

Query: 3471  AFSDSEDIDHKSMAAKRYASRISSTSSWPEYFK-----PSFTQKLTFKYVLEGEPVVFTC 3525
                  E+   +  A            S P   K     P+F        VL GE +    
Sbjct: 22110 GLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDV 22169

Query: 3526  RLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINS 3585
               I  PTP +TW  +N P    L++  +  ++   ++S L IK     D G Y +   NS
Sbjct: 22170 PFIGRPTPAVTWHKDNVP----LKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNS 22225

Query: 3586  EGSAESTASLLVIQK 3600
              G A  T +++V+ K
Sbjct: 22226 AGEAIETLNVIVLDK 22240



 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 68/329 (20%), Positives = 135/329 (41%), Gaps = 45/329 (13%)

Query: 3946 FLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDM-PIPRNQNFIIHSLENYSILTLS 4004
            F+ E +S  V E  +  F+    G P P V W       + +     IH   + + L + 
Sbjct: 8456 FVSEPQSIRVVEKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIR 8515

Query: 4005 SVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKH-----DVKA--HKVPVFHDYLDEEE 4057
                 + G   CV FN++G +++   L+V  ++K      D++A   K P+      EEE
Sbjct: 8516 DTTKTDSGLYRCVAFNEHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGAGEEE 8575

Query: 4058 ELALVFDQAKGAHPSMSQE-----GQTNLH-LLKTNPPVPPSGDTELLSFPVEIQVTAAT 4111
            E+ ++ +  K   P   ++     G T+   LL+    +  S + E     +E       
Sbjct: 8576 EIDIM-ELLKNVDPKEYEKYARMYGITDFRGLLQAFELLKQSQEEETHRLEIE------- 8627

Query: 4112 PIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCR 4171
             I   +++ KE    EEL   +  Q +++Q+             EP  +++++      +
Sbjct: 8628 EIERSERDEKEF---EELV--SFIQQRLSQT-------------EPVTLIKDIENQTVLK 8669

Query: 4172 EGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKC 4231
            + D++    +    P+  ++W++    L+ + KF+       H L +K+   +D G Y+ 
Sbjct: 8670 DNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGDRHTLRVKNCQLKDQGNYRL 8729

Query: 4232 V-----AENNSGAVESVSDLTVEPVTYRE 4255
            V     A      +E   +  ++ VT +E
Sbjct: 8730 VCGPHIASAKLTVIEPAWERHLQDVTLKE 8758



 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 9/134 (6%)

Query: 1521  TPSDSGEW---TVVAQNRAGRSSIS-VILTVEAVEHQVKP---MFVEKLKNVNIKEGSRL 1573
             T  + G+W    V A NR G S  S     ++AV+ Q  P   + V+ L  + +K G+++
Sbjct: 13649 TGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKI 13708

Query: 1574  EMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAI 1633
             E+    TG P P I W K   I+   K  +I IE    ++ + I  +   D+  Y   A+
Sbjct: 13709 ELPATVTGKPEPKITWTKADMILKQDK--RITIENVPKKSTVTIVDSKRSDTGTYIIEAV 13766

Query: 1634  NKAGRDTTRCKVNV 1647
             N  GR T   +VNV
Sbjct: 13767 NVCGRATAVVEVNV 13780



 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 100/437 (22%), Positives = 170/437 (38%), Gaps = 50/437 (11%)

Query: 3197  VVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPA 3256
             + E + +++ +    +   GE T V G  +    L   APE     +  + + V++G  A
Sbjct: 23985 LTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKL--EAPELDLDSELRKGIVVRAGGSA 24042

Query: 3257  RFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIE-AFPEDAAVYTCEAKN 3315
             R      GRP P+I+W +EE   +   +   +  G  YT L I+     DA  Y  + +N
Sbjct: 24043 RIHIPFKGRPTPEITWSREEGEFTDKVQ---IEKGVNYTQLSIDNCDRNDAGKYILKLEN 24099

Query: 3316  DYGVATTSASLSVEVPEVVSPDQEMP-----------VYPPAII---TPLQDTVTSEGQP 3361
               G  + SA ++V+V +   P Q +            V+ P II     +++ V  + + 
Sbjct: 24100 SSG--SKSAFVTVKVLDTPGPPQNLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKRES 24157

Query: 3362  AR-FQCRVSGTDLKVSWYSKDKKIKPSRFFRM---TQFEDTYQLEIAEAY-----PEDEG 3412
              R     VS    K S+  ++       +FR+    +F     +E  +A      P   G
Sbjct: 24158 TRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPG 24217

Query: 3413  TYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDA- 3471
               T      V Q S  A+L  E PE     R+   + +EM+   +E  S  +E    +A 
Sbjct: 24218 KVTL---TDVSQTS--ASLMWEKPEHDGGSRVLGYV-VEMQPKGTEKWSIVAESKVCNAV 24271

Query: 3472  ---FSDSEDIDHKSMAAKRYASRISSTSSWPEYFK-----PSFTQKLTFKYVLEGEPVVF 3523
                 S  ++   +  A              P   K     PS         +  GE +  
Sbjct: 24272 VTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKI 24331

Query: 3524  TCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAI 3583
                +I  P P ++W  +  P    L++  +   +    S+ L IK     D G Y + A 
Sbjct: 24332 EIPVIGRPRPNISWVKDGEP----LKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTAT 24387

Query: 3584  NSEGSAESTASLLVIQK 3600
             NS G+A    S++V++K
Sbjct: 24388 NSAGTATENLSVIVLEK 24404



 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 108/530 (20%), Positives = 189/530 (35%), Gaps = 70/530 (13%)

Query: 5099  PGETL-ERYSTPPGEALERYSIPTGGPNPTGTFKTYPSKIEREDGTP--NEHFYT----- 5150
             PG  L E+Y    G  L  + +  G P P  T+      ++  +     N   YT     
Sbjct: 30630 PGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMK 30689

Query: 5151  --PTEERGSAYEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEG 5208
                 +     Y++  S+ FGT +  ++ +  + P     P+    + +N+    ++  + 
Sbjct: 30690 NVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKPTGPIVIEALLKNSA---VISWKP 30746

Query: 5209  LPVPGVKWYRNKSL--LEPDERIKMERVGNVCSL---EISNIQKGEGGEYMCHAVNIIG- 5262
                 G  W  N  +   E  E  + + V +  S+    I N+ +  G  +   A N  G 
Sbjct: 30747 PADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTENAGYYFRVSAQNTFGI 30806

Query: 5263  -EAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDV 5321
              +    ++V I+         P   T   V +                 +    L +++ 
Sbjct: 30807 SDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPASDGGAKIRNYYLEKREK 30866

Query: 5322  KEFEKQVKIVT--VPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDL----EV 5375
             K+  K + + T  + E     K++I  L+   F     N+   E E  E+   +    +V
Sbjct: 30867 KQ-NKWISVTTEEIRETVFSVKNLIEGLEY-EFRVKCENLGG-ESEWSEISEPITPKSDV 30923

Query: 5376  FEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGS 5435
                 P F   + +  +   S+A   C V G P P VKWY++   I  D +KY I E KG 
Sbjct: 30924 PIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGG 30983

Query: 5436  -HTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEEL 5494
              H L I +V   D+  Y+ RA N       +G    G + +   +  K  +         
Sbjct: 30984 YHQLIIASVTDDDATVYQVRATN-------QGGSVSGTASLEVEVPAKIHL--------- 31027

Query: 5495  VLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLV 5554
                                P+ ++G+   +A  G     +    G P P + W K   L+
Sbjct: 31028 -------------------PKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLI 31068

Query: 5555  QGR---RFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAAL 5601
                   +  V  S T    +F   + + D G Y   A N+ G+ +    L
Sbjct: 31069 DNNGHYQVIVTRSFTSL--VFPNGVERKDAGFYVVCAKNRFGIDQKTVEL 31116



 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 44/166 (26%), Positives = 71/166 (42%), Gaps = 30/166 (18%)

Query: 2111  WYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQA 2170
             WY    ++E S++ Y    ED V  L ++D+T  D  +   K +N  GE SS+A L V+ 
Sbjct: 31602 WYFGVRQLENSEK-YEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVKG 31660

Query: 2171  KQLI--TFTQELQDVVAKEKDTMATFE------------------------CETSEPFVK 2204
              + +   + +     + +  DTM   E                          T  P   
Sbjct: 31661 VREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPH 31720

Query: 2205  VKWYKDGMEVHEGD---KYRMHSDRKVHFLSILTIDTSDAEDYSCV 2247
             V WYK G ++  GD   KY   SD+ ++ L+I ++ T D  +Y+ V
Sbjct: 31721 VTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVV 31766



 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 2     TTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDG 61
             T  A   T+P +S+ V EG +A F     G PVP V+W R GQV+STS     Q++ +  
Sbjct: 32558 TLAARILTKP-RSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARH--QVTTTKY 32614

Query: 62    RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV-------KAETAPP 104
             ++   I +V  ++ G YS+   N  G+  +   L +       KA T+PP
Sbjct: 32615 KSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKAVTSPP 32664



 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 90/390 (23%), Positives = 140/390 (35%), Gaps = 57/390 (14%)

Query: 3941 RCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSI 4000
            +  P   ++IE  EV  G    F C  Q  P     W+     I  +    I S +  S 
Sbjct: 3453 KAAPVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISS 3512

Query: 4001 LTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELA 4060
            L +      + G  TC   N+YG+V  T+ L V             P F   L   + L 
Sbjct: 3513 LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYP--------PTF---LSRPKSLT 3561

Query: 4061 LVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKES 4120
                +A     +++          K    + PS +  +                  D E+
Sbjct: 3562 TFVGKAAKFICTVTGTPVIETIWQKDGAALSPSPNWRI-----------------SDAEN 3604

Query: 4121 KEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITN------EPPKMLQEMPKHARCREGD 4174
            K + +   L      QD+   S K    F +DI        + P  ++E+ +  +     
Sbjct: 3605 KHILELSNLTI----QDRGVYSCKASNKFGADICQAELIIIDKPHFIKEL-EPVQSAINK 3659

Query: 4175 SIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAE 4234
             + LEC +  + +  VTW ++G  L   + ++    +    L I     +DSG Y C A 
Sbjct: 3660 KVHLECQVDEDRKVTVTWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVCTAS 3719

Query: 4235 NNSGAVESVSDLTVEPVTYRENSQFENIGEIYGKYSRDQQLQDQGESVRAH--FYDYPAG 4292
            N +G+    + +TV     RE   F  + ++   Y     L   GES R H      P  
Sbjct: 3720 NEAGSSSCSATVTV-----REPPSF--VKKVDPSY-----LMLPGESARLHCKLKGSPVI 3767

Query: 4293 PFTPWTNVKEYS----VRDYFQSLETIEQI 4318
              T + N KE S    VR YF + E I  I
Sbjct: 3768 QVTWFKNNKELSESNTVRMYFVNSEAILDI 3797



 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 8/146 (5%)

Query: 67    IPAVTKANSGRYSLKATN--GSGQATSTAELLVKAETAPPNF---VQRLQSMTVRQGSQV 121
             +  + +  + R+ +KA N  G G   +T  +  + +  PP+    V+ ++ + V+ G+ V
Sbjct: 17469 VTGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTV 17528

Query: 122   RLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181
             R    + G+P P  K+  DG+EI++   + +  +     L I      D+G Y +  +N+
Sbjct: 17529 RFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 17588

Query: 182   VGRATSTAELLVQGEEEVPAKKTKTI 207
              G  T    L V    +VP   T  I
Sbjct: 17589 AGSKTVAVHLTVL---DVPGPPTGPI 17611



 Score = 57.0 bits (136), Expect = 5e-07
 Identities = 30/96 (31%), Positives = 50/96 (52%), Gaps = 1/96 (1%)

Query: 4154  TNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCS 4213
             + E P + +EM K    + G++  L C I G P P + W++ G  L Q++K++      +
Sbjct: 30529 SGEAPGIRKEM-KDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRT 30587

Query: 4214  HQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVE 4249
             H L +     +D G Y C+A N  G VE+ S L ++
Sbjct: 30588 HTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQ 30623



 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 29/89 (32%), Positives = 46/89 (51%), Gaps = 1/89 (1%)

Query: 4154 TNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCS 4213
            T EPP  + E+ +      GDS+ L+C ++G P+  V+W++    L+   +++    N  
Sbjct: 6075 TLEPPYFVTEL-EPLEAAVGDSVSLQCQVAGTPEITVSWYKGDTKLRPTPEYRTYFTNNV 6133

Query: 4214 HQLYIKDVNSQDSGKYKCVAENNSGAVES 4242
              L    VN  DSG+Y C AEN+ G   S
Sbjct: 6134 ATLVFNKVNINDSGEYTCKAENSIGTASS 6162



 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 54/184 (29%), Positives = 83/184 (45%), Gaps = 13/184 (7%)

Query: 8     FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTI 67
             F  PL+   V EG TATF   +S   +  V WF++   + TS    V IS      KL +
Sbjct: 11576 FMSPLEDQTVKEGETATFVCELSHEKM-HVVWFKNDAKLHTSRT--VLISSEGKTHKLEM 11632

Query: 68    PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRV 127
               VT  +  +   +      + +STA+L  K   A P F  +L   T  +  ++ L+  V
Sbjct: 11633 KEVTLDDISQIKAQVK----ELSSTAQL--KVLEADPYFTVKLHDKTAVEKDEITLKCEV 11686

Query: 128   T-GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRAT 186
             +  +P   VK+++DG EI  S  + I  +G    L I +A  +D G Y  +      +A 
Sbjct: 11687 SKDVP---VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKAN 11743

Query: 187   STAE 190
              T E
Sbjct: 11744 VTVE 11747



 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 57/220 (25%), Positives = 94/220 (42%), Gaps = 30/220 (13%)

Query: 8     FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA-KLT 66
             FT+PL+   V EG+TA  E  +S     +V WF++G  I  S    +    +DGR  KL 
Sbjct: 12287 FTKPLEDQTVEEGATAVLECEVSRENA-KVKWFKNGTEILKSKKYEI---VADGRVRKLV 12342

Query: 67    IPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPN--FVQRLQSMTVRQGSQVRLQ 124
             I   T  +   Y+  A +                  PP+  F++ L  + VR+    R +
Sbjct: 12343 IHDCTPEDIKTYTCDAKDFKTSCN--------LNVVPPHVEFLRPLTDLQVREKEMARFE 12394

Query: 125   VRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGR 184
               ++      VK+++DGAEI+    + I  +G +  L+I +   +D   YS        R
Sbjct: 12395 CELSR-ENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEV-----R 12448

Query: 185   ATSTAELLVQGEEE---------VPAKKTKTIVSTAQISE 215
                T+ +L   EEE         +   +T TI    ++S+
Sbjct: 12449 TARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSK 12488



 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 52/193 (26%), Positives = 81/193 (41%), Gaps = 20/193 (10%)

Query: 1227  KKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISES 1286
             KK  K   V    + +  F + +  E L  E E+R+         E  G E    +ISE 
Sbjct: 30866 KKQNKWISVTTEEIRETVFSVKNLIEGL--EYEFRV-------KCENLGGESEWSEISEP 30916

Query: 1287  EAVESG-------FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKR-IKHGERYQ 1338
                +S        F   ++N  +      T  CK++G+P P + WY+ GK  I  G +Y+
Sbjct: 30917 ITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYR 30976

Query: 1339  MDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEP 1398
             +   + G   L I  V  +D  +Y   A+N  G+   +  L VE  A +  P    TLE 
Sbjct: 30977 IQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLP---KTLEG 31033

Query: 1399  VSRIRSLSPRSVS 1411
             +  + +L    VS
Sbjct: 31034 MGAVHALRGEVVS 31046



 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 52/215 (24%), Positives = 86/215 (40%), Gaps = 32/215 (14%)

Query: 5301 SSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLP--------- 5351
            +++ P+  + +  V + E     FE  +    VPE +      ++S   LP         
Sbjct: 2    TTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDG 61

Query: 5352 ----------------FNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENS 5395
                            ++    N   +     EL +  E    PP F+  +    + + S
Sbjct: 62   RAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAET--APPNFVQRLQSMTVRQGS 119

Query: 5396 DAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRA 5455
                +  V GIPTP VK+Y++   I+  ++ + IS+E   ++L I      DS TY   A
Sbjct: 120  QVRLQVRVTGIPTPVVKFYRDGAEIQ-SSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNA 178

Query: 5456 VNCVGEAICRG-FLTMGDSEIFAVIAKKSKVTLSS 5489
             N VG A      L  G+ E   V AKK+K  +S+
Sbjct: 179  TNSVGRATSTAELLVQGEEE---VPAKKTKTIVST 210



 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 36/144 (25%), Positives = 65/144 (45%), Gaps = 2/144 (1%)

Query: 5136 KIEREDGTPNEHFYTPTEERGSAYEIWRSDSFGTPNEAIE--PKDNEMPPSFIEPLTKRK 5193
            +I   DG         T+     Y +  ++  G      E   K    PP+F++ L    
Sbjct: 55   QISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMT 114

Query: 5194 VYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEY 5253
            V + + +   V V G+P P VK+YR+ + ++     ++ + G++ SL I+     + G Y
Sbjct: 115  VRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTY 174

Query: 5254 MCHAVNIIGEAKSFANVDIMPQEE 5277
              +A N +G A S A + +  +EE
Sbjct: 175  SVNATNSVGRATSTAELLVQGEEE 198



 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 43/129 (33%), Positives = 63/129 (48%), Gaps = 6/129 (4%)

Query: 3504 PSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSS 3563
            P+F Q+L    V +G  V    R+   PTP + ++ +   I + L   I  E DL+    
Sbjct: 104  PNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLY---- 159

Query: 3564 SLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLKRAERTHENVEAL 3623
            SL I      DSG+Y + A NS G A STA LLV  +G++E   +  K    T +  E+ 
Sbjct: 160  SLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV--QGEEEVPAKKTKTIVSTAQISESR 217

Query: 3624 VERGEDRIK 3632
              R E +I+
Sbjct: 218  QTRIEKKIE 226



 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 49/206 (23%), Positives = 91/206 (44%), Gaps = 21/206 (10%)

Query: 4108  TAATPIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHR----FVFLSDITNEPPK--ML 4161
             TA   IP+++  +  + +  + + +A+ +  V  SP          L++  N PP+  + 
Sbjct: 19241 TAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTILAE--NVPPRIDLS 19298

Query: 4162  QEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLK--QNQKFQFEEVNCSHQLYIK 4219
               M      + G ++ L+  + G+P P V+W ++G LLK  +  K   +   C+ +L+  
Sbjct: 19299 VAMKSLLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELF-- 19356

Query: 4220  DVNSQDSGKYKCVAENNSGAVESVSDLTV-----EPVTYRENSQFENIGEIYGKYSRDQQ 4274
              VN +DSG Y   AEN+SG+  +   L V      P + + N  + +   +    S +  
Sbjct: 19357 SVNRKDSGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAML----SWEPP 19412

Query: 4275  LQDQGESVRAHFYDYPAGPFTPWTNV 4300
             L+D G  +  +  D        W  V
Sbjct: 19413 LEDGGSEITNYIVDKRETSRPNWAQV 19438



 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 54/207 (26%), Positives = 88/207 (42%), Gaps = 29/207 (14%)

Query: 4064  DQAKGAHP-------SMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQV--TAATPIP 4114
             D  K A P       +++   QT+  L+   P     G + +L + VE+Q   T    I 
Sbjct: 24205 DAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPE--HDGGSRVLGYVVEMQPKGTEKWSIV 24262

Query: 4115  EQDKESKEV-----------FQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQE 4163
              + K    V           F+ +    K     +V   P    V   D+T +P   L  
Sbjct: 24263 AESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVP----VIAKDLTIQPSLKLPF 24318

Query: 4164  MPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNS 4223
                  +   G+ + +E  + G P+P ++W ++G  LKQ  +   EE   S  L+IK+ N 
Sbjct: 24319 NTYSIQA--GEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNK 24376

Query: 4224  QDSGKYKCVAENNSG-AVESVSDLTVE 4249
              D GKY   A N++G A E++S + +E
Sbjct: 24377 DDFGKYTVTATNSAGTATENLSVIVLE 24403



 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 35/149 (23%), Positives = 73/149 (48%), Gaps = 8/149 (5%)

Query: 54    VQISFSD-GRAKLTIPAVTKANSGRYSLKATNGSGQAT----STAELLVKAETAPPNFV- 107
             V+ +F+D    + T+  ++  +   + + A N  G  +    S+  ++ + E  PP    
Sbjct: 27901 VRCNFTDVSECQYTVTGLSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEF 27960

Query: 108   --QRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAE 165
               +    + ++ G  +R++  V G P P V +++DG EI+  ++ +I+      SL + +
Sbjct: 27961 GPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRD 28020

Query: 166   AYPEDSGTYSVNATNSVGRATSTAELLVQ 194
             A  +  G Y+V A N+ G A +  ++ VQ
Sbjct: 28021 ATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049



 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 46/167 (27%), Positives = 82/167 (49%), Gaps = 11/167 (6%)

Query: 2178  QELQDVVAKEKDTMATFECE-TSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTI 2236
             +E++DV  K  +  A   C+    P   +KWY+ G E+ +  KY+M SD + H L+++T 
Sbjct: 30537 KEMKDVTTKLGEA-AQLSCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTE 30595

Query: 2237  DTSDAEDYSCVLV-EDENVKTTAKLIVEGAVVEF-----VKELQDIEVPESYSGELECIV 2290
             +  D   Y+C+   E   V+T++KL+++ A  +F     +KE     V  +    +  I 
Sbjct: 30596 EQEDEGVYTCIATNEVGEVETSSKLLLQ-ATPQFHPGYPLKEKYYGAVGSTLRLHVMYIG 30654

Query: 2291  SPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDV-TKEDQGEY 2336
              P      W+H    L+++   TI +     +L +K+V  K   G+Y
Sbjct: 30655 RPVPAM-TWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKY 30700



 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 292/1580 (18%), Positives = 546/1580 (34%), Gaps = 300/1580 (18%)

Query: 2051  KALAEEGK-----ITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKP 2105
             KA  E+GK     + +P    D + + PS++ P       + ++  G D    + V+G+P
Sbjct: 24286 KAYNEKGKSDPRVLGVPVIAKD-LTIQPSLKLP-----FNTYSIQAGEDLKIEIPVIGRP 24339

Query: 2106  DPECEWYKNGVKIERSDRIYWYWPEDNVCELV--IRDVTAEDSASIMVKAINIAGETSSH 2163
              P   W K+G  ++++ R+     E+     V  I++   +D     V A N AG     
Sbjct: 24340 RPNISWVKDGEPLKQTTRVN---VEETATSTVLHIKEGNKDDFGKYTVTATNSAG----- 24391

Query: 2164  AFLLVQAKQLITFTQELQDVVAKEKDTMA---TFECETSEPFVKVKW----YKDGMEVHE 2216
                        T T+ L  +V ++         F+ E S  FV + W    Y  G ++  
Sbjct: 24392 -----------TATENLSVIVLEKPGPPVGPVRFD-EVSADFVVISWEPPAYTGGCQISN 24439

Query: 2217  GDKYRMHSDRKV-HFLSILTIDTS-------DAEDYSCVLVEDENVKTTAKLIVEGAVVE 2268
                 +  +     H +S     T+          +Y   +  +     +A L  +  +V+
Sbjct: 24440 YIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQ 24499

Query: 2269  FVKELQDIEVPESYSGELECIVSPENIEGKW-------------YHNDVELKSNGKYTIT 2315
             +       + P          +S + +  +W             YH + + K++  +   
Sbjct: 24500 Y-----PFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYHLEQKEKNSILWVKL 24554

Query: 2316  SRRGRQNLTVKDVTKEDQGEYSFVIDGK-----------------KTTCKLKMKPRPIAI 2358
             ++   Q+   K    ++  EY F +  +                 +  C    +P  I I
Sbjct: 24555 NKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSKVSECFVARDPCDPPGRPEAIVI 24614

Query: 2359  LQGLSDQKVCE-----GDIVQLEVKVSLESVEGVWMKDG--QEVQPSDRVHIVIDKQSHM 2411
              +     K  +     G  +   +    +  +G WMK      ++    V  +++ Q + 
Sbjct: 24615 TRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKASFTNVLETEFTVSGLVEDQRYE 24674

Query: 2412  LLIEDMTKEDAGNYSFTIPALGLSTS-GRVSVYSVDVITPLKDVNVIE-GTKAVLECKVS 2469
               +  + +  AGN+S    + G  T+   +   +  +    KDV V+  G   VLE  + 
Sbjct: 24675 FRV--IARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVVHAGETFVLEADIR 24732

Query: 2470  VPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQR--LVINRTHASDEGPYKLIVGRVETNCN 2527
                +  V W  + ++++ +   +  +K T Q+  LV+     +D G Y L +  V    +
Sbjct: 24733 GKPIPDVVWSKDGKELE-ETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKS 24791

Query: 2528  LSVEKIKII------RGLRDLTCTETQN--VVFEVELSHSGIDVL-WNFKDKEIKPSSKY 2578
             + +  +K++       G   +T    +   + +   L   G ++  +  + +E    S  
Sbjct: 24792 IPIT-VKVLDRPGPPEGPLKVTGVTAEKCYLAWNPPLQDGGANISHYIIEKRETSRLSWT 24850

Query: 2579  KIEAHGKIYKLTVLNMMKDDEGKYTFYA------GENMTSGKLTVAG-----GAISKPLT 2627
             ++    +     V  ++  +E  +   A      GE + SG +T        G  S P  
Sbjct: 24851 QVSTEVQALNYKVTKLLPGNEYIFRVMAVNKYGIGEPLESGPVTACNPYKPPGPPSTPEV 24910

Query: 2628  DQTVAESQEAVFECEVANPDSKGE-------------WLRDGKHL--PLTNNIRSESDGH 2672
                  +S    +   V +  ++ E             W +  K     L   +   ++GH
Sbjct: 24911 SAITKDSMVVTWARPVDDGGTEIEGYILEKRDKEGVRWTKCNKKTLTDLRLRVTGLTEGH 24970

Query: 2673  KRRLIIAATKLDDIGEYTYKVATSKTSAKLKV-EAVKIKKTLKNLTVTETQDAVFTVELT 2731
                  +AA     +GE       S+ S   +  +A+       N  VT+T  +  ++  +
Sbjct: 24971 SYEFRVAAENAAGVGE------PSEPSVFYRACDALYPPGPPSNPKVTDTSRSSVSLAWS 25024

Query: 2732  HPNVKGVQWIKNGVV------------------LESNEKYAISVK-GTIYSLRIKNCAIV 2772
              P   G   +K  VV                  L+  +     +K  T Y+ RI  CAI 
Sbjct: 25025 KPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQGKQFTVTKLKENTEYNFRI--CAIN 25082

Query: 2773  DESVY--GFRLGRLGASARLHVETVKIIKKPKDVTALE-NATVAFEVSVSHDTVP-VKWF 2828
              E V       G + A  R+    +++    + V  L  +AT+   V++     P VKW 
Sbjct: 25083 SEGVGEPATLPGSVVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKW- 25141

Query: 2829  HKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTM 2888
              +  E   +D+ ++        L++ N++  D+G Y   +         FV         
Sbjct: 25142 -EKAEGILTDRAQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFV--------- 25191

Query: 2889  KNIEVPETKTASFEC---EVSHFNVPSMW----LKNGVEI--------EMSEKFKIVVQG 2933
              N+ V ++ +A       EV   +V   W    +  G +I        E + K    +  
Sbjct: 25192 -NVRVLDSPSAPVNLTIREVKKDSVTLSWEPPLIDGGAKITNYIVEKRETTRKAYATITN 25250

Query: 2934  KLHQLIIMNTSTEDSAEYTF-VCGNDQVSATL---TVTPIMITS--------MLKDINAE 2981
                +      + ++   Y F V  +++    L   T  P+ ++          L D+   
Sbjct: 25251 NCTKTTFRIENLQEGCSYYFRVLASNEYGIGLPAETTEPVKVSEPPLPPGRVTLVDVTRN 25310

Query: 2982  EKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFV 3041
                TI +E   +  G         ++ K ++K    T+  T    I  +  G+  +Y F 
Sbjct: 25311 TA-TIKWEKPESDGGSKITGYVVEMQTKGSEKWSTCTQVKTLEATISGLTAGE--EYVFR 25367

Query: 3042  AGKATSTAT-------LYVEARHIEFRK------HIKDIKVLEKKRAMFECEVSEPDITV 3088
                             + V AR IE +       H  ++K  E+ +     +   P  TV
Sbjct: 25368 VAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPFK-GRPQATV 25426

Query: 3089  QWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVR 3148
              W KD Q L+ T R+ +   K V  L I      D G Y +    +              
Sbjct: 25427 NWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAG------------ 25474

Query: 3149  IRSIKKEVQVIEKQR-----AVVEFEVNEDDVDAHW----YKDGIEINFQVQERHK---- 3195
               SI   + +I   R      +   EV+ D +   W    Y  G +I+  + E+ +    
Sbjct: 25475 --SITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIVEKKETTST 25532

Query: 3196  --YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNA--------------PEP 3238
               ++V + + R  I   R +   EY F V   NR   + Y  +              P  
Sbjct: 25533 TWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPFSPPGPPGT 25592

Query: 3239  PQVLQELQ-------PVTVQSGKPARFCAVISGRPQPKISWYKEEQLL--STGFKCKFLH 3289
             P+V+   +        V V  G        +  + +  I W K  ++L   T  K   L 
Sbjct: 25593 PKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADTQMKVSGLD 25652

Query: 3290  DGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIIT 3349
             +G  Y              Y   A+N  G+   S S    VP         P  PP    
Sbjct: 25653 EGLMYE-------------YRVYAENIAGIGKCSKSCE-PVP------ARDPCDPPG--Q 25690

Query: 3350  PLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKP-SRFFR--MTQFEDTYQLEIAEA 3406
             P    +T +    ++         K++ Y  +++  P  R+ +   T  ++TY  E+ E 
Sbjct: 25691 PEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKCNYTNIQETY-FEVTEL 25749

Query: 3407  YPEDEGTYTFVASNAVGQVS 3426
               +    +   A NA   VS
Sbjct: 25750 TEDQRYEFRVFARNAADSVS 25769



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 37/129 (28%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 67    IPAVTKANSGRYSLKATN--GSGQATSTAELLVKAETAPPNFVQR----LQSMTVRQGSQ 120
             +P + + N  R+ +KA N  G G+    AE ++  +   P  V+        +TVR G  
Sbjct: 17866 VPGLIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQT 17925

Query: 121   VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
             +R+  RV G P P + + ++G  +       + Q+     L I EA   D G Y ++A N
Sbjct: 17926 IRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKN 17985

Query: 181   SVGRATSTA 189
             S G A  +A
Sbjct: 17986 SSGHAQGSA 17994



 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 34/137 (24%), Positives = 66/137 (48%), Gaps = 6/137 (4%)

Query: 63    AKLTIPAVTKANSGR---YSLKATNGSGQATSTA---ELLVKAETAPPNFVQRLQSMTVR 116
             +K+    VT  +SG+   + +KA N  G++        ++ K  T  P+      + +++
Sbjct: 24265 SKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQ 24324

Query: 117   QGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSV 176
              G  +++++ V G P P + + +DG  ++ +    + +      L I E   +D G Y+V
Sbjct: 24325 AGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTV 24384

Query: 177   NATNSVGRATSTAELLV 193
              ATNS G AT    ++V
Sbjct: 24385 TATNSAGTATENLSVIV 24401



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 67/305 (21%), Positives = 113/305 (37%), Gaps = 32/305 (10%)

Query: 5177 KDNEMPPSFIEPLTKRKVYENTTLGFIVE--VEGLPVPGVKWYRNKSLLEPDERIKMERV 5234
            K+  +PPSF + L++  V E     F +E  V G     V WY+N   ++P    ++   
Sbjct: 8243 KERLIPPSFTKRLSET-VEETEGNSFKLEGRVAGSQPITVAWYKNNIEIQPTSNCEITFK 8301

Query: 5235 GNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEF 5294
             N   L++      + G Y C   N  G A   +++ I   ++      PPV  QH+   
Sbjct: 8302 NNTLVLQVRKAGMNDAGLYTCKVSNDAGSALCTSSIVIKEPKK------PPVFDQHLTPV 8355

Query: 5295 DLE---------HTTSSRTPSPQEIVL--EVELSEKDVKEFEKQVKIVTVPEFTPDHK-- 5341
             +          H   S     Q +    E++ S++    F     ++ + +        
Sbjct: 8356 TVSEGEYVQLSCHVQGSEPIRIQWLKAGREIKPSDRCSFSFASGTAVLELRDVAKADSGD 8415

Query: 5342 -----SMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSD 5396
                 S +   D         +  +     K+  +D  +F     F+      ++ E + 
Sbjct: 8416 YVCKASNVAGSDTTKSKVTIKDKPAVAPATKKAAVDGRLF-----FVSEPQSIRVVEKTT 8470

Query: 5397 AVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAV 5456
            A F   V G P P VKW K          +  I ++     L+IR+   +DS  YRC A 
Sbjct: 8471 ATFIAKVGGDPIPNVKWTKGKWRQLNQGGRVFIHQKGDEAKLEIRDTTKTDSGLYRCVAF 8530

Query: 5457 NCVGE 5461
            N  GE
Sbjct: 8531 NEHGE 8535



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 117/656 (17%), Positives = 244/656 (37%), Gaps = 71/656 (10%)

Query: 222  EKKIEAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQ 281
            E++ E  +  R +  V+  +   + ++   K P ++P K   ++P PP +  K  + + +
Sbjct: 9137 EEEWEEAYQEREVIQVQKEVYEESHER---KVPAKVPEK---KAPPPPKVIKKPVIEKIE 9190

Query: 282  SPSPIRHSPSPVRHVRAPTPSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEV 341
              S  R     V+  + P  S              P +  R+P+     +    A   + 
Sbjct: 9191 KTSR-RMEEEKVQVTKVPEVSK----------KIVPQKPSRTPVQEEVIEVKVPAVHTKK 9239

Query: 342  PPPWKQEGYVASSSEAEMRETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSAS 401
                +++ + AS +E E+  T      +I TEE+                      +  +
Sbjct: 9240 MVISEEKMFFASHTEEEVSVTVPEVQKEIVTEEK----------------------IHVA 9277

Query: 402  ASYAAEAVATGAKEVKQDADKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQ 461
             S   E      +  ++ A +  A   +   V+    + P +       ++        +
Sbjct: 9278 ISKRVEPPPKVPELPEKPAPEEVAPVPIPKKVEPPAPKVPEVPKKPVPEEKKPVPVPKKE 9337

Query: 462  PAQEQVRKEAEKTAVTKVVVAADKAKEQELK-SRTKEVITTKQEQMHVTHEQIRKETEKT 520
            PA      E  K  V +  +    AK++E   ++  EV      +  +T    R+E+   
Sbjct: 9338 PAAPPKVPEVPKKPVPEEKIPVPVAKKKEAPPAKVPEVQKGVVTEEKITIVTQREESPPP 9397

Query: 521  FVPKVVISAAKAKEQET-RISEEITKKQK--QVTQEAIRQETEITAASMVVVATAKSTKL 577
             VP++       + +   R  EE+    K   + ++ + +E       +   A     ++
Sbjct: 9398 AVPEIPKKKVPEERKPVPRKEEEVPPPPKVPALPKKPVPEEKVAVPVPVAKKAPPPRAEV 9457

Query: 578  ETVPGAQEETTTQQDQMHLSYEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKR 637
                  +E+    ++++  +  + ++ TR  V  +   +  + +E   +S  RE    + 
Sbjct: 9458 SKKTVVEEKRFVAEEKLSFAVPQRVEVTRHEVSAEEEWSYSEEEEGVSISVYREEEREEE 9517

Query: 638  EQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGK 697
            E+ ++T+ ++ +E E+  +       +K  E E    T      RQE+  V   K+   K
Sbjct: 9518 EEAEVTEYEVMEEPEEYVVEEKLHIISKRVEAEPAEVTE-----RQEKKIVLKPKIPA-K 9571

Query: 698  KAEAVATVVAAVDQARVREPREPGHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEP 757
              E     V    +  V E + P  + +            KE++   KV E P++P  E 
Sbjct: 9572 IEEPPPAKVPEAPKKIVPEKKVPAPVPK------------KEKVPPPKVPEEPKKPVPE- 9618

Query: 758  HVVPKAVKPRVIQAPSETHIKTTDQKGMHISSQIKKTTDLTTERL---VHVDKRPRTASP 814
                K V P+VI+       K T ++ M I+ + K    +T +       V + P+ A P
Sbjct: 9619 ----KKVPPKVIKMEEPLPAKVT-ERHMQITQEEKVLVAVTKKEAPPKARVPEEPKRAVP 9673

Query: 815  HFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETR 870
               V K+  PK E    A +       +++E  +  + ++  + +K  T+   + R
Sbjct: 9674 EEKVLKLK-PKREEEPPAKVTEFRKRVVKEEKVSIEAPKREPQPIKEVTIMEEKER 9728



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 44/159 (27%), Positives = 67/159 (42%), Gaps = 11/159 (6%)

Query: 1512  TQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLK----NVNI 1567
             T S ++         E+ V A N  G S  S+ L V   + +V P    +L      + +
Sbjct: 15351 TTSFLVENLDEHQMYEFRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKV 15410

Query: 1568  KEGSRLEMKVRATGNPNPDIVWLKNSDIIVPH----KYPKIRIEGTKGEAALKIDSTVSQ 1623
             K G  + +    TG P P I W KN  +I       +  K  +  ++ +  L I   V +
Sbjct: 15411 KAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVRE 15470

Query: 1624  DSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLII 1662
             D   YT TA N+ G  +    V+VEV +  P P R L +
Sbjct: 15471 DKGTYTVTASNRLG--SVFRNVHVEV-YDRPSPPRNLAV 15506



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 35/123 (28%), Positives = 61/123 (49%), Gaps = 3/123 (2%)

Query: 82    ATNGSGQATSTAELLVKAETAPPNF---VQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFY 138
             A N S  +  +  + + AE  PP     V     +TV+ G+ V L   V G P P V + 
Sbjct: 19271 AVNISPPSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTNVCLDATVFGKPMPTVSWK 19330

Query: 139   RDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198
             +DG  ++ +   +++ + +L +L +     +DSG Y++ A NS G  ++T +L V  +  
Sbjct: 19331 KDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDKPG 19390

Query: 199   VPA 201
              PA
Sbjct: 19391 PPA 19393



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 101/481 (20%), Positives = 162/481 (33%), Gaps = 70/481 (14%)

Query: 1234  VVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGF 1293
             V  +T +    F IS   E   +E + R+       L E            + EA E   
Sbjct: 23969 VTPQTGLRVTRFEISKLTEH--QEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDL 24026

Query: 1294  DSRI-KNYRILEGMGVTFHCKMSGYPLPKIAW------YKDGKRIKHGERYQMDFLQDGR 1346
             DS + K   +  G     H    G P P+I W      + D  +I+ G  Y         
Sbjct: 24027 DSELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKVQIEKGVNY--------- 24077

Query: 1347  ASLRIPVVLPEDEGIYTAFASNIKGN--AICSGKLYVEPAAPLGAPTYIPTLEPVSRIRS 1404
               L I      D G Y     N  G+  A  + K+   P  P            V  +R 
Sbjct: 24078 TQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLA--------VKEVRK 24129

Query: 1405  LSPRSVSRSPIRMSPARMS--------PARMSPARMSPARMSPGRRLEETDESQLERLYK 1456
              S   V   PI    A++           R + A +S        ++E   E  +     
Sbjct: 24130 DSAFLVWEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRV 24189

Query: 1457  ----------PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWF---HDGQQIVNDYTH 1503
                       PV  +  V          +  L  V +      W    HDG   V  Y  
Sbjct: 24190 MAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSASLMWEKPEHDGGSRVLGYVV 24249

Query: 1504  KV---------VIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVI-LTVEAVEHQ 1553
             ++         ++ E    + ++   +     ++ V A N  G+S   V+ + V A +  
Sbjct: 24250 EMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLT 24309

Query: 1554  VKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEA 1613
             ++P         +I+ G  L++++   G P P+I W+K+ + +   +  ++ +E T    
Sbjct: 24310 IQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPL--KQTTRVNVEETATST 24367

Query: 1614  ALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIA 1673
              L I      D   YT TA N AG  T    V   +   +P P      P G  R  E++
Sbjct: 24368 VLHIKEGNKDDFGKYTVTATNSAGTATENLSV---IVLEKPGP------PVGPVRFDEVS 24418

Query: 1674  A 1674
             A
Sbjct: 24419 A 24419



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 115/545 (21%), Positives = 201/545 (36%), Gaps = 79/545 (14%)

Query: 3176  DAHWYKDGIEINFQVQER-HKYVVERRIHRMFISETRQSDAGEYTFVA----GRNRSSVT 3230
             D  WY+ G E+   +Q R +K   + R H + +    Q D G YT +A    G   +S  
Sbjct: 30563 DIKWYRFGKEL---IQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSK 30619

Query: 3231  LYVNAP---EPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKF 3287
             L + A     P   L+E     V  G   R   +  GRP P ++W+  ++LL        
Sbjct: 30620 LLLQATPQFHPGYPLKEKYYGAV--GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENIT- 30676

Query: 3288  LHDGQEYTLLLIEAFPE--DAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPP 3345
             + + + YT L+++       A  Y  +  N +G  T  A L VE+ +   PD+  P  P 
Sbjct: 30677 IENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFG--TVDAILDVEIQD--KPDK--PTGPI 30730

Query: 3346  AIITPLQDTVTSEGQP---------ARFQCRVSGTDLKVSW--YSKDKKIKPSRFFRMTQ 3394
              I   L+++     +P           +            W   S    +   R   +T+
Sbjct: 30731 VIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVSSAISVTTCRIVNLTE 30790

Query: 3395  -----FEDTYQLEIAEAYPEDEGTYTFVAS-----NAVGQVSSTA------NLSLEAPES 3438
                  F  + Q     + P +  +   + S      A G+ + TA       ++ + P S
Sbjct: 30791 NAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGKPTITAVTKDSCVVAWKPPAS 30850

Query: 3439  ILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDIDHKSMAAKRYASRISSTSSW 3498
                 +I      + ++  ++  S  +E      FS    I+      +     +   S W
Sbjct: 30851 DGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEYEFRVKCENLGGESEW 30910

Query: 3499  PEYFKP------------SFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRP-IP 3545
              E  +P             F ++L    V         C++   P P + W+   +  I 
Sbjct: 30911 SEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIA 30970

Query: 3546  TGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEK 3605
              GL+  I+     +H    L I  V D D+  Y++ A N  GS   TASL        E 
Sbjct: 30971 DGLKYRIQEFKGGYH---QLIIASVTDDDATVYQVRATNQGGSVSGTASL--------EV 31019

Query: 3606  YLEFLKRAERTHENVEALVERGEDRIKVDLRFTGSP-----FNKKQD-VEQKGMMRTIHF 3659
              +       +T E + A+     + + + + F+G P     + K QD ++  G  + I  
Sbjct: 31020 EVPAKIHLPKTLEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVT 31079

Query: 3660  KTMSS 3664
             ++ +S
Sbjct: 31080 RSFTS 31084



 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 69/295 (23%), Positives = 109/295 (36%), Gaps = 51/295 (17%)

Query: 5214  VKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
             V WY     LE  E+ ++     V  L + +I K + G Y C  VN  GE  S+A + + 
Sbjct: 31600 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVK 31659

Query: 5274  PQEE--------------------RVVALPPPVT------HQHVMEFDLEHTTSSRTPSP 5307
                E                    R++  PP  T        +V E      T +  P P
Sbjct: 31660 GVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEP 31719

Query: 5308  Q----EIVLEVELSEKDVK---EFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMD 5360
                  +   +++  + D K   E +K +  +T+   T D        D   +  V  N  
Sbjct: 31720 HVTWYKSGQKIKPGDNDKKYTFESDKGLYQLTINSVTTD--------DDAEYTVVARN-- 31769

Query: 5361  SREGEDK-ELKIDLEVFEMP------PRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKW 5413
              + GED  + K+ + +   P      P F   + + +  E     F+  V GIP P +KW
Sbjct: 31770 -KYGEDSCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKW 31828

Query: 5414  YKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFL 5468
              K+   +       +I E    + L IR+    D+  YR  A N  G   C+  L
Sbjct: 31829 EKDGQPLSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHL 31883



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 63/299 (21%), Positives = 112/299 (37%), Gaps = 35/299 (11%)

Query: 3943 PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILT 4002
            PPSF + +++     G SC   C   G     V W++    I     +     +N   L 
Sbjct: 5799 PPSFTRRLKNTGGVLGASCILECKVAGSSPISVAWFHEKTKIVSGAKYQTTFSDNVCTLQ 5858

Query: 4003 LSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALV 4062
            L+S+   + G+ TCV  N  G+ +  ++L V+                 ++ E E L + 
Sbjct: 5859 LNSLDSSDMGNYTCVAANVAGSDECRAVLTVQEPPS-------------FVKEPEPLEV- 5904

Query: 4063 FDQAKGAHPSMSQEGQTNLHLLKTNPPVPPS---GDTELLSFPVEIQVTAATPIPEQDKE 4119
                      +  +  T   +++  PP   +   G  EL+       +     + E +  
Sbjct: 5905 ----------LPGKNVTFTSVIRGTPPFKVNWFRGARELVKGD-RCNIYFEDTVAELELF 5953

Query: 4120 SKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDSIILE 4179
            + ++ Q+ E                  FV       EP   L+ +  H+    G SIILE
Sbjct: 5954 NIDISQSGEYTCVVSNNAGQASCTTRLFV------KEPAAFLKRLSDHS-VEPGKSIILE 6006

Query: 4180 CLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSG 4238
               +G     VTW ++G  +  ++K        +  L I +   +D+G+Y C  EN +G
Sbjct: 6007 STYTGTLPISVTWKKDGFNITTSEKCNIVTTEKTCILEILNSTKRDAGQYSCEIENEAG 6065



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 44/178 (24%), Positives = 83/178 (46%), Gaps = 14/178 (7%)

Query: 10    QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK--LTI 67
             +PL+ +  +E  + TF   ++   V  + W ++G+ +        ++S+   + K  LTI
Sbjct: 12738 EPLKDIETMEKKSVTFWCKVNRLNVT-LKWTKNGEEVPFDN----RVSYRVDKYKHMLTI 12792

Query: 68    PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRV 127
                   + G Y + A    GQ  S AELL+    AP  FV+ L+  TV +        ++
Sbjct: 12793 KDCGFPDEGEYIVTA----GQDKSVAELLIIE--APTEFVEHLEDQTVTEFDDAVFSCQL 12846

Query: 128   TGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
             +     V K+YR+G EI+    ++  ++G ++ L+I +   +D   Y+    +   RA
Sbjct: 12847 SREKANV-KWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRA 12903



 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 66/279 (23%), Positives = 99/279 (35%), Gaps = 67/279 (24%)

Query: 5380  PRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLK 5439
             P FI       I E  + +F C + G P+PE++W+K  + I   +    IS  +  ++L+
Sbjct: 33134 PAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISS-NVSISRSRNVYSLE 33192

Query: 5440  IRNVCLSDSATYRCRAVNCVGEAICRGFL----------------TMGD--------SEI 5475
             IRN  +SDS  Y  +A N  G+      L                T GD        S+ 
Sbjct: 33193 IRNASVSDSGKYTIKAKNFRGQCSATASLMVLPLVEEPSREVVLRTSGDTSLQGSFSSQS 33252

Query: 5476  FAVIAKKSKVTLSSL-------MEELVL-------KSNYTDSFFEFQV------------ 5509
               + A K + + SS        M E+          S+  +SF E               
Sbjct: 33253 VQMSASKQEASFSSFSSSSASSMTEMKFASMSAQSMSSMQESFVEMSSSSFMGISNMTQL 33312

Query: 5510  -----------VEGPPRFIKGI-SDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGR 5557
                        + G P  I+ + SD     G      C   G P P V W   G+ +  +
Sbjct: 33313 ESSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQ 33372

Query: 5558  ---RFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
                RF +E +      L I  + K D G Y     N+ G
Sbjct: 33373 EQGRFHIENT-DDLTTLIIMDVQKQDGGLYTLSLGNEFG 33410



 Score = 53.5 bits (127), Expect = 6e-06
 Identities = 102/470 (21%), Positives = 165/470 (35%), Gaps = 72/470 (15%)

Query: 5177  KDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGN 5236
             K  E+P  FI PL+  KV+E     F  EV   P    +W +    +  D+R ++ + G 
Sbjct: 11834 KVKELPLIFITPLSDVKVFEKDEAKFECEVSREP-KTFRWLKGTQEITGDDRFELIKDGT 11892

Query: 5237  VCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDL 5296
               S+ I +    +  +YM  A +     K      ++ +  R+  L P           L
Sbjct: 11893 KHSMVIKSAAFEDEAKYMFEAEDKHTSGK------LIIEGIRLKFLTP-----------L 11935

Query: 5297  EHTTSSRTPSPQEIVLEVELSEKD--VKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNF 5354
             +  T+    S    V  VELS  +  VK F+   ++ T    +   +    S+     + 
Sbjct: 11936 KDVTAKEKES---AVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSITFKDLSI 11992

Query: 5355  VDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWY 5414
              D +    E      +  L V E  P F   + D+   E  + + +C +     P VKW+
Sbjct: 11993 DDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP-VKWF 12051

Query: 5415  KEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRC--------------------- 5453
             K+   I+P     VI  +     L ++    SD   Y C                     
Sbjct: 12052 KDGKEIKPSK-NAVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLV 12110

Query: 5454  ---RAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSS----LMEE-----LVLKSNYT 5501
                 +V  +     R    + + +I A    K +  L +    + EE     LVL +   
Sbjct: 12111 RPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRL 12170

Query: 5502  DSF--FEFQV--------VEGPPRFI---KGISDCYAPIGTAAYFQCLVRGSPRPTVYWY 5548
             D     +FQ         +   PR I   + + D     G  A F C +     P V WY
Sbjct: 12171 DQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWY 12229

Query: 5549  KDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESF 5598
               GK ++     V  S    H L +  +   D GE +  A +    A  F
Sbjct: 12230 LKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLF 12279



 Score = 53.5 bits (127), Expect = 6e-06
 Identities = 101/451 (22%), Positives = 170/451 (37%), Gaps = 77/451 (17%)

Query: 3237  EPPQVLQELQP---VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHD--G 3291
             EPP V  ++     + + +GK  R  AV++GRP P   W KEE  L    K + + D  G
Sbjct: 15100 EPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELD---KDRVVIDNVG 15156

Query: 3292  QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPL 3351
              +  L++ +A  +D   Y   A N  G  +  A+  VEV +V  P           +  L
Sbjct: 15157 TKSELIIKDALRKDHGRYVITATNSCG--SKFAAARVEVFDVPGP-----------VLDL 15203

Query: 3352  QDTVTSEGQPARFQCRVSGTD------LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAE 3405
             +  VT+     R  C ++ +D       +++ +  ++K      +R     +  + +I  
Sbjct: 15204 KPVVTN-----RKMCLLNWSDPEDDGGSEITGFIIERKDAKMHTWRQPIETERSKCDITG 15258

Query: 3406  AYPEDEGTYTFVASNAVG---QVSSTANLSLE------APESILH-ERIEQEIEMEMKEL 3455
                  E  +  +A N  G    V     L+++      +PE + + ER +  I ++ KE 
Sbjct: 15259 LLEGQEYKFRVIAKNKFGCGPPVEIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEP 15318

Query: 3456  FSEGES-------EHSERDTRDAFSDS-----------EDIDHKSMAAKRYASRISSTSS 3497
              S G S       E    D  D    +           E++D   M   R  +      S
Sbjct: 15319 RSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVENLDEHQMYEFRVKAVNEIGES 15378

Query: 3498  WP----------EYFKPSFTQKLTFK----YVLEGEPVVFTCRLIACPTPEMTWFHNNRP 3543
              P          +   P+   +L+ +     V  GEPV     +   P P++ W  N   
Sbjct: 15379 EPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETV 15438

Query: 3544  I--PTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKG 3601
             I  PT   +I K E       + L I +    D G+Y + A N  GS      + V  + 
Sbjct: 15439 IEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRP 15498

Query: 3602  QDEKYLEFLK-RAERTHENVEALVERGEDRI 3631
                + L     +AE  +   +A ++ G   I
Sbjct: 15499 SPPRNLAVTDIKAESCYLTWDAPLDNGGSEI 15529



 Score = 53.5 bits (127), Expect = 6e-06
 Identities = 62/260 (23%), Positives = 102/260 (39%), Gaps = 52/260 (20%)

Query: 1685  GQEQWEEGDLYDKEKQ----QKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLH 1740
             G+ +W E       K     Q P FK++L +L ++    A   C++T  G P  +V+W  
Sbjct: 30906 GESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVT--GHPKPIVKWYR 30963

Query: 1741  DGKPLEAANRLRMINEF--GYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEK 1798
              GK + A      I EF  GY  L        D+ +   RATN+ G+   +A+L    E 
Sbjct: 30964 QGKEIIADGLKYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASL----EV 31019

Query: 1799  SLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETA 1858
              +  +  LP+  +G+            GA                      V  L GE  
Sbjct: 31020 EVPAKIHLPKTLEGM------------GA----------------------VHALRGEVV 31045

Query: 1859  RFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV----RYDGIHYLDIVDCKSYDTGEVKVTA 1914
               +   +G P P + W     LI  +  ++V     +  + + + V+ K  D G   V A
Sbjct: 31046 SIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERK--DAGFYVVCA 31103

Query: 1915  ENPEGVIEHKVKLEIQQRED 1934
             +N  G+ +  V+L++    D
Sbjct: 31104 KNRFGIDQKTVELDVADVPD 31123



 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 37/137 (27%), Positives = 55/137 (40%), Gaps = 4/137 (2%)

Query: 1527  EWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNV-NIKEGSRLEMKVRATGNPNP 1585
             E+ V  +N  G S       V   E   KP+   KL  V  +K G  + ++    G P P
Sbjct: 18172 EFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFP 18231

Query: 1586  DIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKV 1645
             ++ W K+ D     + P+++I+     +   +      D   Y  TA N AG       V
Sbjct: 18232 EVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATV 18291

Query: 1646  NVEVEFAEPEPERKLII 1662
             NV     +P P R L I
Sbjct: 18292 NV---LDKPGPVRNLKI 18305



 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 38/149 (25%), Positives = 61/149 (40%), Gaps = 3/149 (2%)

Query: 66    TIPAVTKANSGRYSLKATNGSGQATS---TAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
             TI  + +     + + A N  G +     +  ++ K    PP F     + TV  G  ++
Sbjct: 22107 TITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLK 22166

Query: 123   LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
             + V   G PTP V +++D   ++ +         +   L I +A  ED G Y V  TNS 
Sbjct: 22167 VDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSA 22226

Query: 183   GRATSTAELLVQGEEEVPAKKTKTIVSTA 211
             G A  T  ++V  +   P    K    TA
Sbjct: 22227 GEAIETLNVIVLDKPGPPTGPVKMDEVTA 22255



 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 97/512 (18%), Positives = 179/512 (34%), Gaps = 96/512 (18%)

Query: 932   VPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQI 991
             VP   +     P+L       ++  GE + +E  + G P P ++W ++   ++ +    +
Sbjct: 24301 VPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNV 24360

Query: 992   TFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV--------------QVSEE 1037
                +    L I+E   +D G++T +A N AGT + +  + V              +VS +
Sbjct: 24361 EETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVSAD 24420

Query: 1038  F--------------EKETTAVTEKFTTEEKRFVESRDVVMTDTSLTEEQAG-------- 1075
             F              +     V ++ TT     + S  V  T   +T+ + G        
Sbjct: 24421 FVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIF 24480

Query: 1076  ------------------------PGEPAAPYFITKPVVQKLV-------EGGSVVFGCQ 1104
                                     PG P  P+  +    Q LV       +GG+ + G  
Sbjct: 24481 AENRYGKSAPLDSKAVIVQYPFKEPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGYH 24540

Query: 1105  VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGE 1164
             +    K  + W K         ++K +   +  E +  +S           IV   K  +
Sbjct: 24541 LEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAE--------NIVGIGKPSK 24592

Query: 1165  TSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEPKV--GETAPGFVYSEYEKEYEKEQ 1222
              S      +  D     + +  ++ +  VT   ++P    G    G++        +K+ 
Sbjct: 24593 VSECFVARDPCDPP--GRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVE------KKDL 24644

Query: 1223  ALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVD 1282
                R   A  T V+ T     EF +S   E   +  E+R+I         E  +   A+ 
Sbjct: 24645 PDGRWMKASFTNVLET-----EFTVSGLVED--QRYEFRVIARNAAGNFSEPSDSSGAIT 24697

Query: 1283  I-SESEAVESGFDSRIKNYRILEGMGVTF--HCKMSGYPLPKIAWYKDGKRIKHGERYQM 1339
                E +A  +  D + K+  ++   G TF     + G P+P + W KDGK ++       
Sbjct: 24698 ARDEIDAPNASLDPKYKDVIVVHA-GETFVLEADIRGKPIPDVVWSKDGKELEETAARME 24756

Query: 1340  DFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1371
                   + +L +   +  D G Y    SN+ G
Sbjct: 24757 IKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 24788



 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 6/108 (5%)

Query: 926   VTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIES 985
             +T    VP  VE     P    GL    +  GES+ ++  + G P P VTW+++  +IE 
Sbjct: 27948 MTRDENVPPIVEFG---PEYFDGL---IIKSGESLRIKALVQGRPVPRVTWFKDGVEIEK 28001

Query: 986   SIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ 1033
              ++ +IT   G   L +R+A  +  G +T  A N +G+      + VQ
Sbjct: 28002 RMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049



 Score = 53.1 bits (126), Expect = 7e-06
 Identities = 32/119 (26%), Positives = 57/119 (47%), Gaps = 4/119 (3%)

Query: 4151  SDITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNG-VLLKQNQKFQFEE 4209
             SD+  + P   +E+ ++   R   +  L C ++G P+P+V W++ G  ++    K++ +E
Sbjct: 30921 SDVPIQAPHFKEEL-RNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQE 30979

Query: 4210  VNCS-HQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVE-PVTYRENSQFENIGEIY 4266
                  HQL I  V   D+  Y+  A N  G+V   + L VE P         E +G ++
Sbjct: 30980 FKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVH 31038



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 52/219 (23%), Positives = 97/219 (44%), Gaps = 20/219 (9%)

Query: 8     FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA-KLT 66
             F  PL+ V   E  +A F   +S   +  V WF++ Q + T+    +Q    +G+   +T
Sbjct: 11931 FLTPLKDVTAKEKESAVFTVELSHDNI-RVKWFKNDQRLHTTRSVSMQ---DEGKTHSIT 11986

Query: 67    IPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVR 126
                ++  ++ +  ++A   S +A  T           P F  +LQ  T  +  +V LQ  
Sbjct: 11987 FKDLSIDDTSQIRVEAMGMSSEAKLTVL------EGDPYFTGKLQDYTGVEKDEVILQCE 12040

Query: 127   VTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRAT 186
             ++    PV K+++DG EI+ S +  I  +G    L++ +A   D G Y    T   G   
Sbjct: 12041 ISKADAPV-KWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQY----TCDCGTDK 12095

Query: 187   STAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKI 225
             ++ +L ++  E     K    + + ++ E+   R E +I
Sbjct: 12096 TSGKLDIEDRE----IKLVRPLHSVEVMETETARFETEI 12130



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 53/208 (25%), Positives = 92/208 (44%), Gaps = 17/208 (8%)

Query: 5     APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK 64
             A  F    Q++ +LEG  A F   IS    P V W RD + + +     V    +DG+ +
Sbjct: 12551 AAEFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYDV---IADGKKR 12606

Query: 65    -LTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL 123
              L +   T  + G Y +    G+ +A +   ++ K     P     L+   V++  +V  
Sbjct: 12607 VLVVKDATLQDMGTYVVMV--GAARAAAHLTVIEKLRIVVP-----LKDTRVKEQQEVVF 12659

Query: 124   QVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
                V        K++R+   I  S  + I Q+  +Y+L I +A+ +D   Y+V+ TN  G
Sbjct: 12660 NCEVN-TEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRG 12718

Query: 184   RATSTAELLVQGEEEV----PAKKTKTI 207
                 +A  L+  EE++    P K  +T+
Sbjct: 12719 ENVKSAANLIVEEEDLRIVEPLKDIETM 12746



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 39/144 (27%), Positives = 67/144 (46%), Gaps = 6/144 (4%)

Query: 64    KLTIPAVTKANSGRYSLKATNGSGQATS---TAEL-LVKAETAPPNF--VQRLQSMTVRQ 117
             K+ +  + +     Y +KA N  G +     T E+  V  + AP  F  V+ L  +TV+ 
Sbjct: 13645 KMEVTGLEEGKWYAYRVKALNRQGASKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKA 13704

Query: 118   GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVN 177
             G+++ L   VTG P P + + +    ++      I       ++ I ++   D+GTY + 
Sbjct: 13705 GTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTYIIE 13764

Query: 178   ATNSVGRATSTAELLVQGEEEVPA 201
             A N  GRAT+  E+ V  +   PA
Sbjct: 13765 AVNVCGRATAVVEVNVLDKPGPPA 13788



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 95/478 (19%), Positives = 185/478 (38%), Gaps = 92/478 (19%)

Query: 933   PAPVEIPVTPPTL---VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDF 989
             P  V  P  PP +   VS    + ++ G+++ +   ++G P PT  W +E+ +++   D 
Sbjct: 15092 PVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDK--DR 15149

Query: 990   QITFQSGI-ARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEK 1048
              +    G  + L+I++A  +D GR+  +A N  G    S + A +V E F+     +   
Sbjct: 15150 VVIDNVGTKSELIIKDALRKDHGRYVITATNSCG----SKFAAARV-EVFDVPGPVL--- 15201

Query: 1049  FTTEEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGN 1108
                + K  V +R + + + S  E+                      +GGS + G  +   
Sbjct: 15202 ---DLKPVVTNRKMCLLNWSDPED----------------------DGGSEITGFIIERK 15236

Query: 1109  PKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHG-ETSA 1167
                   W++   P+            +T   K  I+        ++ ++ +NK G     
Sbjct: 15237 DAKMHTWRQ---PI------------ETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPV 15281

Query: 1168  SASLLEEADYELLMKSQQEMLY----QTQVTAFVQEPKVGETAPGFVYSEYEKEYEK-EQ 1222
                 +   D      S + + Y    ++ +T   +EP+    +P   Y   ++ ++K + 
Sbjct: 15282 EIGPILAVDPLGPPTSPERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDF 15341

Query: 1223  ALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVD 1282
               + K++   T           F + + +E  + E   + +     E+ E +    + V 
Sbjct: 15342 ERVNKRLCPTT----------SFLVENLDEHQMYEFRVKAV----NEIGESEPSLPLNVV 15387

Query: 1283  ISESE---AVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQM 1339
             I + E    ++     R    ++  G  V     ++G P+PKI W K+   I+       
Sbjct: 15388 IQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEK----PT 15443

Query: 1340  DFLQ---------DGRASLRIPVVLPEDEGIYTAFASNIKGNAI--CSGKLYVEPAAP 1386
             D LQ         + +  L IP  + ED+G YT  ASN  G+       ++Y  P+ P
Sbjct: 15444 DALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPP 15501



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 31/115 (26%), Positives = 55/115 (47%), Gaps = 5/115 (4%)

Query: 6     PTFTQPLQSVVVLE---GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
             P    PL+   V++   G++    A ISG P P + W++D + + T+ L  V +  +   
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNAL--VCVENTTDL 26927

Query: 63    AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQ 117
             A + I    + NSG Y LK  N  G A++T  + +  +  PP      +++T  +
Sbjct: 26928 ASILIKDADRLNSGCYELKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAEK 26982



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 27/97 (27%), Positives = 53/97 (54%)

Query: 116   RQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175
             R G+ V+L+  ++G P P +++Y+D  E+Q++    +    DL S+LI +A   +SG Y 
Sbjct: 26885 RAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYE 26944

Query: 176   VNATNSVGRATSTAELLVQGEEEVPAKKTKTIVSTAQ 212
             +   N++G A++T  + +  +   P    +    TA+
Sbjct: 26945 LKLRNAMGSASATIRVQILDKPGPPGGPIEFKTVTAE 26981



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 23/79 (29%), Positives = 45/79 (56%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             + G+S+ ++ L+ G P P VTWF++GV +++    +  +V  S  L+++D      G Y 
Sbjct: 27971 KSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYT 28030

Query: 4231  CVAENNSGAVESVSDLTVE 4249
               A+N SG+ ++   + V+
Sbjct: 28031 VEAKNASGSAKAEIKVKVQ 28049



 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 94/407 (23%), Positives = 149/407 (36%), Gaps = 77/407 (18%)

Query: 5196 ENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMC 5255
            EN T+ F V V    VP VKW+     ++P ++ ++     V  L + NI   + GEY  
Sbjct: 2808 ENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTA 2866

Query: 5256 HAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQ-EIVLEV 5314
                +  +AK F  V+ +   + +  +  P T     E ++ H      PS   +  +E+
Sbjct: 2867 VVGQLECKAKLF--VETLHITKTMKNIEVPETKTASFECEVSHFN---VPSMWLKNGVEI 2921

Query: 5315 ELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSL---DVLPFNFVDPNMDSREGEDKELKI 5371
            E+SEK         KIV   +    H+ +I++    D   + FV  N           ++
Sbjct: 2922 EMSEK--------FKIVVQGKL---HQLIIMNTSTEDSAEYTFVCGND----------QV 2960

Query: 5372 DLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISE 5431
               +   P      + D    E     F+ +V        KW K  + I+  + K  +  
Sbjct: 2961 SATLTVTPIMITSMLKDINAEEKDTITFEVTV-NYEGISYKWLKNGVEIKSTD-KCQMRT 3018

Query: 5432 EKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLM 5491
            +K +H+L IRNV   D+A Y                           +A K+  T +  +
Sbjct: 3019 KKLTHSLNIRNVHFGDAADY-------------------------TFVAGKATSTATLYV 3053

Query: 5492 EELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDG 5551
            E   ++                  F K I D        A F+C V   P  TV W KD 
Sbjct: 3054 EARHIE------------------FRKHIKDIKVLEKKRAMFECEV-SEPDITVQWMKDD 3094

Query: 5552 KLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESF 5598
            + +Q       +     H L I S   SD G+Y  VA      A+ F
Sbjct: 3095 QELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLF 3141



 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 85/401 (21%), Positives = 144/401 (35%), Gaps = 75/401 (18%)

Query: 5206 VEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAK 5265
            V G P    KW+++   L  D +  +  +  V SL+I   +  + G Y     N +G++ 
Sbjct: 6668 VTGTPELSAKWFKDGRELSADSKHHITFINKVASLKIPCAEMSDKGLYSFEVKNSVGKSN 6727

Query: 5266 SFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEK---DVK 5322
               +V +    +R+V   PP   + + + +     S        +VLE  +S      V 
Sbjct: 6728 CTVSVHV---SDRIV---PPSFIRKLKDVNAILGAS--------VVLECRVSGSAPISVG 6773

Query: 5323 EFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPN-------MDSREGEDKELKIDLEV 5375
             F+   +IV+ P+        + +L++   + ++P+       + +      E    L V
Sbjct: 6774 WFQDGNEIVSGPKCQSSFSENVCTLNL---SLLEPSDTGIYTCVAANVAGSDECSAVLTV 6830

Query: 5376 FEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGS 5435
             E PP F       ++       F   + G P  +VKW+K    + P      IS E   
Sbjct: 6831 QE-PPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGE-SCNISLEDFV 6888

Query: 5436 HTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELV 5495
              L++  V   +S  Y C   N  G A C   L                           
Sbjct: 6889 TELELFEVQPLESGDYSCLVTNDAGSASCTTHL--------------------------- 6921

Query: 5496 LKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLV- 5554
                          V+ P  F+K ++D     G+    +    G+P  +V W KD  L+ 
Sbjct: 6922 -------------FVKEPATFVKRLADFSVETGSPIVLEATYTGTPPISVSWIKDEYLIS 6968

Query: 5555 QGRR--FTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
            Q  R   T+ E  T    L I      D  +Y C+  N++G
Sbjct: 6969 QSERCSITMTEKST---ILEILESTIEDYAQYSCLIENEAG 7006



 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 115/516 (22%), Positives = 186/516 (36%), Gaps = 105/516 (20%)

Query: 950   KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESS--IDFQITFQSGIARLMIREAFA 1007
             K V    G+++ +E  + G P PTVTW + D  ++ +  ++F+ T  S I  L I E   
Sbjct: 21073 KLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTI--LNINECVR 21130

Query: 1008  EDSGRFTCSAVNEAGTVSTSCYLAV--------------QVSEEF--------EKE---- 1041
              DSG +  +A N  G V     + V              +VS +F        E +    
Sbjct: 21131 SDSGPYPLTARNIVGEVGDVITIQVHDIPGPPTGPIKFDEVSSDFVTFSWDPPENDGGVP 21190

Query: 1042  -TTAVTEKFTTEEKRFVE-SRDVVMTDTSLTEEQAG------------------------ 1075
              +  V E   T+   +VE +  V+ T    T    G                        
Sbjct: 21191 ISNYVVEMRQTDSTTWVELATTVIRTTYKATRLTTGLEYQFRVKAQNRYGVGPGITSACI 21250

Query: 1076  --------PGEPAAPYF--ITKPVV-----QKLVEGGSVVFGCQVGGNPKPHVYWKKSGV 1120
                     PG P  P    +TK  +     + L +GGS + G  V    +  + W+    
Sbjct: 21251 VANYPFKVPGPPGTPQVTAVTKDSMTISWHEPLSDGGSPILGYHVERKERNGILWQTVSK 21310

Query: 1121  PLTTGYRYKVSYNKQTGECKLVISMTFADD-AGEYTIVVRNKHGE---TSASASLLEEAD 1176
              L  G  +K              S    D  A E+ ++  N  G+   +  S  +L    
Sbjct: 21311 ALVPGNIFK--------------SSGLTDGIAYEFRVIAENMAGKSKPSKPSEPMLALDP 21356

Query: 1177  YELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVV 1236
              +   K     + +  VT    +P   E   GF  + Y  E   ++ L   +  K     
Sbjct: 21357 IDPPGKPVPLNITRHTVTLKWAKP---EYTGGFKITSYIVE---KRDLPNGRWLKANF-- 21408

Query: 1237  RTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISES-EAVESGFDS 1295
              + + + EF +S   E      E+R+I       +    E   A+   +  EA +   D 
Sbjct: 21409 -SNILENEFTVSGLTED--AAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDV 21465

Query: 1296  RIKNYRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVV 1354
             + K+  IL+ G        +SG P P + W KDGK ++   + ++  + D   +L     
Sbjct: 21466 KFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIK-IADFSTNLVNKDS 21524

Query: 1355  LPEDEGIYTAFASNIKGNA--ICSGKLYVEPAAPLG 1388
                D G YT  A+N  G A  I + K+   P  P G
Sbjct: 21525 TRRDSGAYTLTATNPGGFAKHIFNVKVLDRPGPPEG 21560



 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 923   EAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 982
             +AK+T T   P P +  + P      L N    EG+SV  E  +SG P PT+ W ++   
Sbjct: 31777 KAKLTVTLH-PPPTDSTLRP-MFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQP 31834

Query: 983   IESSIDFQITFQS-GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQ 1033
             +    + +I  +      L IR+   ED+G +  +A N AG+ S   +L V+
Sbjct: 31835 LSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31886



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 5/107 (4%)

Query: 4153 ITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNC 4212
            +T + P +  + P      +G  +IL+C ISG P   V W ++   ++ ++KF+    + 
Sbjct: 6452 LTVKAPPVFTQKPSPVGALKGSDVILQCEISGTPPFEVVWVKDRKQVRNSKKFKITSKHF 6511

Query: 4213 SHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPVTYRENSQF 4259
               L+I ++ + D G+Y C A N  G     SD     V ++E  +F
Sbjct: 6512 DTSLHILNLEASDVGEYHCKATNEVG-----SDTCSCSVKFKEPPRF 6553



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 139/733 (18%), Positives = 251/733 (34%), Gaps = 111/733 (15%)

Query: 250   PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTPSPVRSVSP 309
             P    P +P KP      P  +  K +    + P   +    PV   + P P+P +  +P
Sbjct: 10000 PPAKVPEVPKKPVPEEKVPVPVPKKVEAPPAKVPEVPK---KPVPEKKVPVPAPKKVEAP 10056

Query: 310   AARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPW---KQEGY---VASSSEAEMR-ET 362
              A++   P +     L+  + + + V    E PPP    K+E     VA   E E+  E 
Sbjct: 10057 PAKVPEVPKK-----LIPEEKKPTPVPKKVEAPPPKVPKKREPVPVPVALPQEEEVLFEE 10111

Query: 363   TLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDADK 422
              +    ++  EE  E     +E+V                    E V    +E+  + ++
Sbjct: 10112 EIVPEEEVLPEE--EEVLPEEEEVLPE----------------EEEVLPEEEEIPPEEEE 10153

Query: 423   SAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVA 482
                    V   +     E V+  V+              P  E  +K  EK  V      
Sbjct: 10154 VPPEEEYVPEEEEFVPEEEVLPEVKPKVPVPA-------PVPEIKKKVTEKKVVIPKKEE 10206

Query: 483   ADKAKEQELKSRTKE--VITTKQEQM---HVTHEQIRKETEKTFVPKVVISAAKAKEQET 537
             A  AK  E+  + +E  +I  K+E++    VT E   +   +  +P+   S  + +E   
Sbjct: 10207 APPAKVPEVPKKVEEKRIILPKEEEVLPVEVTEEPEEEPISEEEIPEEPPSIEEVEEVAP 10266

Query: 538   RISEEITKKQKQVTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLS 597
                 E+ KK        + ++ E   A +     +K    E VP   ++      ++   
Sbjct: 10267 PRVPEVIKKAVPEAPTPVPKKVEAPPAKV-----SKKIPEEKVPVPVQKKEAPPAKVPEV 10321

Query: 598   YEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALS 657
              +K+ +  +K +VPK     P            +G T   E+V +   +     E+  L 
Sbjct: 10322 PKKVPE--KKVLVPKKEAVPPA-----------KGRTVLEEKVSVAFRQEVVVKERLELE 10368

Query: 658   TIAVATAKAKEQETILRTRETMATRQ-----EQIQVTHGKVDVGKKAEAVATVVAAVDQA 712
              +     +  E+E      E     +     E I++   +V+   + E V  V+   +  
Sbjct: 10369 VVEAEVEEIPEEEEFHEVEEYFEEGEFHEVEEFIKLEQHRVEEEHRVEKVHRVIEVFEAE 10428

Query: 713   RVR---EPREPGHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVI 769
              V    +P+ P    E        E     +    KV    + PA  P V  K V    +
Sbjct: 10429 EVEVFEKPKAPPKGPE------ISEKIIPPKKPPTKVVPRKEPPAKVPEVPKKIVVEEKV 10482

Query: 770   QAPSETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHG 829
             + P E  +  T         ++    ++  E+ V V    +  +P         PK    
Sbjct: 10483 RVPEEPRVPPTK------VPEVLPPKEVVPEKKVPVPPAKKPEAP--------PPKVPEA 10528

Query: 830   YEASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDT 889
              +  +        +K++      +      K P V  +    +  P  +P  P +  P+ 
Sbjct: 10529 PKEVVP-------EKKVPVPPPKKPEVPPTKVPEVPKAAVPEKKVPEAIPPKPESPPPEV 10581

Query: 890   YKSEAGVEVKKEVGVS------ITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPP 943
              ++   V  +K+V  +      +T   V E   EV+  ++  V        P + P  PP
Sbjct: 10582 PEAPKEVVPEKKVPAAPPKKPEVTPVKVPEAPKEVVPEKKVPV-------PPPKKPEVPP 10634

Query: 944   TLVSGLKNVTVIE 956
             T V  +  V V E
Sbjct: 10635 TKVPEVPKVAVPE 10647



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 71/281 (25%), Positives = 116/281 (41%), Gaps = 26/281 (9%)

Query: 1381  VEPA-APLGAPTYIPTLEPVSRIRSLSPRSVS-RSPIRMSPARMSPARMSPARMSPARMS 1438
             VEP   P+ AP  +P +   +  ++    +   + PI+  P +      SP      ++ 
Sbjct: 11037 VEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTP----SPIEAERRKLR 11092

Query: 1439  PGRRLEET-DESQLERLYK--PVFVLKPVSFKCLE-----GQTARFDLKVVGRPMPETFW 1490
             PG   E+  DE+      K  P+  +K +    L      G +A F+  +V      T W
Sbjct: 11093 PGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFEC-LVSPSTAITTW 11151

Query: 1491  FHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV 1550
               DG  I     H+  I +   + L I+    SD+GE+T V +      + +  L VE  
Sbjct: 11152 MKDGSNIRESPKHRF-IADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVE-- 11208

Query: 1551  EHQVKPMFVEKLKN-VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGT 1609
               ++   FV+ L+  V + +G  L +      N   D+VW K+  I+V  + P   + G 
Sbjct: 11209 --ELPVRFVKTLEEEVTVVKGQPLYLSCEL--NKERDVVWRKDGKIVV--EKPGRIVPGV 11262

Query: 1610  KG-EAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1649
              G   AL I+     D+  YT T  N    + + C   VEV
Sbjct: 11263 IGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEV 11303



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 27/94 (28%), Positives = 51/94 (54%), Gaps = 2/94 (2%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             + V  G+    +A + G P+P VSW +DG ++  +   G++++       L + +V + +
Sbjct: 19305 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAE--GIKMAMQRNLCTLELFSVNRKD 19362

Query: 75    SGRYSLKATNGSGQATSTAELLVKAETAPPNFVQ 108
             SG Y++ A N SG  ++T +L V  +  PP  V+
Sbjct: 19363 SGDYTITAENSSGSKSATIKLKVLDKPGPPASVK 19396



 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 53/187 (28%), Positives = 87/187 (46%), Gaps = 17/187 (9%)

Query: 10    QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPA 69
             +P++ V + E  +A+F+A IS   +P   W   G+++  S  P  +I    G+  LT+  
Sbjct: 11401 KPIEDVTIYEKESASFDAEISEADIPG-QWKLKGELLRPS--PTCEIKAEGGKRFLTLHK 11457

Query: 70    VTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTG 129
             V    +G    +A N    A +TA L VK      +F   L+ +TV +  Q R +  +T 
Sbjct: 11458 VKLDQAGEVLYQALN----AITTAILTVK--EIELDFAVPLKDVTVPERRQARFECVLTR 11511

Query: 130   IPTPVVKFYRDGAEIQSSLD-FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST 188
                 +   +  G +I  S D F I  +G  + L+I ++  +D G Y+       G+ TS 
Sbjct: 11512 EANVI---WSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGVYTAEVE---GKKTS- 11564

Query: 189   AELLVQG 195
             A L V G
Sbjct: 11565 ARLFVTG 11571



 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 83/391 (21%), Positives = 146/391 (37%), Gaps = 53/391 (13%)

Query: 3248  VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPE-DA 3306
             VT+++G   R    +SGRP P I+W K+   L++      +   + Y+LL+++     DA
Sbjct: 29456 VTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASR---AIIDTTESYSLLIVDKVNRYDA 29512

Query: 3307  AVYTCEAKNDYGVATTSASL----------SVEVPEV----VSPDQEMPVYPPAIITPLQ 3352
               YT EA+N  G  + +  +          SV+V EV    V+   E+P        P+ 
Sbjct: 29513 GKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIPTIDGG--APVN 29570

Query: 3353  DTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQL----EIAEAYP 3408
             + +  + + A    +   T    + Y     ++ + ++     E+ Y +    E ++A  
Sbjct: 29571 NYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRVLPENIYGIGEPCETSDAVL 29630

Query: 3409  EDEGTYTFVASNAVGQVSSTANLSLEAP--------ESILHERIEQEIEMEMKEL-FSEG 3459
               E          V    ST  L+ E P           + E  +   E  MK +     
Sbjct: 29631 VSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACKAGTERWMKVVTLKPT 29690

Query: 3460  ESEHSERDTRDAFSDSEDI-------DHKSMAAKR---YASRISSTSSWPEYFKPSFTQK 3509
               EH    T  + ++ E         + K ++  R    A  +      P     +  QK
Sbjct: 29691 VLEH----TVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQK 29746

Query: 3510  LTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKR 3569
                 +V  G PV     +   P P  +WF       + LR   +   + H   + L I+ 
Sbjct: 29747 TI--HVPAGRPVELVIPIAGRPPPAASWFFAG----SKLRESERVTVETHTKVAKLTIRE 29800

Query: 3570  VQDRDSGSYRLLAINSEGSAESTASLLVIQK 3600
                RD+G Y L   N  G+   T  ++++ K
Sbjct: 29801 TTIRDTGEYTLELKNVTGTTSETIKVIILDK 29831



 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 144/679 (21%), Positives = 239/679 (35%), Gaps = 111/679 (16%)

Query: 462  PAQEQVRKEAEKTAVTKVVVAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKETEKTF 521
            P  E+ +   ++  VTK  V  D  K           +  K ++M    E ++K    T 
Sbjct: 8970 PTPEEKKPPPKRIEVTKKAVKKDAKK-----------VVAKPKEMTPREEIVKKPPPPTT 9018

Query: 522  V-----PKVVISAAKAKEQETRISEEITKKQKQVTQEAIRQETE-ITAASMVVVATAKST 575
            +     P+++  ++KA  +E +I     KK+ Q  +EA+ ++ + +     V + + +  
Sbjct: 9019 LIPAKAPEIIDVSSKA--EEVKIMTITRKKEVQKEKEAVYEKKQAVHKEKRVFIESFEEP 9076

Query: 576  --KLETVPGAQEETTTQQDQMHLSYEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGI 633
              +LE  P  +       ++    YE+I  E +K V  +         E+D      EG 
Sbjct: 9077 YDELEVEPYTEPFEQPYYEEPDEDYEEIKVEAKKEVHEEW--------EEDF----EEG- 9123

Query: 634  TTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKV 693
                 Q    +E+   E E+              E E   + RE +  ++E  + +H + 
Sbjct: 9124 -----QEYYEREEGYDEGEE--------------EWEEAYQEREVIQVQKEVYEESHERK 9164

Query: 694  DVGKKAEAVATVVAAVDQARVREPREPG--HLEESYAQQTTLEYGYKERISAAKVAEPPQ 751
               K  E  A     V +  V E  E     +EE   Q T +    K+ +       P Q
Sbjct: 9165 VPAKVPEKKAPPPPKVIKKPVIEKIEKTSRRMEEEKVQVTKVPEVSKKIVPQKPSRTPVQ 9224

Query: 752  RPASEPHVVPKAVKPRVIQAPSETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRT 811
                E  V     K  VI          T+++      +++K  ++ TE  +HV    R 
Sbjct: 9225 EEVIEVKVPAVHTKKMVISEEKMFFASHTEEEVSVTVPEVQK--EIVTEEKIHVAISKRV 9282

Query: 812  ASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSATSSAQKITKSVKAPTVK-----P 866
              P         PK     E   A   +A +         A K+ +  K P  +     P
Sbjct: 9283 EPP---------PKVPELPEKP-APEEVAPVPIPKKVEPPAPKVPEVPKKPVPEEKKPVP 9332

Query: 867  SETRVRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVS----ITGTTVREERFEVLHGR 922
               +  A P  +P+ P    P+  K    V  KKE   +    +    V EE+  ++  R
Sbjct: 9333 VPKKEPAAPPKVPEVPKKPVPEE-KIPVPVAKKKEAPPAKVPEVQKGVVTEEKITIVTQR 9391

Query: 923  EA------------KVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYP 970
            E             KV E  +     E  V PP  V  L    V E E V +   ++   
Sbjct: 9392 EESPPPAVPEIPKKKVPEERKPVPRKEEEVPPPPKVPALPKKPVPE-EKVAVPVPVAKKA 9450

Query: 971  SPT-------VTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGT 1023
             P             + +  E  + F +  +  + R    E  AE+   ++     E   
Sbjct: 9451 PPPRAEVSKKTVVEEKRFVAEEKLSFAVPQRVEVTR---HEVSAEEEWSYS----EEEEG 9503

Query: 1024 VSTSCYLAVQVSEEFEKETTAVT-----EKFTTEEKRFVESRDVVMTDTSLTEEQAGP-- 1076
            VS S Y   +  EE E E T        E++  EEK  + S+ V      +TE Q     
Sbjct: 9504 VSISVYREEEREEEEEAEVTEYEVMEEPEEYVVEEKLHIISKRVEAEPAEVTERQEKKIV 9563

Query: 1077 GEPAAPYFITKPVVQKLVE 1095
             +P  P  I +P   K+ E
Sbjct: 9564 LKPKIPAKIEEPPPAKVPE 9582



 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 111/575 (19%), Positives = 192/575 (33%), Gaps = 121/575 (21%)

Query: 900   KEVGVSITGTTVREERFEVLHGREAKVTETARV-PAPVEIPVTP------PTLVSGLKNV 952
             K +  +I+G T  EE       R A V E  R  P  + +PV        P++       
Sbjct: 25349 KTLEATISGLTAGEEYVF----RVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTF 25404

Query: 953   TVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGR 1012
              V   E + ++    G P  TV W ++   ++ +    ++    +  L I+EA  ED G 
Sbjct: 25405 NVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGT 25464

Query: 1013  FTCSAVNEAGTVSTSCYLAV---------------------------------QVSEEF- 1038
             +     N AG+++    + V                                 Q+S    
Sbjct: 25465 YELCVSNSAGSITVPITIIVLDRPGPPGPIRIDEVSCDSITISWNPPEYDGGCQISNYIV 25524

Query: 1039  -EKETTAVTEKFTTEEKRFVESRDVVMT----------------DTSLTEEQA------- 1074
              +KETT+ T    ++       + V +T                 +S +E  A       
Sbjct: 25525 EKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFRVCAENRYGKSSYSESSAVVAEYPF 25584

Query: 1075  -GPGEPAAPYFITKPVVQKLV-------EGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGY 1126
               PG P  P  +       LV       +GGS V G  +    +  + W K+   L    
Sbjct: 25585 SPPGPPGTPKVVHATKSTMLVTWQVPVNDGGSRVIGYHLEYKERSSILWSKANKILIADT 25644

Query: 1127  RYKVSYNKQTGECKLVISMTFADDAG---EYTIVVRNKHGETSASASLLEEADYELLMKS 1183
             + KVS                  D G   EY +   N  G    S S             
Sbjct: 25645 QMKVS----------------GLDEGLMYEYRVYAENIAGIGKCSKSC------------ 25676

Query: 1184  QQEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI------RKKMAKDTVVVR 1237
               E +          +P+V       V  ++ K +    A I      R+++     +  
Sbjct: 25677 --EPVPARDPCDPPGQPEVTNITRKSVSLKWSKPHYDGGAKITGYIVERRELPDGRWLKC 25734

Query: 1238  TYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISES-EAVESGFDSR 1296
              Y   QE +    E    +  E+R+      + + E  E    + + +  E      D +
Sbjct: 25735 NYTNIQETYFEVTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVK 25794

Query: 1297  IKNYRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVL 1355
              ++  +++ G  +  +  ++G PLP I+W KDG  I+   R ++    D    L +   +
Sbjct: 25795 FRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEI-ISTDNHTLLTVKDCI 25853

Query: 1356  PEDEGIYTAFASNIKG--NAICSGKLYVEPAAPLG 1388
               D G Y     N+ G  +   + K+  +P  P G
Sbjct: 25854 RRDTGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAG 25888



 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 47/208 (22%), Positives = 76/208 (36%), Gaps = 51/208 (24%)

Query: 5397  AVFKCSVIGIPTPEVKWY---KEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRC 5453
             A   C ++G P P++KWY   KE +     + KY +S +  +HTL +      D   Y C
Sbjct: 30550 AQLSCQIVGRPLPDIKWYRFGKELI----QSRKYKMSSDGRTHTLTVMTEEQEDEGVYTC 30605

Query: 5454  RAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGP 5513
              A N VGE                 +   SK+ L                       +  
Sbjct: 30606 IATNEVGE-----------------VETSSKLLL-----------------------QAT 30625

Query: 5514  PRFIKGI---SDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQ-GRRFTVEESGTGFH 5569
             P+F  G       Y  +G+      +  G P P + W+   KL+Q     T+E +    H
Sbjct: 30626 PQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTH 30685

Query: 5570  NLFITSLVKSDEGEYRCVATNKSGMAES 5597
              +      K+  G+Y+   +N  G  ++
Sbjct: 30686 LVMKNVQRKTHAGKYKVQLSNVFGTVDA 30713



 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 2/102 (1%)

Query: 3     TQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
             T  P+   P  +  +  G     E  + G P P +SW +DG+ +  +T   V+ + +   
Sbjct: 24309 TIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATS-- 24366

Query: 63    AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
               L I    K + G+Y++ ATN +G AT    ++V  +  PP
Sbjct: 24367 TVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPP 24408



 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 29/95 (30%), Positives = 54/95 (56%), Gaps = 2/95 (2%)

Query: 4156  EPPKM-LQEMPKHA-RCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCS 4213
             EPP++ ++  P H    R G ++ ++  ISG+P P VT  ++GV LK   +F  E    +
Sbjct: 26472 EPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAEN 26531

Query: 4214  HQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV 4248
               + +K+  + D+G+Y+  A N+SG  ++  ++ V
Sbjct: 26532 LTINLKESVTADAGRYEITAANSSGTTKAFINIVV 26566



 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 50/237 (21%), Positives = 92/237 (38%), Gaps = 46/237 (19%)

Query: 1701  QKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYC 1760
             + P  +K++  +  K    A   C++  +G P   ++W   GK L  + + +M ++    
Sbjct: 30531 EAPGIRKEMKDVTTKLGEAAQLSCQI--VGRPLPDIKWYRFGKELIQSRKYKMSSDGRTH 30588

Query: 1761  SLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELE 1820
             +L        D G+ TC ATN+ G   TS+ L+++           P+   G    E+  
Sbjct: 30589 TLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQ---------ATPQFHPGYPLKEK-- 30637

Query: 1821  RMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQL 1880
                + GA+                          G T R      G P P + W+   +L
Sbjct: 30638 ---YYGAV--------------------------GSTLRLHVMYIGRPVPAMTWFHGQKL 30668

Query: 1881  IRKSKRFRVRYDGIHYLDIV---DCKSYDTGEVKVTAENPEGVIEHKVKLEIQQRED 1934
             ++ S+   +  +  HY  +V     +    G+ KV   N  G ++  + +EIQ + D
Sbjct: 30669 LQNSENITIE-NTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPD 30724



 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 32/122 (26%), Positives = 62/122 (50%), Gaps = 7/122 (5%)

Query: 4156 EPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQ 4215
            EPP + ++ P      +G  + LEC + G P   V+W+++   L+  +K++    N    
Sbjct: 7397 EPP-IFRKKPHPIETLKGADVHLECELQGTPPFHVSWYKDKRELRSGKKYKIMSENFLTS 7455

Query: 4216 LYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPVTYRENSQF-ENIGEIYGKYSRDQQ 4274
            ++I +V++ D G+Y+C A N+ G     SD  V  +  +   +F + + +I     ++ Q
Sbjct: 7456 IHILNVDAADIGEYQCKATNDVG-----SDTCVGSIALKAPPRFVKKLSDISTVVGKEVQ 7510

Query: 4275 LQ 4276
            LQ
Sbjct: 7511 LQ 7512



 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 40/181 (22%), Positives = 72/181 (39%), Gaps = 10/181 (5%)

Query: 6     PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTS---TLPGVQISFSDGR 62
             PT       ++V+EG   +        PVP VSW +DG+ +  S   T+    IS     
Sbjct: 14387 PTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHIS----- 14441

Query: 63    AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
             A L +P   +A++G Y++   N  G AT++  + V     P   ++   S   +   ++ 
Sbjct: 14442 AHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIK--ASDITKSSCKLT 14499

Query: 123   LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
              +       TP++ +  +  E        +    +  S  + +  P     + V A N V
Sbjct: 14500 WEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFFRVKAVNKV 14559

Query: 183   G 183
             G
Sbjct: 14560 G 14560



 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 3/126 (2%)

Query: 900   KEVGVSITGTTVREE-RFEVLHGREAKVTETARVPAPVEIP--VTPPTLVSGLKNVTVIE 956
             K    +ITG    EE  F V    E  +++  ++  PV     V PP         TV+ 
Sbjct: 22102 KVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLA 22161

Query: 957   GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCS 1016
             GE + ++    G P+P VTW++++  ++ +           + L I++A  ED G +   
Sbjct: 22162 GEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVK 22221

Query: 1017  AVNEAG 1022
               N AG
Sbjct: 22222 LTNSAG 22227



 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 20/167 (11%)

Query: 1516  IIVPATPSDSGEWTVVAQNRAGRS-----SISVILTVEAVEHQVKPMFVEKLKNVNIKEG 1570
             +I   T  +   + VVA N  GRS     ++ ++     +E  VKP F     + +++ G
Sbjct: 23189 VITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAF----SSYSVQVG 23244

Query: 1571  SRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTA 1630
               L+++V  +G P P I W K  D +   +  +I +  +     L I  T   D   Y  
Sbjct: 23245 QDLKIEVPISGRPKPTITWTK--DGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGI 23302

Query: 1631  TAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPEL 1677
             T  N  G+ T   ++   V   +P+P      P+G  +  +++A  +
Sbjct: 23303 TVANVVGQKTASIEI---VTLDKPDP------PKGPVKFDDVSAESI 23340



 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 25/102 (24%), Positives = 52/102 (50%), Gaps = 3/102 (2%)

Query: 95    LLVKAETAPPNFVQR---LQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQ 151
             +L+K +  PP    +     ++ VR GS +++ + ++G P P V   RDG  +++++ F 
Sbjct: 26465 VLIKEQLEPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFN 26524

Query: 152   ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193
                  +  ++ + E+   D+G Y + A NS G   +   ++V
Sbjct: 26525 TEITAENLTINLKESVTADAGRYEITAANSSGTTKAFINIVV 26566



 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 33/149 (22%), Positives = 70/149 (46%), Gaps = 17/149 (11%)

Query: 4156 EPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQ 4215
            EPP  ++E+ K     +   + LEC ++G P   VTW +N   ++ ++K+   +      
Sbjct: 4953 EPPTFIREL-KPVEVVKYSDVELECEVTGTPPFEVTWLKNNREIRSSKKYTLTDRVSVFN 5011

Query: 4216 LYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV-EPVTY-----------RENSQFENI- 4262
            L+I   +  D+G+Y+C+  N  G+    + + + EP ++           + ++ F++  
Sbjct: 5012 LHITKCDPSDTGEYQCIVSNEGGSCSCSTRVALKEPPSFIKKIENTTTVLKSSATFQSTV 5071

Query: 4263 ---GEIYGKYSRDQQLQDQGESVRAHFYD 4288
                 I   + +D Q+ D+ ++V   F D
Sbjct: 5072 AGSPPISITWLKDDQILDEDDNVYISFVD 5100



 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 3/107 (2%)

Query: 5170  PNEAIEPKDNEMPPSF---IEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPD 5226
             P E I+  D +  P     ++ L    V   T +     V G P P + W +   +L+ D
Sbjct: 13675 PTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQD 13734

Query: 5227  ERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
             +RI +E V    ++ I + ++ + G Y+  AVN+ G A +   V+++
Sbjct: 13735 KRITIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNVL 13781



 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 31/131 (23%), Positives = 57/131 (43%), Gaps = 3/131 (2%)

Query: 900   KEVGVSITGTTVREE---RFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIE 956
             K +   IT  T  EE   R   ++ +      +  VP   +  V  P +     + +V  
Sbjct: 23184 KSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQV 23243

Query: 957   GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCS 1016
             G+ + +E  ISG P PT+TW ++   ++ +    +T    +  L I+E   +D G++  +
Sbjct: 23244 GQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGIT 23303

Query: 1017  AVNEAGTVSTS 1027
               N  G  + S
Sbjct: 23304 VANVVGQKTAS 23314



 Score = 49.7 bits (117), Expect = 8e-05
 Identities = 100/470 (21%), Positives = 176/470 (37%), Gaps = 40/470 (8%)

Query: 2393  QEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLK 2452
             +E + +D+V I        L I++  + DAG Y   +     S S  V+V  +D   P +
Sbjct: 24061 EEGEFTDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQ 24120

Query: 2453  DVNVIEGTK--AVLECKVSVPDV-TSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHA 2509
             ++ V E  K  A L  +  + D    VK Y+ D++ +   +  A V     +      + 
Sbjct: 24121 NLAVKEVRKDSAFLVWEPPIIDGGAKVKNYVIDKR-ESTRKAYANVSSKCSKTSFKVENL 24179

Query: 2510  SDEGPYKL-IVGRVETNCNLSVEKIKIIRG-----------LRDLTCTETQNVVFEVELS 2557
             ++   Y   ++   E    + VE +  ++            L D++ T   ++++E    
Sbjct: 24180 TEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLTDVSQTSA-SLMWEKPEH 24238

Query: 2558  HSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA-GENMTSGKLT 2616
               G  VL    + + K + K+ I A  K+    V  +    E ++   A  E   S    
Sbjct: 24239 DGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRVKAYNEKGKSDPRV 24298

Query: 2617  VAGGAISKPLTDQ----------TVAESQEAVFECEV-ANPDSKGEWLRDGKHLPLTNNI 2665
             +    I+K LT Q          ++   ++   E  V   P     W++DG+ L  T  +
Sbjct: 24299 LGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRV 24358

Query: 2666  RSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKK---TLKNLTVTETQ 2722
               E       L I     DD G+YT     S  +A   +  + ++K    +  +   E  
Sbjct: 24359 NVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEVS 24418

Query: 2723  DAVFTVELTHPNVKGVQWIKNGVVLESNEKYAI--SVKGTIYSLRIKNCAIVDESVYGFR 2780
                  +    P   G   I N +V + +        V  T+    IK   +   + Y FR
Sbjct: 24419 ADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFR 24478

Query: 2781  L---GRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKW 2827
             +    R G SA L  + V I++ P            F  S+S D + V+W
Sbjct: 24479 IFAENRYGKSAPLDSKAV-IVQYPFKEPGPPG--TPFVTSISKDQMLVQW 24525



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 87/413 (21%), Positives = 152/413 (36%), Gaps = 79/413 (19%)

Query: 5180  EMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCS 5239
             E     ++P+    +YE  +  F  E+    +PG +W     LL P    +++  G    
Sbjct: 11394 EREVELLKPIEDVTIYEKESASFDAEISEADIPG-QWKLKGELLRPSPTCEIKAEGGKRF 11452

Query: 5240  LEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHT 5299
             L +  ++  + GE +  A+N I  A       I+  +E  +    P+          + T
Sbjct: 11453 LTLHKVKLDQAGEVLYQALNAITTA-------ILTVKEIELDFAVPLK---------DVT 11496

Query: 5300  TSSRTPSPQEIVLEVELS-----EKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNF 5354
                R  +  E VL  E +       D+ +   +  I+       D K  I+ ++   F+ 
Sbjct: 11497 VPERRQARFECVLTREANVIWSKGPDIIKSSDKFDIIA------DGKKHILVINDSQFD- 11549

Query: 5355  VDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWY 5414
              D  + + E E K+    L V  +  +F+ P+ D  + E   A F C  +      V W+
Sbjct: 11550 -DEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCE-LSHEKMHVVWF 11607

Query: 5415  KEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSE 5474
             K    +       + SE K +H L+++ V L D                         S+
Sbjct: 11608 KNDAKLHTSRTVLISSEGK-THKLEMKEVTLDDI------------------------SQ 11642

Query: 5475  IFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQ 5534
             I A + + S                   S  + +V+E  P F   + D  A        +
Sbjct: 11643 IKAQVKELS-------------------STAQLKVLEADPYFTVKLHDKTAVEKDEITLK 11683

Query: 5535  CLVRGSPRPTVYWYKDG-KLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRC 5586
             C V  S    V W+KDG ++V   +++++  G     L I      D+GEY C
Sbjct: 11684 CEV--SKDVPVKWFKDGEEIVPSPKYSIKADGLR-RILKIKKADLKDKGEYVC 11733



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 51/222 (22%), Positives = 90/222 (40%), Gaps = 26/222 (11%)

Query: 5076  PPGETLERYST-----PPGETLE-RYSTPPGETLERYSTPP----GEALERYSIPTGGPN 5125
             PP ET++R +      PP   ++ +       T+     PP    G  +  Y +     +
Sbjct: 15995 PPVETIQRTTARDPIYPPDPPIKLKIGLITKNTVHLSWKPPKNDGGSPVTHYIVECLAWD 16054

Query: 5126  PTGTFKTYPSKIEREDGTPNEHFYTPTEERGSAYEIW----RSDSFGTPNEAIEPKD--- 5178
             PTGT K    +  + D      F       G  YE       +     P+  + P D   
Sbjct: 16055 PTGTKKEAWRQCNKRD-VEELQFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQR 16113

Query: 5179  NEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYR-------NKSLLEPDERIKM 5231
              +MPPS I+     +V E T +  + +++G+P P + W++       NK  +  D  +  
Sbjct: 16114 PDMPPS-IDLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNK 16172

Query: 5232  ERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
               V + C+L I   ++ + G Y   AVN +G A     ++++
Sbjct: 16173 LVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNVL 16214



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 36/123 (29%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 915   RFEVLHGREAKVTETARVPAPVEIP--VTPPTLV---SGLKNVTVIEGESVTLECHISGY 969
             +F VL    A  ++ A VP PV +   + PP L+   +  +   +  G+++ L   I G 
Sbjct: 17186 KFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGV 17245

Query: 970   PSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCY 1029
             P P VTW +ED    +     +T     ++L IR A  ED G ++ +  N AG+ + S  
Sbjct: 17246 PFPKVTWKKEDRDAPTKARIDVTPVG--SKLEIRNAAHEDGGIYSLTVENPAGSKTVSVK 17303

Query: 1030  LAV 1032
             + V
Sbjct: 17304 VLV 17306



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 1/101 (0%)

Query: 4     QAPTFTQPLQSVVVLE-GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR 62
             Q P     L  V+ ++ G T   EA + G P PEV+W +D      +  P V+I      
Sbjct: 18199 QKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADS 18258

Query: 63    AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAP 103
             +K ++    +++ G+Y + ATN +G   + A + V  +  P
Sbjct: 18259 SKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDKPGP 18299



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 27/82 (32%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 4157  PPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQL 4216
             PPK+L  MP+    + G  + +E  + G+P P   W +    +  +      + + S  L
Sbjct: 18899 PPKIL--MPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSIL 18956

Query: 4217  YIKDVNSQDSGKYKCVAENNSG 4238
              IKDV  +DSG Y   AEN+SG
Sbjct: 18957 IIKDVTRKDSGYYSLTAENSSG 18978



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 2/109 (1%)

Query: 6     PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
             P F     +  VL G     +    G P P V+W +D   +  +T   V    ++  + L
Sbjct: 22148 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTR--VNAESTENNSLL 22205

Query: 66    TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMT 114
             TI    + + G Y +K TN +G+A  T  ++V  +  PP    ++  +T
Sbjct: 22206 TIKDACREDVGHYVVKLTNSAGEAIETLNVIVLDKPGPPTGPVKMDEVT 22254



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 14    SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73
             ++VV  G +   +A I G P+P + W +  Q +S +    ++I  +D    L++    + 
Sbjct: 22552 TIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTAR--LEIKSTDFATSLSVKDAVRV 22609

Query: 74    NSGRYSLKATNGSGQATSTAELLVKAETAPP 104
             +SG Y LKA N +G+ + T  + V     PP
Sbjct: 22610 DSGNYILKAKNVAGERSVTVNVKVLDRPGPP 22640



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 95/426 (22%), Positives = 154/426 (36%), Gaps = 86/426 (20%)

Query: 3081  VSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKL 3140
             +  P   + W+KD + L+ T R+ +++      L I      D GKYTV A  +  TA  
Sbjct: 24336 IGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTA-- 24393

Query: 3141  FVEGRDVRIRSIKKEVQVIEKQR---AVVEF-EVNEDDVDAHW----YKDGIEI-NFQVQ 3191
                       +    V V+EK       V F EV+ D V   W    Y  G +I N+ V+
Sbjct: 24394 ----------TENLSVIVLEKPGPPVGPVRFDEVSADFVVISWEPPAYTGGCQISNYIVE 24443

Query: 3192  ERHK-----YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNA---------- 3235
             +R       ++V   + R  I  T+     EY F +   NR   +  +++          
Sbjct: 24444 KRDTTTTTWHMVSATVARTTIKITKLKTGTEYQFRIFAENRYGKSAPLDSKAVIVQYPFK 24503

Query: 3236  -PEPP------------QVLQELQPVTVQSGKPARFCAVISGRPQPKISWYK--EEQLLS 3280
              P PP             ++Q  +PV     K   +   +  + +  I W K  +  +  
Sbjct: 24504 EPGPPGTPFVTSISKDQMLVQWHEPVNDGGTKIIGY--HLEQKEKNSILWVKLNKTPIQD 24561

Query: 3281  TGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEM 3340
             T FK   L +G EY              +   A+N  G+   S    V    V     + 
Sbjct: 24562 TKFKTTGLDEGLEYE-------------FKVSAENIVGIGKPS---KVSECFVARDPCDP 24605

Query: 3341  PVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQ 3400
             P  P AI+    +      +PA           K++ Y  +KK  P   +    F +  +
Sbjct: 24606 PGRPEAIVITRNNVTLKWKKPA------YDGGSKITGYIVEKKDLPDGRWMKASFTNVLE 24659

Query: 3401  LEIAEAYPEDEGTYTF--VASNAVGQVSS--------TANLSLEAPESILHERIEQEIEM 3450
              E   +   ++  Y F  +A NA G  S         TA   ++AP + L  + +  I +
Sbjct: 24660 TEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGAITARDEIDAPNASLDPKYKDVIVV 24719

Query: 3451  EMKELF 3456
                E F
Sbjct: 24720 HAGETF 24725



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 95/491 (19%), Positives = 181/491 (36%), Gaps = 79/491 (16%)

Query: 1107  GNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETS 1166
             G PKP + W K G+PL       V ++K   +  L I     +  G+YT+++ N     +
Sbjct: 27589 GKPKPSISWLKDGLPLKESEF--VRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCRIA 27646

Query: 1167  ASASLLEEADYELLMKSQQEMLY-QTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALI 1225
                +++         K +  + + + +  + +    V E   G   + Y  E ++E +  
Sbjct: 27647 VPITVITLGPPS---KPKGPIRFDEIKADSVILSWDVPEDNGGGEITCYSIE-KRETSQT 27702

Query: 1226  RKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISE 1285
               KM   +V   T+        + ++ R+  E  Y + +  +  ++           +++
Sbjct: 27703 NWKMVCSSVARTTFKVPNLVKDAEYQFRVRAENRYGVSQPLVSSII-----------VAK 27751

Query: 1286  SEAVESGFDSRIKNYRIL-EGMGVTFHC-------KMSGYPLPK-----IAWYKDGKRIK 1332
              +    G   +   Y +  +GM +T+         +++G+ + K     I W K      
Sbjct: 27752 HQFRIPGPPGKPVIYNVTSDGMSLTWDAPVYDGGSEVTGFHVEKKERNSILWQKVNTSPI 27811

Query: 1333  HGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGK----LYVEPAAPLG 1388
              G  Y+   L +G             +  +  +A N  G +  S      L V P  P G
Sbjct: 27812 SGREYRATGLVEGL------------DYQFRVYAENSAGLSSPSDPSKFTLAVSPVDPPG 27859

Query: 1389  APTYIPTLEPVSRIR---------------SLSPRSVSRSPIRMSPARMSPARMSPARMS 1433
              P YI        ++               S+  R  +   +R +   +S  + +   +S
Sbjct: 27860 TPDYIDVTRETITLKWNPPLRDGGSKIVGYSIEKRQGNERWVRCNFTDVSECQYTVTGLS 27919

Query: 1434  P---------ARMSPGRRLEETDESQL----ERLYKPVFVLKPVSFKCL---EGQTARFD 1477
             P         AR + G     +  S +    +    P+    P  F  L    G++ R  
Sbjct: 27920 PGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIK 27979

Query: 1478  LKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAG 1537
               V GRP+P   WF DG +I      ++     G+ SL +  AT    G +TV A+N +G
Sbjct: 27980 ALVQGRPVPRVTWFKDGVEIEKRMNMEIT-DVLGSTSLFVRDATRDHRGVYTVEAKNASG 28038

Query: 1538  RSSISVILTVE 1548
              +   + + V+
Sbjct: 28039 SAKAEIKVKVQ 28049



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 119/546 (21%), Positives = 206/546 (37%), Gaps = 80/546 (14%)

Query: 2044  ELTEEEKKALAE-EGKITIP--TFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVR 2100
             E TE E +  AE E  ++ P  T    K +L+ S EAP I + ++  T   G  A    +
Sbjct: 30497 EATEYEFRVFAENETGLSRPRRTAMSIKTKLT-SGEAPGIRKEMKDVTTKLGEAAQLSCQ 30555

Query: 2101  VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET 2160
             +VG+P P+ +WY+ G ++ +S R Y    +     L +     ED       A N  GE 
Sbjct: 30556 IVGRPLPDIKWYRFGKELIQS-RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEV 30614

Query: 2161  SSHAFLLVQAKQLITFTQELQD-VVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDK 2219
              + + LL+QA         L++        T+         P   + W+        G K
Sbjct: 30615 ETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWF-------HGQK 30667

Query: 2220  YRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTA-KLIVE-GAVVEFVKELQDIE 2277
                +S+          I   + E Y+ +++++   KT A K  V+   V   V  + D+E
Sbjct: 30668 LLQNSE---------NITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVE 30718

Query: 2278  V---PESYSGEL--------ECIVS---PENIEGKWYHNDV----ELKSNGKYTITSRRG 2319
             +   P+  +G +          ++S   P +  G W  N V    E K   ++ + S   
Sbjct: 30719 IQDKPDKPTGPIVIEALLKNSAVISWKPPADDGGSWITNYVVEKCEAKEGAEWQLVS-SA 30777

Query: 2320  RQNLTVKDVTKEDQGEYSFVIDGKKT-TCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVK 2378
                 T + V   +   Y F +  + T      ++   + I++   ++    G        
Sbjct: 30778 ISVTTCRIVNLTENAGYYFRVSAQNTFGISDPLEVSSVVIIKSPFEKPGAPGK--PTITA 30835

Query: 2379  VSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPAL--GLST 2436
             V+ +S    W     +     R + +  ++        +T E+     F++  L  GL  
Sbjct: 30836 VTKDSCVVAWKPPASDGGAKIRNYYLEKREKKQNKWISVTTEEIRETVFSVKNLIEGLEY 30895

Query: 2437  SGRVSVYSV----------DVITP--------------LKDVNVIEGTKAVLECKVSVPD 2472
               RV   ++          + ITP              L+++NV   + A L CKV+   
Sbjct: 30896 EFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP 30955

Query: 2473  VTSVKWYLNDEQIKPDD---RVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETN 2525
                VKWY   ++I  D    R+Q   KG   +L+I      D   Y++      G V   
Sbjct: 30956 KPIVKWYRQGKEIIADGLKYRIQEF-KGGYHQLIIASVTDDDATVYQVRATNQGGSVSGT 31014

Query: 2526  CNLSVE 2531
              +L VE
Sbjct: 31015 ASLEVE 31020



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 43/186 (23%), Positives = 73/186 (39%), Gaps = 16/186 (8%)

Query: 4084  LKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKES------------KEVFQTEELEP 4131
             +KT  P P   +   ++ PV + V       +  KE             K+     E E 
Sbjct: 11029 VKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPSPIEAER 11088

Query: 4132  KAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCRE---GDSIILECLISGEPQP 4188
             + +      + P     F   +   P K ++E+           G S I ECL+S     
Sbjct: 11089 RKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTA- 11147

Query: 4189  VVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV 4248
             + TW ++G  ++++ K +F       +L+I DV   D+G+Y CV    +    S + L V
Sbjct: 11148 ITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVV 11207

Query: 4249  EPVTYR 4254
             E +  R
Sbjct: 11208 EELPVR 11213



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 31/94 (32%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 3238  PPQVLQEL---QPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEY 3294
             PP+V  ++     +TV+ G+  R  A + GRP+P I+W KE ++L    +   + D    
Sbjct: 17905 PPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRV 17964

Query: 3295  TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3328
              L + EA   D   Y   AKN  G A  SA ++V
Sbjct: 17965 ELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNV 17998



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 9/149 (6%)

Query: 885   DTPDTYKSEAGVEVKKEVGVSITGTTVREERFEV------LHGREAKVTE-TARVPAPVE 937
             D PD    +A      E   +++G T  ++R+E         G  +K ++ T  + A  E
Sbjct: 23561 DLPDGRWMKASFTNVIETQFTVSGLT-EDQRYEFRVIAKNAAGAISKPSDSTGPITAKDE 23619

Query: 938   IPVTPPTLVSGLKNVTVIE-GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSG 996
             + +   ++    ++  V+  GE+  LE  + G P PT+ W R D +IE S   +I     
Sbjct: 23620 VELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDF 23679

Query: 997   IARLMIREAFAEDSGRFTCSAVNEAGTVS 1025
              A L++++A   D G++   A N AG+ S
Sbjct: 23680 KALLIVKDAIRIDGGQYILRASNVAGSKS 23708



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 28/93 (30%), Positives = 48/93 (51%), Gaps = 4/93 (4%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             +++  G +   +A + G PVP V+WF+DG  +       ++I+   G   L +   T+ +
Sbjct: 27968 LIIKSGESLRIKALVQGRPVPRVTWFKDG--VEIEKRMNMEITDVLGSTSLFVRDATRDH 28025

Query: 75    SGRYSLKATNGSGQATSTAELLVKAETAPPNFV 107
              G Y+++A N SG A   AE+ VK +  P   V
Sbjct: 28026 RGVYTVEAKNASGSA--KAEIKVKVQDTPGKVV 28056



 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 30/81 (37%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 4159  KMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYI 4218
             ++  ++ K    R G S+ L   +SG P PV+TW + G+ L         E   S+ L I
Sbjct: 29447 ELADDLKKTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTTE---SYSLLI 29503

Query: 4219  KD-VNSQDSGKYKCVAENNSG 4238
              D VN  D+GKY   AEN SG
Sbjct: 29504 VDKVNRYDAGKYTIEAENQSG 29524



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 12/118 (10%)

Query: 78    YSLKATNGSGQATSTAEL--LVKAETAPPNFVQRLQ----SMTVRQGSQVRLQVRVTGIP 131
             + +KA N  G++  +  L  +++ +  PP    RL     ++ V+ G  V +   VTG+P
Sbjct: 15367 FRVKAVNEIGESEPSLPLNVVIQDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLP 15426

Query: 132   TPVVKFYRDGAEIQSSLDF------QISQEGDLYSLLIAEAYPEDSGTYSVNATNSVG 183
              P +++ ++   I+   D       ++S+      L I +A  ED GTY+V A+N +G
Sbjct: 15427 MPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLG 15484



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 31/94 (32%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 12    LQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQI-SFSDGRAKLTIPAV 70
             ++ +VV  G+T  F A I G PVP   W  DG  I T     V+  +FS   + LTI   
Sbjct: 17517 IEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFS---SVLTIKNC 17573

Query: 71    TKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
              + ++G Y +  +N +G  T    L V     PP
Sbjct: 17574 LRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPP 17607



 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             + + +  G     EAH+ G P P   W +    + TS+   + +  +D  + L I  VT+
Sbjct: 18906 EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSS--HLAVHKADSSSILIIKDVTR 18963

Query: 73    ANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
              +SG YSL A N SG  T   +++V     PP
Sbjct: 18964 KDSGYYSLTAENSSGTDTQKIKVVVMDAPGPP 18995



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 26/99 (26%), Positives = 51/99 (51%), Gaps = 3/99 (3%)

Query: 3233  VNAPEPPQVLQE---LQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLH 3289
             V+  E P++  +   L  +TV++G      A ++G+P+PKI+W K + +L    +    +
Sbjct: 13682 VDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIEN 13741

Query: 3290  DGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3328
               ++ T+ ++++   D   Y  EA N  G AT    ++V
Sbjct: 13742 VPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 22/68 (32%), Positives = 39/68 (57%)

Query: 5206  VEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAK 5265
             V G P+P V W ++ +LL+P E IKM    N+C+LE+ ++ + + G+Y   A N  G   
Sbjct: 19319 VFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKS 19378

Query: 5266  SFANVDIM 5273
             +   + ++
Sbjct: 19379 ATIKLKVL 19386



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 16/154 (10%)

Query: 886   TPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAP--VEIPVTPP 943
             TP T  ++  +EV+K +          E  F +    +A V E A VP P  VE  +  P
Sbjct: 22888 TPPTGINKTNIEVEKLL-------EKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAP 22940

Query: 944   TLVSGL---KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARL 1000
              +   L   K + +  G S+ L   I G P+P V W + D +I  +    +T  S    L
Sbjct: 22941 DIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAAIIDVT--SSFTSL 22998

Query: 1001  MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQV 1034
             ++      DSG++T +  N +GT   S ++ V+V
Sbjct: 22999 VLDNVNRYDSGKYTLTLENSSGT--KSAFVTVRV 23030



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 71/362 (19%), Positives = 130/362 (35%), Gaps = 91/362 (25%)

Query: 3958  GDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSV----------- 4006
             G+    +  F+G P P VTW  ++  +  +  + I + ++ S+LT+  V           
Sbjct: 27286 GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILT 27345

Query: 4007  -----------------------------HHQNEGSITC----------------VLFNQ 4021
                                           H + G++T                 V+  +
Sbjct: 27346 IENGVGEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKR 27405

Query: 4022  YGTVKTTSMLKVKAKQ---KHDVKAHKVPVFHDYLDEEE----ELALVFDQAKGAHP--- 4071
               T +T S++  K      K    + K P F   L E E    E     +  K A     
Sbjct: 27406 DATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAP 27465

Query: 4072  ----SMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVE-------------IQVTAATPIP 4114
                 SM    +T++ L  T P     G + +  + VE             I  T    + 
Sbjct: 27466 IRDLSMKDSTKTSVILSWTKPDF--DGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVS 27523

Query: 4115  EQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMP-KHARCREG 4173
             +  ++S   F+      K +  D VT  P    + + ++   P   L ++P      R G
Sbjct: 27524 QLKEQSVLEFRVFAKNEKGL-SDPVTIGP----ITVKELIITPEVDLSDIPGAQVTVRIG 27578

Query: 4174  DSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVA 4233
              ++ LE    G+P+P ++W ++G+ LK+++  +F +      L IK+   +  GKY  + 
Sbjct: 27579 HNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVIL 27638

Query: 4234  EN 4235
             +N
Sbjct: 27639 DN 27640



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 81/377 (21%), Positives = 139/377 (36%), Gaps = 39/377 (10%)

Query: 3084  PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3143
             P  TV W KD++ L    R  I+       L IP    +D GKY +     V   K    
Sbjct: 27299 PPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPK---- 27354

Query: 3144  GRDVRIRSIKKEVQVIEKQRAVVEFEV---NEDDVDAHWYKDGIE-----INFQVQERH- 3194
                    S    V+V++   A  + +V   +   V   W    I+     IN+ +++R  
Sbjct: 27355 -------SSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDA 27407

Query: 3195  -KYVVERRIHRMFISETRQSDAGEYT----FVAGRNRSSVTLYVNAPEPPQVLQELQPVT 3249
              K       H+   +  +  D  E T     V   N   +       EP +  +   P+ 
Sbjct: 27408 TKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIR 27467

Query: 3250  VQSGKPARFCAVISGRPQPKISWYK--EEQLLSTGFKCK--FLHDGQEYTLLLIEAFPED 3305
               S K +   +VI    +P         E ++    K +  + H G   T  +  +  ++
Sbjct: 27468 DLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKE 27527

Query: 3306  AAV--YTCEAKNDYGVATTSASLSVEVPE-VVSPDQEMPVYPPAIITPLQDTVTSEGQPA 3362
              +V  +   AKN+ G++       + V E +++P+ ++   P A +T         G   
Sbjct: 27528 QSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVT------VRIGHNV 27581

Query: 3363  RFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNA 3421
               +    G     +SW      +K S F R ++ E+   L I  A  E  G YT +  NA
Sbjct: 27582 HLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNA 27641

Query: 3422  VGQVSSTANLSLEAPES 3438
             V +++    +    P S
Sbjct: 27642 VCRIAVPITVITLGPPS 27658



 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 28/98 (28%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 937   EIPVTPPTLVSGLKN--VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQ 994
             E  + P   ++G+ N  +T   G   T++  ISG P+P VTW  E+ +++ +    IT  
Sbjct: 28640 EPQIEPTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTT 28699

Query: 995   SGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
                  L ++++   DSGR+  +  N AG  + S  + V
Sbjct: 28700 KDRTTLTVKDSMRGDSGRYFLTLENTAGVKTFSVTVVV 28737



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 68/278 (24%), Positives = 109/278 (39%), Gaps = 42/278 (15%)

Query: 5186 IEPLTKRKVYENTTLG------FIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCS 5239
            +E +  +K  +N T+       F VE+    V GV+W +N  +LE +E+  +   G + S
Sbjct: 2704 VEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYS 2763

Query: 5240 LEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHT 5299
            L I N    +   Y       +G   + A + +  +  +++  P  VT        LE+ 
Sbjct: 2764 LRIKNCAIVDESVYGFR----LGRLGASARLHV--ETVKIIKKPKDVT-------ALENA 2810

Query: 5300 TSSRTPSPQEIVLEVELSEK--DVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDP 5357
            T         +  EV +S     VK F K V      E  P  K  +VS   +    +  
Sbjct: 2811 T---------VAFEVSVSHDTVPVKWFHKSV------EIKPSDKHRLVSERKVHKLMLQN 2855

Query: 5358 NMDSREGEDK----ELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKW 5413
               S  GE      +L+   ++F         + + ++PE   A F+C V     P + W
Sbjct: 2856 ISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSM-W 2914

Query: 5414 YKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATY 5451
             K  + IE    K+ I  +   H L I N    DSA Y
Sbjct: 2915 LKNGVEIEMSE-KFKIVVQGKLHQLIIMNTSTEDSAEY 2951



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 53/213 (24%), Positives = 93/213 (43%), Gaps = 22/213 (10%)

Query: 10    QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPA 69
             +PL  V V  G TA FE  +S  P     W   GQ ++ S  P  +I     +  L +  
Sbjct: 11755 KPLYGVEVFVGETAHFEIELSE-PDVHGQWKLKGQPLTAS--PDCEIIEDGKKHILILHN 11811

Query: 70    VTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTG 129
                  +G  S +A N    A S A L VK    P  F+  L  + V +  + + +  V+ 
Sbjct: 11812 CQLGMTGEVSFQAAN----AKSAANLKVK--ELPLIFITPLSDVKVFEKDEAKFECEVSR 11865

Query: 130   IPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTA 189
              P    ++ +   EI     F++ ++G  +S++I  A  ED   Y   A +      ++ 
Sbjct: 11866 EP-KTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAEDK----HTSG 11920

Query: 190   ELLVQG--------EEEVPAKKTKTIVSTAQIS 214
             +L+++G         ++V AK+ ++ V T ++S
Sbjct: 11921 KLIIEGIRLKFLTPLKDVTAKEKESAVFTVELS 11953



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 30/95 (31%), Positives = 47/95 (49%), Gaps = 2/95 (2%)

Query: 4156  EPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQ 4215
             E P    E  +     E D  +  C +S E +  V W++NG  +K+ +K++FE+    H+
Sbjct: 12820 EAPTEFVEHLEDQTVTEFDDAVFSCQLSRE-KANVKWYRNGREIKEGKKYKFEKDGSIHR 12878

Query: 4216  LYIKDVNSQDSGKYKC-VAENNSGAVESVSDLTVE 4249
             L IKD    D  +Y C V +  S A   V ++ VE
Sbjct: 12879 LIIKDCRLDDECEYACGVEDRKSRARLFVEEIPVE 12913



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 33/139 (23%), Positives = 63/139 (45%), Gaps = 8/139 (5%)

Query: 1240  VEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKN 1299
             ++D +F +   EE ++ + EY +    +  +   +  E     +++    +   D    +
Sbjct: 14339 IKDLKFKV---EEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHD 14395

Query: 1300  YRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQM--DFLQDGRASLRIPVVLPE 1357
               ++EG  ++        P+P ++W+KDGK +K  +R  M  D +    A L +P  +  
Sbjct: 14396 IIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHIS---AHLEVPKSVRA 14452

Query: 1358  DEGIYTAFASNIKGNAICS 1376
             D GIYT    N  G+A  S
Sbjct: 14453 DAGIYTITLENKLGSATAS 14471



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 88/373 (23%), Positives = 141/373 (37%), Gaps = 49/373 (13%)

Query: 3084  PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVST--AKLF 3141
             P  T  W K++ EL   DR+ I        L+I      D G+Y + A  +  +  A   
Sbjct: 15132 PVPTKVWTKEEGELD-KDRVVIDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAAR 15190

Query: 3142  VEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER-----HKY 3196
             VE  DV    +  +  V  ++  ++ +   EDD        G EI   + ER     H +
Sbjct: 15191 VEVFDVPGPVLDLKPVVTNRKMCLLNWSDPEDD-------GGSEITGFIIERKDAKMHTW 15243

Query: 3197  VVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKP 3255
                    R     T   +  EY F V  +N+      V    P   +  L P T     P
Sbjct: 15244 RQPIETERSKCDITGLLEGQEYKFRVIAKNKFGCGPPVEIG-PILAVDPLGPPT----SP 15298

Query: 3256  ARFCAVISGRPQPKISWYKEEQLLSTGFKCKFL----HDGQEY----------TLLLIEA 3301
              R       +    + W +      +  +   +    HD  ++          T  L+E 
Sbjct: 15299 ERLTYTERTKSTITLDWKEPRSNGGSPIQGYIIEKRRHDKPDFERVNKRLCPTTSFLVEN 15358

Query: 3302  FPEDAAV-YTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTV-TSEG 3359
               E     +  +A N+ G +  S  L+V     V  D E+P      ++   DT+    G
Sbjct: 15359 LDEHQMYEFRVKAVNEIGESEPSLPLNV-----VIQDDEVPPTIKLRLSVRGDTIKVKAG 15413

Query: 3360  QPARFQCRVSGTDL-KVSWYSKDKKI-KPSRFFRMTQFEDTY-----QLEIAEAYPEDEG 3412
             +P      V+G  + K+ W   +  I KP+   ++T+ E +      +L I +A  ED+G
Sbjct: 15414 EPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPKAVREDKG 15473

Query: 3413  TYTFVASNAVGQV 3425
             TYT  ASN +G V
Sbjct: 15474 TYTVTASNRLGSV 15486



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 45/179 (25%), Positives = 80/179 (44%), Gaps = 13/179 (7%)

Query: 885   DTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVT--- 941
             D PD   ++A      E    I+G T   +    +  R A    +   P+ V  P+T   
Sbjct: 26808 DLPDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNA--VGSISNPSEVVGPITCID 26865

Query: 942   ---PPTLVSGLKNVTVIE---GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQS 995
                 P +   L+   V++   G SV L   ISG P+PT+ WY++D +++++    +   +
Sbjct: 26866 SYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTT 26925

Query: 996   GIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEK 1054
              +A ++I++A   +SG +     N  G  S S  + VQ+ ++       +  K  T EK
Sbjct: 26926 DLASILIKDADRLNSGCYELKLRNAMG--SASATIRVQILDKPGPPGGPIEFKTVTAEK 26982



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 22/138 (15%)

Query: 64    KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQ------------ 111
             + T+P +       + + A N  G +  +  +   AE  P   V+R++            
Sbjct: 29401 EFTVPDLKMGQKYSFRVAAVNVKGMSEYSESI---AEIEP---VERIEIPDLELADDLKK 29454

Query: 112   SMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPE-D 170
             ++T+R G+ +RL V V+G P PV+ + + G ++ S     I    + YSLLI +     D
Sbjct: 29455 TVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASR---AIIDTTESYSLLIVDKVNRYD 29511

Query: 171   SGTYSVNATNSVGRATST 188
             +G Y++ A N  G+ ++T
Sbjct: 29512 AGKYTIEAENQSGKKSAT 29529



 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 37/168 (22%), Positives = 73/168 (43%), Gaps = 17/168 (10%)

Query: 3881  ESFGTLVNVEESEEIASERIKKDDLRELQLSASTRIDEFKTEQKEENMRFFENSFR-KRP 3939
             E  G  V   +S + A ++  K+ +++ Q +    ++  + E +     F EN     RP
Sbjct: 30461 EILGYWVEYRQSGDSAWKKSNKERIKDKQFTIGGLLEATEYEFRV----FAENETGLSRP 30516

Query: 3940  QRCP------------PSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRN 3987
             +R              P   +E++      G++    C   G P P + WY     + ++
Sbjct: 30517 RRTAMSIKTKLTSGEAPGIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIKWYRFGKELIQS 30576

Query: 3988  QNFIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKA 4035
             + + + S      LT+ +   ++EG  TC+  N+ G V+T+S L ++A
Sbjct: 30577 RKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQA 30624



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 68/278 (24%), Positives = 105/278 (37%), Gaps = 27/278 (9%)

Query: 5180  EMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCS 5239
             E P  F +PL  + V E  T     EV       VKW++N + +   ++ ++   G V  
Sbjct: 12282 EPPVEFTKPLEDQTVEEGATAVLECEVSRENAK-VKWFKNGTEILKSKKYEIVADGRVRK 12340

Query: 5240  LEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHT 5299
             L I +    +   Y C A +     K+  N++++P     V    P+T   V E ++   
Sbjct: 12341 LVIHDCTPEDIKTYTCDAKDF----KTSCNLNVVPPH---VEFLRPLTDLQVREKEMAR- 12392

Query: 5300  TSSRTPSPQEIVLEVELSEKD--VKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDP 5357
                          E ELS ++  VK F+   +I    ++    K  +  L +      D 
Sbjct: 12393 ------------FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDE 12440

Query: 5358  NMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYK-E 5416
                S E         L V E    F   + + ++ E       C V   P  EV WYK +
Sbjct: 12441 AEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEV-SKPGAEVIWYKGD 12499

Query: 5417  YMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCR 5454
                IE    +Y I  E     L I+N  L D+  Y CR
Sbjct: 12500 EEIIETG--RYEILTEGRKRILVIQNAHLEDAGNYNCR 12535



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 3/120 (2%)

Query: 77    RYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQS-MTVRQGSQVRLQVRVTGIPTPVV 135
             R   K   G      T E++VK +   P    +L   +TV+ G  +RL+  V G P P V
Sbjct: 18174 RVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEV 18233

Query: 136   KFYRD--GAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193
              + +D    ++  S   +I    D     + +A   D G Y V ATN+ G   + A + V
Sbjct: 18234 AWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 1/96 (1%)

Query: 98    KAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGD 157
             K +  PP  +   Q +T++ G ++R++  V G P P  K+ +   E+ +S    + +   
Sbjct: 18894 KEQLLPPKILMPEQ-ITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADS 18952

Query: 158   LYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193
                L+I +   +DSG YS+ A NS G  T   +++V
Sbjct: 18953 SSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVV 18988



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 94/431 (21%), Positives = 173/431 (40%), Gaps = 60/431 (13%)

Query: 2975  LKDINAEEKDTI------TFEVTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSL 3025
             L DI++E + T+      +F +TV + G    +  W K   ++++  +  + T     SL
Sbjct: 26185 LFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRT--RAYVDTTDSRTSL 26242

Query: 3026  NIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLE--KKRAMFECEVSE 3083
              I N +  D+  YT       S A+L +  + ++      +I V +  K+ A+   +V E
Sbjct: 26243 TIENANRNDSGKYTLTIQNVLSAASLTLVVKVLDTPGPPTNITVQDVTKESAVLSWDVPE 26302

Query: 3084  PDITVQWMKDD-QELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTV-VAGGNVSTAKLF 3141
              D          ++ + + +  +      +RL    T + +   Y   V+G N     + 
Sbjct: 26303 NDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIP 26362

Query: 3142  VEGRDVRIRSIKKEVQVIEKQRAVVEF---EVNEDDVDAHWYKD----GIEINFQVQERH 3194
              E         K+ V++ EK     +     +++D V   W K     G  I   V E  
Sbjct: 26363 AE--------TKEGVKITEKPSPPEKLGVTSISKDSVSLTWLKPEHDGGSRIVHYVVEAL 26414

Query: 3195  --------KYVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVT---------LYVNAP 3236
                     K  V +  H + +S  R++   EY F V   N++ ++         L     
Sbjct: 26415 EKGQKNWVKCAVAKSTHHV-VSGLRENS--EYFFRVFAENQAGLSDPRELLLPVLIKEQL 26471

Query: 3237  EPPQVLQELQP---VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQE 3293
             EPP++  +  P   V V++G   +    ISG+P PK++  ++   L    +       + 
Sbjct: 26472 EPPEIDMKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAEN 26531

Query: 3294  YTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQD 3353
              T+ L E+   DA  Y   A N  G  TT A +++ V +   P    P  P  I    ++
Sbjct: 26532 LTINLKESVTADAGRYEITAANSSG--TTKAFINIVVLDRPGP----PTGPVVISDITEE 26585

Query: 3354  TVTSEGQPARF 3364
             +VT + +P ++
Sbjct: 26586 SVTLKWEPPKY 26596



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 29/89 (32%), Positives = 43/89 (48%), Gaps = 4/89 (4%)

Query: 1087  KPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMT 1146
             K V  KL E   +   CQ+ G P P + W + G  L    +YK+S + +T    L +   
Sbjct: 30540 KDVTTKLGEAAQL--SCQIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTH--TLTVMTE 30595

Query: 1147  FADDAGEYTIVVRNKHGETSASASLLEEA 1175
               +D G YT +  N+ GE   S+ LL +A
Sbjct: 30596 EQEDEGVYTCIATNEVGEVETSSKLLLQA 30624



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 37/127 (29%), Positives = 58/127 (45%), Gaps = 5/127 (3%)

Query: 1527  EWTVVAQNRAGRSSISVI---LTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNP 1583
             E+ V  +N  G S  S I   +T ++      P F E+L+N+N++  S   +  + TG+P
Sbjct: 30896 EFRVKCENLGGESEWSEISEPITPKSDVPIQAPHFKEELRNLNVRYQSNATLVCKVTGHP 30955

Query: 1584  NPDIVWLKNSDIIVPHKYPKIRIEGTK-GEAALKIDSTVSQDSAWYTATAINKAGRDTTR 1642
              P + W +    I+     K RI+  K G   L I S    D+  Y   A N+ G  +  
Sbjct: 30956 KPIVKWYRQGKEIIADGL-KYRIQEFKGGYHQLIIASVTDDDATVYQVRATNQGGSVSGT 31014

Query: 1643  CKVNVEV 1649
               + VEV
Sbjct: 31015 ASLEVEV 31021



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 92/458 (20%), Positives = 162/458 (35%), Gaps = 75/458 (16%)

Query: 5206 VEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAK 5265
            V G P    KWY++   L   ++ ++    NV  L+  + +  + G+Y     N +G + 
Sbjct: 4040 VAGTPELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSGQYTFEISNEVGSSS 4099

Query: 5266 SFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSE-KDVKEF 5324
                  ++   +R +A   P   + +   D     + R        L + +S  KD KE 
Sbjct: 4100 CETTFTVL---DRDIA---PFFTKPLRNVDSVVNGTCRLDCKIAGSLPMRVSWFKDGKEI 4153

Query: 5325 EKQVKI-VTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFI 5383
                +  +   E T   + + V ++    NF     +S   +D    +   + + PP F+
Sbjct: 4154 AASDRYRIAFVEGTASLEIIRVDMNDAG-NFTCRATNSVGSKDSSGAL---IVQEPPSFV 4209

Query: 5384 MPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNV 5443
                   +   S    K +  G     ++W+K    +      Y+  E   S +L++  V
Sbjct: 4210 TKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEALES-SLELYLV 4268

Query: 5444 CLSDSATYRCRAVNCVGEAICRGFLTMGDSEIF------AVIAKKS-------------- 5483
              SDS TY C+  N  G   C   L + +   F      + + KK               
Sbjct: 4269 KTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPP 4328

Query: 5484 -KVTLSSLMEELVLKSNYTDSFFE---------------------------------FQV 5509
             K+T  +   E+   S +  SF E                                   +
Sbjct: 4329 IKITWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMCEAQNEAGSDHCSSIVI 4388

Query: 5510 VEGPPRFIKGISDCYAPIGTAAYFQCL----VRGSPRPTVYWYKDGKLVQGRRFTVEESG 5565
            V+  P F K     + PI     +  +    V G+P   + W+KD  +++  R       
Sbjct: 4389 VKESPYFTKE----FKPIEVLKEYDVMLLAEVAGTPPFEITWFKDNTILRSGRKYKTFIQ 4444

Query: 5566 TGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
                +L I   V +D GEY+C  TN+ G +   A +TL
Sbjct: 4445 DHLVSLQILKFVAADAGEYQCRVTNEVGSSICSARVTL 4482



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 128/572 (22%), Positives = 207/572 (36%), Gaps = 77/572 (13%)

Query: 5053  TPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGE 5112
             +PP E  E    P    LE    PP E +E    P      + + PP + +     P   
Sbjct: 10660 SPPPEVFEE---PEEVALEE---PPAEVVEE---PEPAAPPQVTVPPKKPVPEKKAPAVV 10710

Query: 5113  ALERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEHFYTPTEERGSAYEIWRSDSFGTPNE 5172
             A +    P   P         P ++  E   P      P +      ++        P +
Sbjct: 10711 AKKPELPPVKVPE-------VPKEVVPEKKVP---LVVPKKPEAPPAKVPEVPKEVVPEK 10760

Query: 5173  AIE-PKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKM 5231
              +  PK  E+PP+ +  + K+ V E      + E    P P V  Y     + P+E I  
Sbjct: 10761 KVAVPKKPEVPPAKVPEVPKKPVLEEKPAVPVPERAESPPPEV--YEEPEEIAPEEEIAP 10818

Query: 5232  ER-----VGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALP--- 5283
             E      V      E+      E  + +     +    K  A     P+ E+V+  P   
Sbjct: 10819 EEEKPVPVAEEEEPEVPPPAVPEEPKKIIPEKKVPVIKKPEAPPPKEPEPEKVIEKPKLK 10878

Query: 5284  ---------PPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVP 5334
                      PP        F L+     + P   ++  +VEL+   V   EK+V+ + +P
Sbjct: 10879 PRPPPPPPAPPKEDVKEKIFQLKAIPKKKVPEKPQVPEKVELTPLKVPGGEKKVRKL-LP 10937

Query: 5335  EFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKEL-KIDLEVFEMPP------RFIMPIC 5387
             E  P+ K  +V   VL      P  +  + E K+L K+       PP         +P  
Sbjct: 10938 ERKPEPKEEVVLKSVLRKR---PEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTV 10994

Query: 5388  ---DFKIPENSDAVFKCSVIGIPTPEV--KWYKEYMCIEPDNIKYVISEEKGSHTLKIRN 5442
                + KIPE +        I +P PE   K   E   I+P  ++   +      T+ +  
Sbjct: 10995 TKRERKIPEPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVG 11054

Query: 5443  VCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTD 5502
                +++   +  A    G    +G      S I A   ++ K+   S  E+   ++ +T 
Sbjct: 11055 K-KAEAKAPKEEAAKPKGPI--KGVPKKTPSPIEA---ERRKLRPGSGGEKPPDEAPFT- 11107

Query: 5503  SFFEFQVVEGPPRFIKGISDCYAP----IGTAAYFQCLVRGSPRPTVYWYKDGKLVQG-- 5556
                 +Q+   P +F+K I D        +G++A F+CLV  S   T  W KDG  ++   
Sbjct: 11108 ----YQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITT-WMKDGSNIRESP 11162

Query: 5557  -RRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
               RF  +      H   I  +  SD GEY CV
Sbjct: 11163 KHRFIADGKDRKLH---IIDVQLSDAGEYTCV 11191



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 2045  LTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERI-QSQTVGQGSDAHFRVRVVG 2103
             ++ + +K +++  ++++P    D +        P  F+ +  + TV  G D    V  +G
Sbjct: 22121 VSAQNEKGISDPRQLSVPVIAKDLV-------IPPAFKLLFNTFTVLAGEDLKVDVPFIG 22173

Query: 2104  KPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGE 2159
             +P P   W+K+ V ++++ R+     E+N   L I+D   ED    +VK  N AGE
Sbjct: 22174 RPTPAVTWHKDNVPLKQTTRVNAESTENNSL-LTIKDACREDVGHYVVKLTNSAGE 22228



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 94/454 (20%), Positives = 173/454 (38%), Gaps = 69/454 (15%)

Query: 3202  IHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNAPEPPQVLQELQP------------V 3248
             I++  I   +  +  EY F +   N++ V  + + P P  V ++L+             +
Sbjct: 22893 INKTNIEVEKLLEKHEYNFRICAINKAGVGEHADVPGPIIVEEKLEAPDIDLDLELRKII 22952

Query: 3249  TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPE-DAA 3307
              +++G   R    I GRP P++ W K +  +        +     +T L+++     D+ 
Sbjct: 22953 NIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIR---DAAIIDVTSSFTSLVLDNVNRYDSG 23009

Query: 3308  VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPV-----------YPPAII---TPLQD 3353
              YT   +N  G  T SA ++V V +  SP   + V           + P ++   + +++
Sbjct: 23010 KYTLTLENSSG--TKSAFVTVRVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKN 23067

Query: 3354  TVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTY----------QLE 3402
              +  + +  R       T+  K SW     +   S +FR+T  E+ Y           ++
Sbjct: 23068 YIVEKREATRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTA-ENEYGIGLPAQTADPIK 23126

Query: 3403  IAEAYPEDEGTYTF--VASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGE 3460
             +AE  P+  G  T   V  N+V       +LS   PE     +I Q I +EM+   SE  
Sbjct: 23127 VAEV-PQPPGKITVDDVTRNSV-------SLSWTKPEHDGGSKIIQYI-VEMQAKHSEKW 23177

Query: 3461  SEHSERDTRDA----FSDSEDIDHKSMAAKRYASRISSTSSWPEYFK-----PSFTQKLT 3511
             SE +   +  A     +  E+   + +A          + + P   K     P      +
Sbjct: 23178 SECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFS 23237

Query: 3512  FKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQ 3571
                V  G+ +     +   P P +TW  +  P+    R  +    DL    ++L IK   
Sbjct: 23238 SYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDL----TTLSIKETH 23293

Query: 3572  DRDSGSYRLLAINSEGSAESTASLLVIQKGQDEK 3605
               D G Y +   N  G   ++  ++ + K    K
Sbjct: 23294 KDDGGQYGITVANVVGQKTASIEIVTLDKPDPPK 23327



 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 81/381 (21%), Positives = 138/381 (36%), Gaps = 63/381 (16%)

Query: 3076  MFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNV 3135
             +F      P  T  W K D  L +  R  I        L + +   +DAGKYT+    N 
Sbjct: 28377 LFIAYQGRPTPTAVWSKPDSNLSL--RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNS 28434

Query: 3136  STAKLFVEGRDVRIRSIKKEVQVIEKQRA---VVEFEVNEDDVDAHWYKDGIEINFQVQE 3192
              +            +SI   V+V++       +   +V        W    ++   ++  
Sbjct: 28435 GS------------KSITFTVKVLDTPGPPGPITFKDVTRGSATLMWDAPLLDGGARI-- 28480

Query: 3193  RHKYVVERRIHR----MFISE--TRQ----SDAGE----YTFVAGRNRSSVTLYVNAPEP 3238
              H YVVE+R         ISE  TRQ    +D  E    Y  V+  N   V      PEP
Sbjct: 28481 -HHYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGVPYYFRVSAVNEYGVGEPYEMPEP 28539

Query: 3239  PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQ---LLSTGFKCKFLHDGQEYT 3295
                 ++  P       P R   V + +    ++W K +       TG+  +    G ++ 
Sbjct: 28540 IVATEQPAP-------PRRLDVVDTSKSSAVLAWLKPDHDGGSRITGYLLEMRQKGSDFW 28592

Query: 3296  L---------LLIEAFPEDAAV-YTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPP 3345
             +           +E   E     +  +AKND G +    + S  + +      E  + P 
Sbjct: 28593 VEAGHTKQLTFTVERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIK------EPQIEPT 28646

Query: 3346  AIITPLQDTVTS--EGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLE 3402
             A +T + + + +   G P      +SG    KV+W  ++ ++K +    +T  +D   L 
Sbjct: 28647 ADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLT 28706

Query: 3403  IAEAYPEDEGTYTFVASNAVG 3423
             + ++   D G Y     N  G
Sbjct: 28707 VKDSMRGDSGRYFLTLENTAG 28727



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 27/92 (29%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 4171 REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
            +EG +  + C  S  P     WF+NG +LK   + + E  +  H+L I DV ++D G+Y 
Sbjct: 8757 KEGQTCTMTCQFS-VPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYT 8815

Query: 4231 CVAENNSGAVESVSDLTVEPVTYRENSQFENI 4262
            C  E+    +E+ ++L +E    +   + +NI
Sbjct: 8816 CKYED----LETSAELRIEAEPIQFTKRIQNI 8843



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 35/124 (28%), Positives = 53/124 (42%), Gaps = 4/124 (3%)

Query: 64    KLTIPAVTKANSGRYSLKATNGSGQATS---TAELLVKAETAPPNF-VQRLQSMTVRQGS 119
             K T+  + + ++  Y + A N  GQ      T  +  K E APP   +     +T+R G 
Sbjct: 16775 KYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGE 16834

Query: 120   QVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNAT 179
                L  R +G P P V +++D A++       I       +L   +A   DSG Y V   
Sbjct: 16835 AFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVE 16894

Query: 180   NSVG 183
             NS G
Sbjct: 16895 NSTG 16898



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 31/138 (22%), Positives = 64/138 (46%), Gaps = 22/138 (15%)

Query: 898   VKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIP------------VTPPTL 945
             V K++ + +TG         +  G++ K    AR    V +P            + PP +
Sbjct: 18852 VVKDLSLVVTG---------LKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKI 18902

Query: 946   VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREA 1005
             +   + +T+  G+ + +E H+ G P PT  W + + ++ +S    +      + L+I++ 
Sbjct: 18903 LMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLAVHKADSSSILIIKDV 18961

Query: 1006  FAEDSGRFTCSAVNEAGT 1023
               +DSG ++ +A N +GT
Sbjct: 18962 TRKDSGYYSLTAENSSGT 18979



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 37/141 (26%), Positives = 61/141 (43%), Gaps = 15/141 (10%)

Query: 5152  TEERGSAYEIWRSDSFGTPNEAIEP-----KDNEMPPSFIEPLTKRKVYENT---TLGFI 5203
             TE +     I+  +S G    A+ P     +D  +PP        RKV       TL   
Sbjct: 21822 TENQEYKIRIYAMNSEGLGEPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLF 21881

Query: 5204  VEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGE 5263
             V ++G P P VKW R+    E  ++  +E   +   L + N+ + + G+Y+    N  G 
Sbjct: 21882 VPIKGRPAPEVKWARDHG--ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGS 21939

Query: 5264  AKSFANVDIM-----PQEERV 5279
               +F NV ++     PQ+ +V
Sbjct: 21940 KSAFVNVRVLDTPGPPQDLKV 21960



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 108/486 (22%), Positives = 179/486 (36%), Gaps = 69/486 (14%)

Query: 2611  TSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPDSKGEW--LRDGKHLPLTNNIRSE 2668
             T   +T+A G   KP+ D     S+   +  E+   D + EW  +     L +T    S+
Sbjct: 23932 TKNSITLAWG---KPIYD---GGSEILGYVVEICKADEE-EWQIVTPQTGLRVTRFEISK 23984

Query: 2669  SDGHKR-RLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTL-KNLTVTETQDAVF 2726
                H+  ++ + A     +GE T    T K   KL+   + +   L K + V     A  
Sbjct: 23985 LTEHQEYKIRVCALNKVGLGEATSVPGTVKPEDKLEAPELDLDSELRKGIVVRAGGSARI 24044

Query: 2727  TVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYS-LRIKNCAIVDESVYGFRLGRLG 2785
              +         + W +     E  +K  I  KG  Y+ L I NC   D   Y  +L    
Sbjct: 24045 HIPFKGRPTPEITWSREEG--EFTDKVQIE-KGVNYTQLSIDNCDRNDAGKYILKLENSS 24101

Query: 2786  ASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSE 2845
              S    V TVK++  P      +N  V     V  D+  + W    ++     K+ ++ +
Sbjct: 24102 GSKSAFV-TVKVLDTPGPP---QNLAVK---EVRKDSAFLVWEPPIIDGGAKVKNYVIDK 24154

Query: 2846  RKVHKLMLQNISPS-------------DAGEYTAVVGQLECKAKLFVETLHITKTMKNIE 2892
             R+  +    N+S                A  Y  V+ + E    + VET+   K  +   
Sbjct: 24155 RESTRKAYANVSSKCSKTSFKVENLTEGAIYYFRVMAENEFGVGVPVETVDAVKAAEPPS 24214

Query: 2893  VPETKTASFECEVSHFNVPSMWLKN---------GVEIEM----SEKFKIVVQGKLHQLI 2939
              P   T +   +VS  +   MW K          G  +EM    +EK+ IV + K+   +
Sbjct: 24215 PPGKVTLT---DVSQTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAV 24271

Query: 2940  IMNTSTEDSAEYTF--------------VCGNDQVSATLTVTP-IMITSMLKDINAEEKD 2984
             +  T      EY F              V G   ++  LT+ P + +      I A E  
Sbjct: 24272 V--TGLSSGQEYQFRVKAYNEKGKSDPRVLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDL 24329

Query: 2985  TITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGK 3044
              I   V +     +  W+K+G  +K T +  +     +  L+I+  +  D   YT  A  
Sbjct: 24330 KIEIPV-IGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATN 24388

Query: 3045  ATSTAT 3050
             +  TAT
Sbjct: 24389 SAGTAT 24394



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 1/103 (0%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             +VV  G T   EA I G P+P+V W +DG+ +   T   ++I  +  +  L +    + +
Sbjct: 24717 IVVHAGETFVLEADIRGKPIPDVVWSKDGKELE-ETAARMEIKSTIQKTTLVVKDCIRTD 24775

Query: 75    SGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQ 117
              G+Y LK +N  G  +    + V     PP    ++  +T  +
Sbjct: 24776 GGQYILKLSNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEK 24818



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 3/98 (3%)

Query: 2     TTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD- 60
             +T  P F + L +    EG +  FE  +SG P P + W +DGQ +S    P ++I     
Sbjct: 31791 STLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLG--PNIEIIHEGL 31848

Query: 61    GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVK 98
                 L I      ++G Y + ATN +G  +  A L V+
Sbjct: 31849 DYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVE 31886



 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 47/211 (22%), Positives = 87/211 (41%), Gaps = 12/211 (5%)

Query: 6     PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
             P     LQ   V   S A F    +G P P   W +DG+ I+       ++S   G   L
Sbjct: 32852 PVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQG--GKYKLSEDKGGFFL 32909

Query: 66    TIPAVTKANSGRYSLKATNGSGQATSTAELLVKA---ETAPPNFVQRLQSMTVRQGSQVR 122
              I     ++SG Y+    N +G  +S+ +L +KA     A     Q+   +T ++ + V+
Sbjct: 32910 EIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQKVSTQKTSEITPQKKAVVQ 32969

Query: 123   LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGT-YSVNATNS 181
              ++    + +  +K     +E +S     + +E     +LI+E   + + T    +  + 
Sbjct: 32970 EEISQKALRSEEIKM----SEAKSQEKLALKEEAS--KVLISEEVKKSAATSLEKSIVHE 33023

Query: 182   VGRATSTAELLVQGEEEVPAKKTKTIVSTAQ 212
                 TS A   V+   E+ A  T+  ++  Q
Sbjct: 33024 EITKTSQASEEVRTHAEIKAFSTQMSINEGQ 33054



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 2/95 (2%)

Query: 3944 PSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRN--QNFIIHSLENYSIL 4001
            P+F Q ++S  V EG +  F  H  G+P P V+W+ +   I  +      I   +  + L
Sbjct: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65

Query: 4002 TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAK 4036
            T+ +V   N G  +    N  G   +T+ L VKA+
Sbjct: 66   TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAE 100



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 27/97 (27%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 4154  TNEPPKMLQEMPKHA--RCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVN 4211
             T E P++  ++   A    + G  I L   ++G+P+P +TW +  ++LKQ+++   E V 
Sbjct: 13684 TQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVP 13743

Query: 4212  CSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV 4248
                 + I D    D+G Y   A N  G   +V ++ V
Sbjct: 13744 KKSTVTIVDSKRSDTGTYIIEAVNVCGRATAVVEVNV 13780



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 36/163 (22%), Positives = 69/163 (42%), Gaps = 15/163 (9%)

Query: 870   RVRAEPTPLPQFPFADTPDTYKSEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTET 929
             R    P  +PQ  +  T    K++          V+I+  +   +   +L          
Sbjct: 19238 RCNTAPHQIPQEEYTATGLEEKAQYQFRAIARTAVNISPPSEPSDPVTIL---------A 19288

Query: 930   ARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDF 989
               VP  +++ V   +L+      TV  G +V L+  + G P PTV+W ++   ++ +   
Sbjct: 19289 ENVPPRIDLSVAMKSLL------TVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGI 19342

Query: 990   QITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
             ++  Q  +  L +     +DSG +T +A N +G+ S +  L V
Sbjct: 19343 KMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 19385



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 31/131 (23%), Positives = 56/131 (42%), Gaps = 3/131 (2%)

Query: 66    TIPAVTKANSGRYSLKATNGSGQATST---AELLVKAETAPPNFVQRLQSMTVRQGSQVR 122
             TI  +T      + + A N  G++        ++ +     P+      +  V+   Q++
Sbjct: 25354 TISGLTAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLK 25413

Query: 123   LQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSV 182
             + V   G P   V + +DG  ++ +    +S    + SL I EA  ED GTY +  +NS 
Sbjct: 25414 IDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSA 25473

Query: 183   GRATSTAELLV 193
             G  T    ++V
Sbjct: 25474 GSITVPITIIV 25484



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 2/91 (2%)

Query: 14    SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73
             +V++  G     EA +SG P P + W +DG+ +  +    ++I  +D    L     T+ 
Sbjct: 21470 TVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTA--KLEIKIADFSTNLVNKDSTRR 21527

Query: 74    NSGRYSLKATNGSGQATSTAELLVKAETAPP 104
             +SG Y+L ATN  G A     + V     PP
Sbjct: 21528 DSGAYTLTATNPGGFAKHIFNVKVLDRPGPP 21558



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 81/393 (20%), Positives = 142/393 (36%), Gaps = 77/393 (19%)

Query: 3084  PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3143
             P   V+W K D E++  D   I        L++ +    D+GKYT+    +  T   FV 
Sbjct: 22970 PTPEVKWGKVDGEIR--DAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVT 23027

Query: 3144  GRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR-- 3201
              R +   S    ++V          E+ +D V   W    ++   +++    Y+VE+R  
Sbjct: 23028 VRVLDTPSPPVNLKVT---------EITKDSVSITWEPPLLDGGSKIK---NYIVEKREA 23075

Query: 3202  -----------IHR-MFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVT 3249
                         H+  +  +  Q     Y  V   N   + L     +P +V +  QP  
Sbjct: 23076 TRKSYAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENEYGIGLPAQTADPIKVAEVPQP-- 23133

Query: 3250  VQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLI--------EA 3301
                  P +       R    +SW K E            HDG    +  I        E 
Sbjct: 23134 -----PGKITVDDVTRNSVSLSWTKPE------------HDGGSKIIQYIVEMQAKHSEK 23176

Query: 3302  FPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPL--QDTV---- 3355
             + E A V + +A     V T        +  VV+ +++    P ++  P+  +D V    
Sbjct: 23177 WSECARVKSLQA-----VITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPD 23231

Query: 3356  ---------TSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAE 3405
                         GQ  + +  +SG     ++W      +K +    +T   D   L I E
Sbjct: 23232 VKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKE 23291

Query: 3406  AYPEDEGTYTFVASNAVGQVSSTANL-SLEAPE 3437
              + +D G Y    +N VGQ +++  + +L+ P+
Sbjct: 23292 THKDDGGQYGITVANVVGQKTASIEIVTLDKPD 23324



 Score = 45.8 bits (107), Expect = 0.001
 Identities = 26/91 (28%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 14    SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73
             ++VV  G T   EA + G P+P + W R  + I  S     +I  +D +A L +    + 
Sbjct: 23634 TIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESA--RCEIKNTDFKALLIVKDAIRI 23691

Query: 74    NSGRYSLKATNGSGQATSTAELLVKAETAPP 104
             + G+Y L+A+N +G  +    + V     PP
Sbjct: 23692 DGGQYILRASNVAGSKSFPVNVKVLDRPGPP 23722



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 26/90 (28%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 5183 PSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPD--ERIKMERVGNVCSL 5240
            P+F +PL    V E +T  F   + G PVP V W+R+  ++       +++        L
Sbjct: 6    PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65

Query: 5241 EISNIQKGEGGEYMCHAVNIIGEAKSFANV 5270
             I  + K   G Y   A N  G+A S A +
Sbjct: 66   TIPAVTKANSGRYSLKATNGSGQATSTAEL 95



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 22/91 (24%), Positives = 38/91 (41%)

Query: 5513 PPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLF 5572
            PP  + G+ +     G +   +C + G P PTV WY++   ++          +G   L 
Sbjct: 942  PPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM 1001

Query: 5573 ITSLVKSDEGEYRCVATNKSGMAESFAALTL 5603
            I      D G + C A N++G   +   L +
Sbjct: 1002 IREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 2367  VCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2425
             V EG+ + + V      V  V W KDG+EV+ SDR+ +  D  S  L +    + DAG Y
Sbjct: 14398 VIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIY 14457

Query: 2426  SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVS 2469
             + T+     S +  ++V  + +  P KD+   + TK+   CK++
Sbjct: 14458 TITLENKLGSATASINVKVIGLPGPCKDIKASDITKS--SCKLT 14499



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 23/95 (24%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query: 14    SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTST----LPGVQISFSDGRAKLTIPA 69
             ++ V  G      A ++G P+P++ W ++  VI   T    +   ++S S+ + +L+IP 
Sbjct: 15407 TIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPK 15466

Query: 70    VTKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
               + + G Y++ A+N  G       + V    +PP
Sbjct: 15467 AVREDKGTYTVTASNRLGSVFRNVHVEVYDRPSPP 15501



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 1/102 (0%)

Query: 1457  PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1516
             P  +L P       G+  R +  V G+P P   W     ++V   +H  V K D +  LI
Sbjct: 18899 PPKILMPEQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTS-SHLAVHKADSSSILI 18957

Query: 1517  IVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMF 1558
             I   T  DSG +++ A+N +G  +  + + V       +P F
Sbjct: 18958 IKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDAPGPPQPPF 18999



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 52/237 (21%), Positives = 95/237 (40%), Gaps = 11/237 (4%)

Query: 14    SVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73
             SV+   G          G P P V+W +D + + +       I  +D  + LTIP VT+ 
Sbjct: 27280 SVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDAR--YSIENTDSSSLLTIPQVTRN 27337

Query: 74    NSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRL-QVRVTGIPT 132
             ++G+Y L   NG G+  S+   +   +T  P   Q+LQ   V +G+   L    +    +
Sbjct: 27338 DTGKYILTIENGVGEPKSSTVSVKVLDT--PAACQKLQVKHVSRGTVTLLWDPPLIDGGS 27395

Query: 133   PVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELL 192
             P++ +  +  +        +S +    S  + +   +    + V A N +G         
Sbjct: 27396 PIINYVIEKRDATKRTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEP----- 27450

Query: 193   VQGEEEVPAKKTKTIVSTAQISESRQTR-IEKKIEAHFDARSIATVEMVIDGAAGQQ 248
              +  E V A +    +    + +S +T  I    +  FD  S+ T  +V     G+Q
Sbjct: 27451 CETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQ 27507



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 83/442 (18%), Positives = 141/442 (31%), Gaps = 64/442 (14%)

Query: 5169  TPNEAIEPKDNE---MPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEP 5225
             T     EPK  E     P  +  L    V  ++   F V+  G P P   W ++   +  
Sbjct: 32835 TVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKAITQ 32894

Query: 5226  DERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPP 5285
               + K+        LEI      + G Y C   N  G   S   + I   ++        
Sbjct: 32895 GGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEAQ---K 32951

Query: 5286  VTHQHVMEFD------LEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPD 5339
             V+ Q   E        ++   S +    +EI +    S++ +   E+  K++   E    
Sbjct: 32952 VSTQKTSEITPQKKAVVQEEISQKALRSEEIKMSEAKSQEKLALKEEASKVLISEEVK-- 33009

Query: 5340  HKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVF 5399
              KS   SL+    + V   +       +E++   E+     +         I E    V 
Sbjct: 33010 -KSAATSLEK---SIVHEEITKTSQASEEVRTHAEIKAFSTQM-------SINEGQRLVL 33058

Query: 5400  KCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCV 5459
             K ++ G    +VKW    + +  ++ +Y         TL I+     D     C      
Sbjct: 33059 KANIAG--ATDVKWVLNGVELT-NSEEYRYGVSGSDQTLTIKQASHRDEGILTC------ 33109

Query: 5460  GEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKG 5519
                                   K+K  +     +L L    +D+          P FI  
Sbjct: 33110 --------------------ISKTKEGIVKCQYDLTLSKELSDA----------PAFISQ 33139

Query: 5520  ISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKS 5579
                     G    F C + G P P + W+K+   +              ++L I +   S
Sbjct: 33140 PRSQNINEGQNVLFTCEISGEPSPEIEWFKNNLPISISSNVSISRSRNVYSLEIRNASVS 33199

Query: 5580  DEGEYRCVATNKSGMAESFAAL 5601
             D G+Y   A N  G   + A+L
Sbjct: 33200 DSGKYTIKAKNFRGQCSATASL 33221



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 53/240 (22%), Positives = 87/240 (36%), Gaps = 56/240 (23%)

Query: 934  APVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF 993
            A  ++ V  P     L++VT+ EG++ T+ C  S  P+    W+R    ++     +   
Sbjct: 8736 ASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFS-VPNVKSEWFRNGRILKPQGRHKTEV 8794

Query: 994  QSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEE 1053
            +  + +L I +  AED G++TC             Y  ++ S E   E   +  +FT   
Sbjct: 8795 EHKVHKLTIADVRAEDQGQYTCK------------YEDLETSAELRIEAEPI--QFTKRI 8840

Query: 1054 KRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHV 1113
            +  V S                                   E  S  F C+V  +    V
Sbjct: 8841 QNIVVS-----------------------------------EHQSATFECEVSFD-DAIV 8864

Query: 1114 YWKKSGVPLTTGYRYKVSYNKQTGECK-LVISMTFADDAGEYTIVVR-NKHGETSASASL 1171
             W K    LT   +Y     +  G C  + I     DD G Y+++ R    GE  ++A L
Sbjct: 8865 TWYKGPTELTESQKYNF---RNDGRCHYMTIHNVTPDDEGVYSVIARLEPRGEARSTAEL 8921



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTV 1530
             G T RF   + G P+P   W  DG +I  D  H  V  ++ +  L I      D+GE+ +
Sbjct: 17525 GTTVRFPAIIRGVPVPTAKWTTDGSEIKTD-EHYTVETDNFSSVLTIKNCLRRDTGEYQI 17583

Query: 1531  VAQNRAGRSSISVILTV 1547
                N AG  +++V LTV
Sbjct: 17584 TVSNAAGSKTVAVHLTV 17600



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 36/133 (27%), Positives = 52/133 (39%), Gaps = 19/133 (14%)

Query: 1052  EEKRFVESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVE-------------GGS 1098
             EEK   + R +  T  +++     P EP+ P  I    V   ++             G +
Sbjct: 19257 EEKAQYQFRAIARTAVNISP----PSEPSDPVTILAENVPPRIDLSVAMKSLLTVKAGTN 19312

Query: 1099  VVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVV 1158
             V     V G P P V WKK G  L      K++  +    C L +      D+G+YTI  
Sbjct: 19313 VCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNL--CTLELFSVNRKDSGDYTITA 19370

Query: 1159  RNKHGETSASASL 1171
              N  G  SA+  L
Sbjct: 19371 ENSSGSKSATIKL 19383



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 3/96 (3%)

Query: 940   VTPPTLVSGLK---NVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSG 996
             V PP +    K    + V  GES  ++  I G P PT+ W + D ++ ++   +I     
Sbjct: 22538 VDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDF 22597

Query: 997   IARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
                L +++A   DSG +   A N AG  S +  + V
Sbjct: 22598 ATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 154/766 (20%), Positives = 292/766 (38%), Gaps = 114/766 (14%)

Query: 2662  TNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSK--TSAKLKVEAVKIKKTLKNLTVT 2719
             T+ ++ E   +  +L I     +D G+Y  K+  S    SA + V+ +      +NL V 
Sbjct: 24066 TDKVQIEKGVNYTQLSIDNCDRNDAGKYILKLENSSGSKSAFVTVKVLDTPGPPQNLAVK 24125

Query: 2720  ETQ-DAVFTVELTHPNVKGVQWIKNGVV--LESNEK-YA-ISVKGTIYSLRIKNCAIVDE 2774
             E + D+ F V    P + G   +KN V+   ES  K YA +S K +  S +++N  + + 
Sbjct: 24126 EVRKDSAFLV-WEPPIIDGGAKVKNYVIDKRESTRKAYANVSSKCSKTSFKVEN--LTEG 24182

Query: 2775  SVYGFR-LGRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKS-- 2831
             ++Y FR +        + VETV  +K  +  +     T+     VS  +  + W      
Sbjct: 24183 AIYYFRVMAENEFGVGVPVETVDAVKAAEPPSPPGKVTLT---DVSQTSASLMWEKPEHD 24239

Query: 2832  ---------VEIKP--SDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE 2880
                      VE++P  ++K  +V+E KV   ++  +S     EY   V     K K    
Sbjct: 24240 GGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQ--EYQFRVKAYNEKGKSDPR 24297

Query: 2881  TLHITKTMKNIEVPETKTASFEC------EVSHFNVPSM--------WLKNGVEIEMSEK 2926
              L +    K++ +  +    F        E     +P +        W+K+G  ++ + +
Sbjct: 24298 VLGVPVIAKDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTR 24357

Query: 2927  FKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTI 2986
               +        L I   + +D  +YT    N   +AT  ++ I++      +     D +
Sbjct: 24358 VNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVLEKPGPPVGPVRFDEV 24417

Query: 2987  TFE-VTVNYEGISY-------KWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADY 3038
             + + V +++E  +Y        ++    +  +T    +       ++ I  +  G    +
Sbjct: 24418 SADFVVISWEPPAYTGGCQISNYIVEKRDTTTTTWHMVSATVARTTIKITKLKTGTEYQF 24477

Query: 3039  -TFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMK--DDQ 3095
               F   +   +A L  +A  +++       K        F   +S+  + VQW +  +D 
Sbjct: 24478 RIFAENRYGKSAPLDSKAVIVQY-----PFKEPGPPGTPFVTSISKDQMLVQWHEPVNDG 24532

Query: 3096  ELQITDRIKIQKEK------YVHRLLIPSTRMSDAG-------KYTVVAGGNVSTAK--- 3139
               +I      QKEK       +++  I  T+    G       ++ V A   V   K   
Sbjct: 24533 GTKIIGYHLEQKEKNSILWVKLNKTPIQDTKFKTTGLDEGLEYEFKVSAENIVGIGKPSK 24592

Query: 3140  ---LFV-------EGRDVRIRSIKKEVQVIEKQRA------VVEFEVNEDDV-DAHWYK- 3181
                 FV        GR   I   +  V +  K+ A      +  + V + D+ D  W K 
Sbjct: 24593 VSECFVARDPCDPPGRPEAIVITRNNVTLKWKKPAYDGGSKITGYIVEKKDLPDGRWMKA 24652

Query: 3182  ---DGIEINFQV-----QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYV 3233
                + +E  F V      +R+++ V  R      SE   S       +  R+       +
Sbjct: 24653 SFTNVLETEFTVSGLVEDQRYEFRVIARNAAGNFSEPSDSSGA----ITARDE------I 24702

Query: 3234  NAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKE-EQLLSTGFKCKFLHDGQ 3292
             +AP      +    + V +G+     A I G+P P + W K+ ++L  T  + +     Q
Sbjct: 24703 DAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQ 24762

Query: 3293  EYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3338
             + TL++ +    D   Y  +  N  G  T S  ++V+V +   P +
Sbjct: 24763 KTTLVVKDCIRTDGGQYILKLSNVGG--TKSIPITVKVLDRPGPPE 24806



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 61/309 (19%), Positives = 114/309 (36%), Gaps = 36/309 (11%)

Query: 4153 ITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNC 4212
            +T + P   ++ P       G S+    +I G P   V WF+    L   +       + 
Sbjct: 6828 LTVQEPPSFEQTPDSVEVLPGMSLTFTSVIRGTPPFKVKWFKGSRELVPGESCNISLEDF 6887

Query: 4213 SHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV-EPVTYRE---------------N 4256
              +L + +V   +SG Y C+  N++G+    + L V EP T+ +                
Sbjct: 6888 VTELELFEVQPLESGDYSCLVTNDAGSASCTTHLFVKEPATFVKRLADFSVETGSPIVLE 6947

Query: 4257 SQFENIGEIYGKYSRDQQLQDQGESVRAHFYDYPAGPFTPWTNVKEYSVRDYFQSLETIE 4316
            + +     I   + +D+ L  Q E       +      +    + E ++ DY Q    IE
Sbjct: 6948 ATYTGTPPISVSWIKDEYLISQSERCSITMTEK-----STILEILESTIEDYAQYSCLIE 7002

Query: 4317 QIDQKEQVRCIPSREKIPRFVHGASRT-IKISKPIRAEFIQCQAEG-KERHVS---EKSK 4371
                ++    + S  + P F+         I +P     +QC+ +G  E  +S   E +K
Sbjct: 7003 NEAGQDICEALVSVLEPPYFIEPLEHVEAVIGEPAT---LQCKVDGTPEIRISWYKEHTK 7059

Query: 4372 LHQAEGTVYPFVDDFSDVTIKKEIRNNFGKLGRSEKENVQECAQSDY-------LPNIHS 4424
            L  A      F ++ + + I K   ++ G+       +V   A S         LP   +
Sbjct: 7060 LRSAPAYKMQFKNNVASLVINKVDHSDVGEYSCKADNSVGAVASSAVLVIKARKLPPFFA 7119

Query: 4425 ERISDSYNT 4433
             ++ D + T
Sbjct: 7120 RKLKDVHET 7128



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 75/377 (19%), Positives = 142/377 (37%), Gaps = 57/377 (15%)

Query: 3088  VQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDV 3147
             V W K+D++     RI +       +L I +    D G Y++       +          
Sbjct: 17250 VTWKKEDRDAPTKARIDVTPVG--SKLEIRNAAHEDGGIYSLTVENPAGS---------- 17297

Query: 3148  RIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHW--YKDGIEINFQVQERHKYVVERR---- 3201
               +++  +V V++K     + EV+E   D+ +  +K+ ++    V     YVVERR    
Sbjct: 17298 --KTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITN--YVVERRDVAS 17353

Query: 3202  IHRMFISETRQ---------SDAGEYTF-VAGRNRSSVTLYVNAPEPPQVLQELQPVTVQ 3251
                  +S T +         ++  +Y F VA  N+     +V  P+P + L  L P    
Sbjct: 17354 AQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPFVETPKPIKALDPLHP---- 17409

Query: 3252  SGKPARFCAVISGRPQPKISWYKEEQ---LLSTGFKCKFLHDGQEYTLLLIEAFPEDAAV 3308
              G P     V   + +  + W K ++      TG+  ++  +G +  +        +  V
Sbjct: 17410 PGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECVV 17469

Query: 3309  ----------YTCEAKNDYGVATTSASLSVEVPE-VVSPDQEMPVYPPAIITPLQDTVTS 3357
                       +  +A+N  G+     ++ +E  E +V P  E+ V        ++  V  
Sbjct: 17470 TGLQQGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDV------KLIEGLVVK 17523

Query: 3358  EGQPARFQCRVSGTDLKVS-WYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTF 3416
              G   RF   + G  +  + W +   +IK    + +     +  L I      D G Y  
Sbjct: 17524 AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 17583

Query: 3417  VASNAVGQVSSTANLSL 3433
               SNA G  +   +L++
Sbjct: 17584 TVSNAAGSKTVAVHLTV 17600



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 35/134 (26%), Positives = 54/134 (40%), Gaps = 9/134 (6%)

Query: 5172  EAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKM 5231
             E + P   E+    IE L    V   TT+ F   + G+PVP  KW  + S ++ DE   +
Sbjct: 17503 EKLVPPSVELDVKLIEGLV---VKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTV 17559

Query: 5232  ERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHV 5291
             E       L I N  + + GEY     N  G      ++ ++          PP    ++
Sbjct: 17560 ETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLD------VPGPPTGPINI 17613

Query: 5292  MEFDLEHTTSSRTP 5305
             ++   EH T S  P
Sbjct: 17614 LDVTPEHMTISWQP 17627



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             + G++  LE  +SG P P + W ++G  L+   K + +  + S  L  KD   +DSG Y 
Sbjct: 21474 KAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYT 21533

Query: 4231  CVAENNSGAVESVSDLTV 4248
               A N  G  + + ++ V
Sbjct: 21534 LTATNPGGFAKHIFNVKV 21551



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 28/123 (22%), Positives = 54/123 (43%), Gaps = 3/123 (2%)

Query: 82    ATNGSGQATSTAELLVKAETAPPNFVQRLQS---MTVRQGSQVRLQVRVTGIPTPVVKFY 138
             A + S  + ST  ++VK +  PP  +  ++    + V+ G  +++   + G P PV+ + 
Sbjct: 25765 ADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWA 25824

Query: 139   RDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQGEEE 198
             +DG EI+     +I    +   L + +    D+G Y +   N  G  +      V  +  
Sbjct: 25825 KDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPG 25884

Query: 199   VPA 201
              PA
Sbjct: 25885 PPA 25887



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 5/130 (3%)

Query: 5468  LTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPI 5527
             L+ GD   F +IA+ +  T+S   +   +     ++     +VE  P +  G+       
Sbjct: 27918 LSPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPP--IVEFGPEYFDGL---IIKS 27972

Query: 5528  GTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
             G +   + LV+G P P V W+KDG  ++ R         G  +LF+    +   G Y   
Sbjct: 27973 GESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVE 28032

Query: 5588  ATNKSGMAES 5597
             A N SG A++
Sbjct: 28033 AKNASGSAKA 28042



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 9     TQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIP 68
             T P +++ V  G        I+G P P  SWF  G  +  S    V +      AKLTI 
Sbjct: 29742 TMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESER--VTVETHTKVAKLTIR 29799

Query: 69    AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
               T  ++G Y+L+  N +G  + T ++++  +  PP
Sbjct: 29800 ETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPP 29835



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 55/198 (27%), Positives = 84/198 (42%), Gaps = 21/198 (10%)

Query: 2176  FTQELQDVVAKEKDTMATFECE-TSEPFVKVKWYKDGME-VHEGDKYRMHSDR-KVHFLS 2232
             F +EL+++  + +   AT  C+ T  P   VKWY+ G E + +G KYR+   +   H L 
Sbjct: 30930 FKEELRNLNVRYQSN-ATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQLI 30988

Query: 2233  ILTIDTSDAEDYSC-VLVEDENVKTTAKLIVE-GAVVEFVKELQDIEVPESYSGELECIV 2290
             I ++   DA  Y      +  +V  TA L VE  A +   K L+ +    +  GE+  I 
Sbjct: 30989 IASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGAVHALRGEVVSIK 31048

Query: 2291  SPENIEGK------WYHNDVELKSNGKYTITSRRGRQNLTVKD-VTKEDQGEY------S 2337
              P    GK      W      + +NG Y +   R   +L   + V ++D G Y       
Sbjct: 31049 IP--FSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLVFPNGVERKDAGFYVVCAKNR 31106

Query: 2338  FVIDGKKTTCKLKMKPRP 2355
             F ID K     +   P P
Sbjct: 31107 FGIDQKTVELDVADVPDP 31124



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 12/117 (10%)

Query: 3920  KTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYN 3979
             K +++ + MR  E          PP F   + ++  Y G++  F      +P+P VTWY 
Sbjct: 31675 KIKRRTDTMRLLER---------PPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYK 31725

Query: 3980  NDMPIPRNQN---FIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKV 4033
             +   I    N   +   S +    LT++SV   ++   T V  N+YG     + L V
Sbjct: 31726 SGQKIKPGDNDKKYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTV 31782



 Score = 44.7 bits (104), Expect = 0.003
 Identities = 34/141 (24%), Positives = 55/141 (39%), Gaps = 11/141 (7%)

Query: 5180  EMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEP---DERIKMERVGN 5236
             E PP F  PL  +  Y    + F V +   P P V WY++   ++P   D++   E    
Sbjct: 31687 ERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGDNDKKYTFESDKG 31746

Query: 5237  VCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDL 5296
             +  L I+++   +  EY   A N  GE    A +         V L PP T   +     
Sbjct: 31747 LYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKL--------TVTLHPPPTDSTLRPMFK 31798

Query: 5297  EHTTSSRTPSPQEIVLEVELS 5317
                 ++     Q +  E+ +S
Sbjct: 31799 RLLANAECQEGQSVCFEIRVS 31819



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 77/418 (18%), Positives = 154/418 (36%), Gaps = 95/418 (22%)

Query: 5190 TKRKVYENTTLGFIVEVEGLPVPGV----------------KWYRNKSLLEPDERIKMER 5233
            T + + E   + F+ E++ + VP                  KWY N   L+ + +  +  
Sbjct: 2257 TAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITS 2316

Query: 5234 VGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVME 5293
                 +L + ++ K + GEY      +I   K+   + + P   R +A+   ++ Q V E
Sbjct: 2317 RRGRQNLTVKDVTKEDQGEYSF----VIDGKKTTCKLKMKP---RPIAILQGLSDQKVCE 2369

Query: 5294 FDLEHTTSSRTPSPQEIVL-----EVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLD 5348
             D+       +    E V      EV+ S++     +KQ  ++ + + T +        D
Sbjct: 2370 GDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKE--------D 2421

Query: 5349 VLPFNFVDPNMD-SREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIP 5407
               ++F  P +  S  G      +D+         I P+ D  + E + AV +C V    
Sbjct: 2422 AGNYSFTIPALGLSTSGRVSVYSVDV---------ITPLKDVNVIEGTKAVLECKVSVPD 2472

Query: 5408 TPEVKWYKEYMCIEPDN-IKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRG 5466
               VKWY     I+PD+ ++ ++   K    L I     SD   Y+              
Sbjct: 2473 VTSVKWYLNDEQIKPDDRVQAIVKGTK--QRLVINRTHASDEGPYK-------------- 2516

Query: 5467 FLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAP 5526
                       +I  + +   +  +E++                    + I+G+ D    
Sbjct: 2517 -----------LIVGRVETNCNLSVEKI--------------------KIIRGLRDLTCT 2545

Query: 5527 IGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEY 5584
                  F+  +  S    ++ +KD ++    ++ +E  G   + L + +++K DEG+Y
Sbjct: 2546 ETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGK-IYKLTVLNMMKDDEGKY 2602



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 52/194 (26%), Positives = 91/194 (46%), Gaps = 15/194 (7%)

Query: 8     FTQPLQSVVVLE----GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGR- 62
             F + ++ +++ E    GS+A FE  +S       +W +DG  I  S         +DG+ 
Sbjct: 11117 FVKEIKDIILTESEFVGSSAIFECLVSP-STAITTWMKDGSNIRESPKHRF---IADGKD 11172

Query: 63    AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRL-QSMTVRQGSQV 121
              KL I  V  +++G Y+     G+ + TSTA+L+V  E  P  FV+ L + +TV +G  +
Sbjct: 11173 RKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVV--EELPVRFVKTLEEEVTVVKGQPL 11230

Query: 122   RLQVRVTGIPTPVVKFYRDG-AEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
              L   +       V + +DG   ++          G + +L I +A   D+GTY+V   N
Sbjct: 11231 YLSCELN--KERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN 11288

Query: 181   SVGRATSTAELLVQ 194
             +     S+   +V+
Sbjct: 11289 ANNLECSSCVKVVE 11302



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 44/181 (24%), Positives = 70/181 (38%), Gaps = 28/181 (15%)

Query: 2181  QDVVAKEKDTMATFECETSE------------------PFVKVKWYKDGMEVHEGDKYRM 2222
             ++VVAK+ D   T + ET +                  P   V W+KDG EV   D+  M
Sbjct: 14376 ENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTM 14435

Query: 2223  HSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESY 2282
              +D   H  + L +  S   D     +  EN   +A   +   V+      +DI+  +  
Sbjct: 14436 KND---HISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDIT 14492

Query: 2283  SGELECIVSPENIEG--KWYHNDVELKSNGKYT---ITSRRGRQNLTVKDVTKEDQGEYS 2337
                 +    P   +G     H  +E +  G+ T   + S   + + TVKD+     GEY 
Sbjct: 14493 KSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLI--PNGEYF 14550

Query: 2338  F 2338
             F
Sbjct: 14551 F 14551



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 23/94 (24%), Positives = 48/94 (51%)

Query: 939   PVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIA 998
             P   PT+     ++ VIEGE +++       P PTV+W+++  ++++S    +      A
Sbjct: 14383 PDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISA 14442

Query: 999   RLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
              L + ++   D+G +T +  N+ G+ + S  + V
Sbjct: 14443 HLEVPKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 30/136 (22%), Positives = 58/136 (42%), Gaps = 8/136 (5%)

Query: 64    KLTIPAVTKANSGRYSLKATNGSGQATST---AELLVKAETAPPNFV---QRLQSMTVRQ 117
             K  +  +    + ++ + A N +G++        +LVK    PP  +      +   ++ 
Sbjct: 17173 KYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKV 17232

Query: 118   GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVN 177
             G  +RL   + G+P P V + ++  +  +     ++  G    L I  A  ED G YS+ 
Sbjct: 17233 GDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGS--KLEIRNAAHEDGGIYSLT 17290

Query: 178   ATNSVGRATSTAELLV 193
               N  G  T + ++LV
Sbjct: 17291 VENPAGSKTVSVKVLV 17306



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 45/203 (22%), Positives = 83/203 (40%), Gaps = 11/203 (5%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             R G +I +   + G P+P +TW + G +L + ++    +     +L IK+    D GKY 
Sbjct: 17921 RVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYI 17980

Query: 4231  CVAENNSGAVESVSDLTV-EPVTYRENSQFENIGEIYGKYSRDQQLQDQGESVRAHFYDY 4289
               A+N+SG  +  + + V +     +N +  N+ +     S +  L + G  +     +Y
Sbjct: 17981 ISAKNSSGHAQGSAIVNVLDRPGPCQNLKVTNVTKENCTISWENPLDNGGSEITNFIVEY 18040

Query: 4290  PAGPFTPWTNVKEYSVRDYFQSLETIEQIDQKEQVRCIPSREKIPRFVHGASRTIKISKP 4349
                    W+ V      D  + L     +   E    + +  K+     G   TI+   P
Sbjct: 18041 RKPNQKGWSIV----ASDVTKRLIKANLLANNEYYFRVCAENKV-----GVGPTIETKTP 18091

Query: 4350  IRA-EFIQCQAEGKERHVSEKSK 4371
             I A   I    E +  H+++K K
Sbjct: 18092 ILAINPIDRPGEPENLHIADKGK 18114



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 29/129 (22%), Positives = 63/129 (48%), Gaps = 7/129 (5%)

Query: 64    KLTIPAVTKANSGRYSLKATNGSGQATSTAE----LLVKAETAPPNF---VQRLQSMTVR 116
             + T+  +T+  +  + + A N +G  +  +E    +  + +   P     V+   ++ ++
Sbjct: 21415 EFTVSGLTEDAAYEFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILK 21474

Query: 117   QGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSV 176
              G   RL+  V+G P P +++ +DG E++ +   +I       +L+  ++   DSG Y++
Sbjct: 21475 AGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTL 21534

Query: 177   NATNSVGRA 185
              ATN  G A
Sbjct: 21535 TATNPGGFA 21543



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 28/113 (24%), Positives = 52/113 (46%), Gaps = 6/113 (5%)

Query: 5167  FGTPNE---AIEPKDNEMPPSF-IEPLTKRKVYENTTLGFIVEVE--GLPVPGVKWYRNK 5220
             F  P+E   AI  +D   PP   ++P  K  +  +    F V+ +  G P+P ++W +  
Sbjct: 22522 FSEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGD 22581

Query: 5221  SLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
               L    R++++      SL + +  + + G Y+  A N+ GE     NV ++
Sbjct: 22582 QELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVL 22634



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 27/99 (27%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 6     PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
             P       S  V  G     E  ISG P P ++W +DG  +  +T   + ++ S     L
Sbjct: 23230 PDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTT--RINVTDSLDLTTL 23287

Query: 66    TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
             +I    K + G+Y +   N  GQ T++ E++   +  PP
Sbjct: 23288 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPP 23326



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 33/100 (33%), Positives = 48/100 (48%), Gaps = 6/100 (6%)

Query: 12    LQSVVVLEGS-TATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAV 70
             L+ VVVL  S T      I G P PEV W +   +++       QI  +     L I  V
Sbjct: 25113 LRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILTDRA----QIEVTSSFTMLVIDNV 25168

Query: 71    TKANSGRYSLKATNGSGQATSTAEL-LVKAETAPPNFVQR 109
             T+ +SGRY+L   N SG  T+   + ++ + +AP N   R
Sbjct: 25169 TRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNLTIR 25208



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 37/145 (25%), Positives = 68/145 (46%), Gaps = 11/145 (7%)

Query: 916   FEVLHGREAKVTETARVPAPVEIP--VTPPTLVSGLKN-----VTVIEGESVTLECHISG 968
             F V    +A +++   +  PV I   + PP +   +KN     V V  G ++ ++  ISG
Sbjct: 26445 FRVFAENQAGLSDPRELLLPVLIKEQLEPPEI--DMKNFPSHTVYVRAGSNLKVDIPISG 26502

Query: 969   YPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSC 1028
              P P VT  R+   +++++ F     +    + ++E+   D+GR+  +A N +GT  T  
Sbjct: 26503 KPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGT--TKA 26560

Query: 1029  YLAVQVSEEFEKETTAVTEKFTTEE 1053
             ++ + V +     T  V     TEE
Sbjct: 26561 FINIVVLDRPGPPTGPVVISDITEE 26585



 Score = 44.3 bits (103), Expect = 0.003
 Identities = 27/90 (30%), Positives = 43/90 (47%), Gaps = 2/90 (2%)

Query: 111   QSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170
             + + VRQG  +RL + + G P P+ K+ ++G +I        S+      L+I EA   D
Sbjct: 30144 EGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHT--ELVIKEADRGD 30201

Query: 171   SGTYSVNATNSVGRATSTAELLVQGEEEVP 200
             SGTY +   N  G+     ++ V G    P
Sbjct: 30202 SGTYDLVLENKCGKKAVYIKVRVIGSPNSP 30231



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 53/246 (21%), Positives = 98/246 (39%), Gaps = 33/246 (13%)

Query: 5214 VKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
            V W      ++P  + K+E  G +  L + N+ K + G+Y  +A    GE  +   + + 
Sbjct: 2563 VLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYA----GENMTSGKLTVA 2618

Query: 5274 PQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVK-EFEKQVKIV- 5331
                   A+  P+T Q V E              QE V E E++  D K E+ +  K + 
Sbjct: 2619 GG-----AISKPLTDQTVAE-------------SQEAVFECEVANPDSKGEWLRDGKHLP 2660

Query: 5332 ---TVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEVFEMPPRFIMPICD 5388
                +   +  HK  ++ +     + +              K+ +E  ++       + +
Sbjct: 2661 LTNNIRSESDGHKRRLI-IAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKT----LKN 2715

Query: 5389 FKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDS 5448
              + E  DAVF   +       V+W K  + +E  N KY IS +   ++L+I+N  + D 
Sbjct: 2716 LTVTETQDAVFTVELTHPNVKGVQWIKNGVVLE-SNEKYAISVKGTIYSLRIKNCAIVDE 2774

Query: 5449 ATYRCR 5454
            + Y  R
Sbjct: 2775 SVYGFR 2780



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 24/117 (20%), Positives = 54/117 (46%)

Query: 79    SLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFY 138
             ++ A   S  +  +  ++ K     P        + V +G ++ + V    +P P V ++
Sbjct: 14362 AVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWH 14421

Query: 139   RDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQG 195
             +DG E+++S    +  +     L + ++   D+G Y++   N +G AT++  + V G
Sbjct: 14422 KDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIG 14478



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 38/138 (27%), Positives = 57/138 (41%), Gaps = 24/138 (17%)

Query: 1057  VESRDVVMTDTSLTEE------------QAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQ 1104
             V+S   V+T+ +  EE            ++ P   A P      V++  V+     +  Q
Sbjct: 23183 VKSLQAVITNLTQGEEYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQ 23242

Query: 1105  VG----------GNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEY 1154
             VG          G PKP + W K G+PL    R  V+ +       L I  T  DD G+Y
Sbjct: 23243 VGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDL--TTLSIKETHKDDGGQY 23300

Query: 1155  TIVVRNKHGETSASASLL 1172
              I V N  G+ +AS  ++
Sbjct: 23301 GITVANVVGQKTASIEIV 23318



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 5172  EAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKM 5231
             E IEP + E+     + +  R    + TL   V ++G P P VKW + + +L   +R ++
Sbjct: 25100 ERIEPPEIELDADLRKVVVLRA---SATLRLFVTIKGRPEPEVKWEKAEGIL--TDRAQI 25154

Query: 5232  ERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVAL 5282
             E   +   L I N+ + + G Y     N  G   +F NV ++      V L
Sbjct: 25155 EVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRVLDSPSAPVNL 25205



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 151/761 (19%), Positives = 278/761 (36%), Gaps = 134/761 (17%)

Query: 2676  LIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTL---KNLTVTETQDAVFTVELTH 2732
             L I     +D G+YT  +    ++A L +  VK+  T     N+TV +       +    
Sbjct: 26242 LTIENANRNDSGKYTLTIQNVLSAASLTL-VVKVLDTPGPPTNITVQDVTKESAVLSWDV 26300

Query: 2733  PNVKGVQWIKNGVV--LESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRL-GRLGASAR 2789
             P   G   +KN  +   E+++K  +SV      L  K   + + ++Y FR+ G       
Sbjct: 26301 PENDGGAPVKNYHIEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVG 26360

Query: 2790  LHVET---VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWF-----------HKSVE-- 2833
             +  ET   VKI +KP     L         S+S D+V + W            H  VE  
Sbjct: 26361 IPAETKEGVKITEKPSPPEKLG------VTSISKDSVSLTWLKPEHDGGSRIVHYVVEAL 26414

Query: 2834  -----------IKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETL 2882
                        +  S  H +   R+  +   +  + + AG        L    K  +E  
Sbjct: 26415 EKGQKNWVKCAVAKSTHHVVSGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPP 26474

Query: 2883  HITKTMKN-----IEVPETKTASFECEVSHFNVPSMWL-KNGVEIEMSEKFKIVVQGKLH 2936
              I   MKN     + V        +  +S   +P + L ++GV ++ + +F   +  +  
Sbjct: 26475 EID--MKNFPSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENL 26532

Query: 2937  QLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITS--------MLKDINAEEKDTITF 2988
              + +  + T D+  Y     N   +    +  +++          ++ DI  EE  T+ +
Sbjct: 26533 TINLKESVTADAGRYEITAANSSGTTKAFINIVVLDRPGPPTGPVVISDIT-EESVTLKW 26591

Query: 2989  EVTVNYEGIS----YKWLKNGV------EIKST-DKCQMRTKKLTHSLNIRNVHFGDAAD 3037
             E    Y+G S    Y  LK         E+ +T  +  M+  KLT         F   A+
Sbjct: 26592 EPP-KYDGGSQVTNYILLKRETSTAVWTEVSATVARTMMKVMKLTTG---EEYQFRIKAE 26647

Query: 3038  YTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKD---- 3093
               F       +A + V+  +                   +   V+   ITV W +     
Sbjct: 26648 NRFGISDHIDSACVTVKLPYT----------TPGPPSTPWVTNVTRESITVGWHEPVSNG 26697

Query: 3094  -----DQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE----- 3143
                     L++ DR  I  +K  ++L+I +T      K T ++ G +   +++ E     
Sbjct: 26698 GSAVVGYHLEMKDRNSILWQK-ANKLVIRTTHF----KVTTISAGLIYEFRVYAENAAGV 26752

Query: 3144  GRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRI- 3202
             G+          +   E  R V   +++++ V   W +   +   ++     Y+VERR  
Sbjct: 26753 GKPSHPSEPVLAIDACEPPRNVRITDISKNSVSLSWQQPAFDGGSKITG---YIVERRDL 26809

Query: 3203  ---------------HRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEP--------- 3238
                             +  IS   Q+   E+   A     S++       P         
Sbjct: 26810 PDGRWTKASFTNVTETQFIISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGG 26869

Query: 3239  PQV---LQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYT 3295
             P +   L+  + V  ++G   +  A ISG+P P I WYK+++ L T       +     +
Sbjct: 26870 PVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLAS 26929

Query: 3296  LLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3336
             +L+ +A   ++  Y  + +N  G A  SA++ V++ +   P
Sbjct: 26930 ILIKDADRLNSGCYELKLRNAMGSA--SATIRVQILDKPGP 26968



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 33/133 (24%), Positives = 51/133 (38%), Gaps = 7/133 (5%)

Query: 1521  TPSDSGEWTVVAQNRAGR-----SSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEM 1575
             +P D  E+ ++A+N  G       S  +I+T +     +     E    + IK G  L +
Sbjct: 27919 SPGDRYEFRIIARNAVGTISPPSQSSGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRI 27978

Query: 1576  KVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINK 1635
             K    G P P + W K  D +   K   + I    G  +L +          YT  A N 
Sbjct: 27979 KALVQGRPVPRVTWFK--DGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNA 28036

Query: 1636  AGRDTTRCKVNVE 1648
             +G      KV V+
Sbjct: 28037 SGSAKAEIKVKVQ 28049



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query: 928   ETARVPAPVEIPVTPPTLVSGL--KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIES 985
             ET       ++ V P   +S +  K + V  G  V L   I+G P P  +W+    ++  
Sbjct: 29722 ETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRE 29781

Query: 986   SIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVS 1025
             S    +   + +A+L IRE    D+G +T    N  GT S
Sbjct: 29782 SERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGTTS 29821



 Score = 43.9 bits (102), Expect = 0.005
 Identities = 53/211 (25%), Positives = 85/211 (40%), Gaps = 28/211 (13%)

Query: 5300  TSSRTPSPQEIVLEVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNM 5359
             T  R+PSP         SE+ +  FE+  +     +    ++SM  +L            
Sbjct: 32314 TRPRSPSPVS-------SERSLSRFERSARF----DIFSRYESMKAALKT---------- 32352

Query: 5360  DSREGEDKELKIDLEVFEMP--PRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEY 5417
               +  E K   +  + F +   PR  + +   ++P   +  F  +V   PT EVKWY   
Sbjct: 32353 -QKTSERKYEVLSQQPFTLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNG 32411

Query: 5418  MCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFL--TMGDSEI 5475
             + ++ ++ K   +   G  TL+I +    DS TYR    N  GEA     L  T GD   
Sbjct: 32412 VELQ-ESSKIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVTGGDYTT 32470

Query: 5476  FAVIAKKSKVTLSSLMEELVLKSNYTDSFFE 5506
             +A   +  +V   S+  EL     Y  S F+
Sbjct: 32471 YASQRRDEEVP-RSVFPELTRTEAYAVSSFK 32500



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 2/87 (2%)

Query: 4172 EGDSIILECLISGEPQPVVTWFQNGVLLKQN--QKFQFEEVNCSHQLYIKDVNSQDSGKY 4229
            EG +   E  ISG P P V+WF++G ++  +     Q    +   +L I  V   +SG+Y
Sbjct: 19   EGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRY 78

Query: 4230 KCVAENNSGAVESVSDLTVEPVTYREN 4256
               A N SG   S ++L V+  T   N
Sbjct: 79   SLKATNGSGQATSTAELLVKAETAPPN 105



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 86/432 (19%), Positives = 165/432 (38%), Gaps = 52/432 (12%)

Query: 3824 YGEILVNENTQA--RGQLEEIMANTTIGESSTYITNVCEKEEVYETPENVSQAITPHASE 3881
            +GEI  N N Q   R + E+I  +       T I      EE       + + + P   E
Sbjct: 8533 HGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPILKKGAGEEEEIDIMELLKNVDPKEYE 8592

Query: 3882 SFGTLVNVEESEEI--ASERIKKDDLRELQLSASTRIDEFKTEQKE--ENMRFFENSFRK 3937
             +  +  + +   +  A E +K+    E        I+  + ++KE  E + F +   ++
Sbjct: 8593 KYARMYGITDFRGLLQAFELLKQSQEEETHRLEIEEIERSERDEKEFEELVSFIQ---QR 8649

Query: 3938 RPQRCPPSFLQEIESQEVYEGDSCNFVCHFQ-GYPQPIVTWYNNDMPIPRNQNFIIHSLE 3996
              Q  P + +++IE+Q V + +   F    +  YP+  ++WY     +  +  F I    
Sbjct: 8650 LSQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDG 8709

Query: 3997 NYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEE 4056
            +   L + +   +++G+   V      + K T +     +   DV           L E 
Sbjct: 8710 DRHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVT----------LKEG 8759

Query: 4057 EELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQ 4116
            +   +     + + P++  E   N  +LK      P G  +     VE +V   T    +
Sbjct: 8760 QTCTMT---CQFSVPNVKSEWFRNGRILK------PQGRHKT---EVEHKVHKLTIADVR 8807

Query: 4117 -DKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARCREGDS 4175
             + + +   + E+LE  A  +                I  EP +  + + ++    E  S
Sbjct: 8808 AEDQGQYTCKYEDLETSAELR----------------IEAEPIQFTKRI-QNIVVSEHQS 8850

Query: 4176 IILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAE- 4234
               EC +S +   +VTW++    L ++QK+ F      H + I +V   D G Y  +A  
Sbjct: 8851 ATFECEVSFD-DAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARL 8909

Query: 4235 NNSGAVESVSDL 4246
               G   S ++L
Sbjct: 8910 EPRGEARSTAEL 8921



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGV-------QISFSDGRAKLTI 67
             +V   GS     A I G P P+ SW  DG+    +   GV       Q+  ++  + + I
Sbjct: 15820 LVCKAGSQIRIPAVIKGRPTPKSSWEFDGKA-KKAMKDGVHDIPEDAQLETAENSSVIII 15878

Query: 68    PAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
             P   ++++G+YS+ A N +GQ T+   + V     PP
Sbjct: 15879 PECKRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPP 15915



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 8/142 (5%)

Query: 1499  NDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMF 1558
             + +TH   +K       ++   T  +   + V+A N AGRS+      V   E  + P  
Sbjct: 21009 DQWTHITTVKG---LECVVRNLTEGEEYTFQVMAVNSAGRSAPRESRPVIVKEQTMLPEL 21065

Query: 1559  VEK---LKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAAL 1615
               +    K V  K G  +++++   G P P + W K   I+   +  ++  E T     L
Sbjct: 21066 DLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQIL--KQTQRVNFETTATSTIL 21123

Query: 1616  KIDSTVSQDSAWYTATAINKAG 1637
              I+  V  DS  Y  TA N  G
Sbjct: 21124 NINECVRSDSGPYPLTARNIVG 21145



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 22/80 (27%), Positives = 40/80 (50%)

Query: 3250  VQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVY 3309
             ++SG+  R  A++ GRP P+++W+K+   +      +        +L + +A  +   VY
Sbjct: 27970 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 28029

Query: 3310  TCEAKNDYGVATTSASLSVE 3329
             T EAKN  G A     + V+
Sbjct: 28030 TVEAKNASGSAKAEIKVKVQ 28049



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 22/69 (31%), Positives = 31/69 (44%)

Query: 4170  CREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKY 4229
             C+ G    ++  ISG P P VTW    + LK+  +           L +KD    DSG+Y
Sbjct: 28659 CKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRY 28718

Query: 4230  KCVAENNSG 4238
                 EN +G
Sbjct: 28719 FLTLENTAG 28727



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 35/122 (28%), Positives = 56/122 (45%), Gaps = 13/122 (10%)

Query: 1427  MSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMP 1486
             MS    S A + P  R+E  D    + L K V +          G + R  + V GRP P
Sbjct: 29425 MSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRA--------GASLRLMVSVSGRPPP 29476

Query: 1487  ETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPS-DSGEWTVVAQNRAGRSSISVIL 1545
                W   G     D   + +I    + SL+IV      D+G++T+ A+N++G+ S +V++
Sbjct: 29477 VITWSKQGI----DLASRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLV 29532

Query: 1546  TV 1547
              V
Sbjct: 29533 KV 29534



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 1/78 (1%)

Query: 4173  GDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQ-DSGKYKC 4231
             G ++ L  +  G P P +TWF    LL+ ++    E       L +K+V  +  +GKYK 
Sbjct: 30643 GSTLRLHVMYIGRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKV 30702

Query: 4232  VAENNSGAVESVSDLTVE 4249
                N  G V+++ D+ ++
Sbjct: 30703 QLSNVFGTVDAILDVEIQ 30720



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 1/112 (0%)

Query: 2075  MEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWP-EDNV 2133
             ++AP   E +++  V   S+A    +V G P P  +WY+ G +I      Y     +   
Sbjct: 30925 IQAPHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGY 30984

Query: 2134  CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVA 2185
              +L+I  VT +D+    V+A N  G  S  A L V+    I   + L+ + A
Sbjct: 30985 HQLIIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAKIHLPKTLEGMGA 31036



 Score = 43.5 bits (101), Expect = 0.006
 Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 1/86 (1%)

Query: 4167  HARCREGDSIILECLISGEPQPV-VTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQD 4225
             HA   EG  +   C I    Q   VTW+     L+ ++K++    +    LY+KD+   D
Sbjct: 31576 HAVGEEGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLD 31635

Query: 4226  SGKYKCVAENNSGAVESVSDLTVEPV 4251
              G Y+C   N+ G   S ++L V+ V
Sbjct: 31636 DGTYRCKVVNDYGEDSSYAELFVKGV 31661



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 55/233 (23%), Positives = 90/233 (38%), Gaps = 27/233 (11%)

Query: 5186 IEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNI 5245
            I PL    V E T      +V    V  VKWY N   ++PD+R++    G    L I+  
Sbjct: 2448 ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRT 2507

Query: 5246 QKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTP 5305
               + G Y      I+G  ++  N+ +  ++ +++               L   T + T 
Sbjct: 2508 HASDEGPYKL----IVGRVETNCNLSV--EKIKIIR-------------GLRDLTCTET- 2547

Query: 5306 SPQEIVLEVELSEK--DVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSRE 5363
              Q +V EVELS    DV    K  +I    ++  +    I  L VL     D    +  
Sbjct: 2548 --QNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFY 2605

Query: 5364 GEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKE 5416
              +      L V         P+ D  + E+ +AVF+C V   P  + +W ++
Sbjct: 2606 AGENMTSGKLTV--AGGAISKPLTDQTVAESQEAVFECEVAN-PDSKGEWLRD 2655



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 47/175 (26%), Positives = 75/175 (42%), Gaps = 12/175 (6%)

Query: 8     FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAK-LT 66
             F +PL  + V E   A FE  +S     +V WF+DG  I       +    S G  + L 
Sbjct: 12376 FLRPLTDLQVREKEMARFECELSRENA-KVKWFKDGAEIKKGKKYDI---ISKGAVRILV 12431

Query: 67    IPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVR 126
             I      +   YS +       A ++  L V  E A   F + L ++ V +   ++L   
Sbjct: 12432 INKCLLDDEAEYSCEVRT----ARTSGMLTVLEEEAV--FTKNLANIEVSETDTIKLVCE 12485

Query: 127   VTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNS 181
             V+  P   V +Y+   EI  +  ++I  EG    L+I  A+ ED+G Y+    +S
Sbjct: 12486 VSK-PGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSS 12539



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 11/118 (9%)

Query: 2051  KALAEEGKITIPTFKPDKIELSPSMEAPKIF---ERIQSQTVGQGSDAHFRVRVVGKPDP 2107
             KAL  +G  + P+   ++I+   + EAP+IF   + +   TV  G+       V GKP+P
Sbjct: 13662 KALNRQGA-SKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLTVKAGTKIELPATVTGKPEP 13720

Query: 2108  ECEWYKNGVKIERSDRIYWYWPEDNV---CELVIRDVTAEDSASIMVKAINIAGETSS 2162
             +  W K  + +++  RI      +NV     + I D    D+ + +++A+N+ G  ++
Sbjct: 13721 KITWTKADMILKQDKRI----TIENVPKKSTVTIVDSKRSDTGTYIIEAVNVCGRATA 13774



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 33/138 (23%), Positives = 60/138 (43%), Gaps = 2/138 (1%)

Query: 1794  VKDEKSLVEESQLPEGRKGLQ-RIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRV 1852
             +KD K  VEE  +P+    L+ R      ++    ++     +    KP I L    + V
Sbjct: 14339 IKDLKFKVEEGVVPDKEYVLRVRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIV 14398

Query: 1853  LEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIH-YLDIVDCKSYDTGEVK 1911
             +EGE           P P V+W+ +G+ ++ S R  ++ D I  +L++      D G   
Sbjct: 14399 IEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYT 14458

Query: 1912  VTAENPEGVIEHKVKLEI 1929
             +T EN  G     + +++
Sbjct: 14459 ITLENKLGSATASINVKV 14476



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 39/138 (28%), Positives = 60/138 (43%), Gaps = 11/138 (7%)

Query: 1527  EWTVVAQNRAGRSSISVILTVEAVEHQVKP----MFVEKLKNVNIKEGSRLEMKVRATGN 1582
             ++ V+A N AG S  + +     V+ +++P    +     +  +IK G  L +     G 
Sbjct: 17186 KFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKVGDTLRLSAIIKGV 17245

Query: 1583  PNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTR 1642
             P P + W K  D   P    K RI+ T   + L+I +   +D   Y+ T  N AG  T  
Sbjct: 17246 PFPKVTW-KKEDRDAP---TKARIDVTPVGSKLEIRNAAHEDGGIYSLTVENPAGSKTVS 17301

Query: 1643  CKVNVEVEFAEPEPERKL 1660
              KV V     +P P R L
Sbjct: 17302 VKVLV---LDKPGPPRDL 17316



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 1848  EPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYD 1906
             E + V  G T RF   + G P P   W  +G  I+  + + V  D     L I +C   D
Sbjct: 17518 EGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRD 17577

Query: 1907  TGEVKVTAENPEG 1919
             TGE ++T  N  G
Sbjct: 17578 TGEYQITVSNAAG 17590



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 15/140 (10%)

Query: 3210  TRQSDAGEYTF-VAGRNRSSVTLYVNAPE---------PPQVLQELQPVTVQSGKPARFC 3259
             T   +  +Y F VA RN   V+L   A           PP++L   Q +T+++GK  R  
Sbjct: 18861 TGLKEGKKYKFRVAARNAVGVSLPREAEGVYEAKEQLLPPKILMPEQ-ITIKAGKKLRIE 18919

Query: 3260  AVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLI-EAFPEDAAVYTCEAKNDYG 3318
             A + G+P P   W K E  + T      +H     ++L+I +   +D+  Y+  A+N  G
Sbjct: 18920 AHVYGKPHPTCKWKKGEDEVVTSSHLA-VHKADSSSILIIKDVTRKDSGYYSLTAENSSG 18978

Query: 3319  VATTSASLSVEVPEVVSPDQ 3338
               T +  + V V +   P Q
Sbjct: 18979 --TDTQKIKVVVMDAPGPPQ 18996



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 23/81 (28%), Positives = 36/81 (44%)

Query: 3943  PPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILT 4002
             PP+F     +  V  G+       F G P P VTW+ +++P+ +       S EN S+LT
Sbjct: 22147 PPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLT 22206

Query: 4003  LSSVHHQNEGSITCVLFNQYG 4023
             +     ++ G     L N  G
Sbjct: 22207 IKDACREDVGHYVVKLTNSAG 22227



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 4173  GDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCV 4232
             G+ + ++    G P P VTW ++ V LKQ  +   E    +  L IKD   +D G Y   
Sbjct: 22162 GEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVK 22221

Query: 4233  AENNSG-AVESVSDLTVE 4249
               N++G A+E+++ + ++
Sbjct: 22222 LTNSAGEAIETLNVIVLD 22239



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 86/411 (20%), Positives = 151/411 (36%), Gaps = 76/411 (18%)

Query: 5199  TLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAV 5258
             +L   V ++G P P VKW +     E  +   ++   +  SL + N+ + + G+Y     
Sbjct: 22959 SLRLFVPIKGRPTPEVKWGKVDG--EIRDAAIIDVTSSFTSLVLDNVNRYDSGKYTLTLE 23016

Query: 5259  NIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSE 5318
             N  G   +F  V       RV+  P P  +  V E   +  + +  P   +   +++   
Sbjct: 23017 NSSGTKSAFVTV-------RVLDTPSPPVNLKVTEITKDSVSITWEPPLLDGGSKIKNYI 23069

Query: 5319  KDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGEDKELKIDLEV--- 5375
              + +E  ++     V   T  HK+    +D L           +EG     ++  E    
Sbjct: 23070 VEKREATRKSYAAVV---TNCHKNSW-KIDQL-----------QEGCSYYFRVTAENEYG 23114

Query: 5376  FEMPPRFIMPICDFKIPE-----NSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVIS 5430
               +P +   PI   ++P+       D V + SV       + W K         I+Y++ 
Sbjct: 23115 IGLPAQTADPIKVAEVPQPPGKITVDDVTRNSV------SLSWTKPEHDGGSKIIQYIV- 23167

Query: 5431  EEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSK------ 5484
             E +  H+ K             C  V  +   I    LT G+  +F V+A   K      
Sbjct: 23168 EMQAKHSEKWSE----------CARVKSLQAVITN--LTQGEEYLFRVVAVNEKGRSDPR 23215

Query: 5485  -VTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRP 5543
              + +  + ++LV++ +   +F  + V                 +G     +  + G P+P
Sbjct: 23216 SLAVPIVAKDLVIEPDVKPAFSSYSV----------------QVGQDLKIEVPISGRPKP 23259

Query: 5544  TVYWYKDG-KLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
             T+ W KDG  L Q  R  V +S      L I    K D G+Y     N  G
Sbjct: 23260 TITWTKDGLPLKQTTRINVTDS-LDLTTLSIKETHKDDGGQYGITVANVVG 23309



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 91/425 (21%), Positives = 155/425 (36%), Gaps = 74/425 (17%)

Query: 3084  PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3143
             P  T+ W KD   L+ T RI +     +  L I  T   D G+Y +     V      +E
Sbjct: 23257 PKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIE 23316

Query: 3144  GRDVRIRSIKKEVQVIEKQRAVVEF-EVNEDDVDAHW----YKDGIEI-NFQVQERHKY- 3196
                  I ++ K     +  +  V+F +V+ + +   W    Y  G +I N+ VQ+R    
Sbjct: 23317 -----IVTLDKP----DPPKGPVKFDDVSAESITLSWNPPLYTGGCQITNYIVQKRDTTT 23367

Query: 3197  ----VVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNA-----------PEPP- 3239
                 VV   + R  +  T+     EY F +   NR   +  + +           P PP 
Sbjct: 23368 TVWDVVSATVARTTLKVTKLKTGTEYQFRIFAENRYGQSFALESDPIVAQYPYKEPGPPG 23427

Query: 3240  -----------QVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLL--STGFKCK 3286
                         V+Q  +PV    G P      +  + +  I W K  + +   T FK +
Sbjct: 23428 TPFATAISKDSMVIQWHEPVN-NGGSPV-IGYHLERKERNSILWTKVNKTIIHDTQFKAQ 23485

Query: 3287  FLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPA 3346
              L +G EY          +  VY   A+N  GV   S +    V          P  PP 
Sbjct: 23486 NLEEGIEY----------EFRVY---AENIVGVGKASKNSECYV-------ARDPCDPPG 23525

Query: 3347  IITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEA 3406
               TP    V       ++   V      ++ Y  +K+  P   +    F +  + +   +
Sbjct: 23526 --TPEPIMVKRNEITLQWTKPVYDGGSMITGYIVEKRDLPDGRWMKASFTNVIETQFTVS 23583

Query: 3407  YPEDEGTYTF--VASNAVGQVSSTANLS--LEAPESILHERIEQEIEMEMKELFSEGESE 3462
                ++  Y F  +A NA G +S  ++ +  + A + +   RI  + +     + + GE+ 
Sbjct: 23584 GLTEDQRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPKFRDTIVVNAGETF 23643

Query: 3463  HSERD 3467
               E D
Sbjct: 23644 RLEAD 23648



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 2/105 (1%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             +VV  G      A I+G P+P +SW +DG  I        +I  +D    LT+    + +
Sbjct: 25799 IVVKAGEVLKINADIAGRPLPVISWAKDG--IEIEERARTEIISTDNHTLLTVKDCIRRD 25856

Query: 75    SGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGS 119
             +G+Y L   N +G  +      V  +  PP     +  +T  + S
Sbjct: 25857 TGQYVLTLKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAEKCS 25901



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 78/365 (21%), Positives = 131/365 (35%), Gaps = 31/365 (8%)

Query: 3084  PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAK--LF 3141
             P   V W K D +L+   R  +        L I +   +D+GKYT+     +S A   L 
Sbjct: 26214 PVPNVLWSKPDTDLRT--RAYVDTTDSRTSLTIENANRNDSGKYTLTIQNVLSAASLTLV 26271

Query: 3142  VEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR 3201
             V+  D         VQ + K+ AV+ ++V E+D  A      IE   +  ++    V   
Sbjct: 26272 VKVLDTPGPPTNITVQDVTKESAVLSWDVPENDGGAPVKNYHIE-KREASKKAWVSVTNN 26330

Query: 3202  IHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCA 3260
              +R+    T   +   Y F V+G N   V +       P   +E   +T +   P +   
Sbjct: 26331 CNRLSYKVTNLQEGAIYYFRVSGENEFGVGI-------PAETKEGVKITEKPSPPEKLGV 26383

Query: 3261  VISGRPQPKISWYKEEQ---LLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDY 3317
                 +    ++W K E         +  + L  GQ+  +    A      V      ++Y
Sbjct: 26384 TSISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKCAVAKSTHHVVSGLRENSEY 26443

Query: 3318  ---GVATTSASLS----VEVPEVVSPDQEMPVYPPAIIT---PLQDTVTSEGQPARFQCR 3367
                  A   A LS    + +P ++    E    PP I     P        G   +    
Sbjct: 26444 FFRVFAENQAGLSDPRELLLPVLIKEQLE----PPEIDMKNFPSHTVYVRAGSNLKVDIP 26499

Query: 3368  VSGTDLKVSWYSKD-KKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVS 3426
             +SG  L     S+D   +K +  F      +   + + E+   D G Y   A+N+ G   
Sbjct: 26500 ISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVTADAGRYEITAANSSGTTK 26559

Query: 3427  STANL 3431
             +  N+
Sbjct: 26560 AFINI 26564



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 2/94 (2%)

Query: 11    PLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAV 70
             P  +V V  GS    +  ISG P+P+V+  RDG  +  +     +I+  +    + +   
Sbjct: 26482 PSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAEN--LTINLKES 26539

Query: 71    TKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
               A++GRY + A N SG   +   ++V     PP
Sbjct: 26540 VTADAGRYEITAANSSGTTKAFINIVVLDRPGPP 26573



 Score = 43.1 bits (100), Expect = 0.008
 Identities = 28/108 (25%), Positives = 54/108 (50%), Gaps = 3/108 (2%)

Query: 90    TSTAELLVKAETAPPNFVQRLQS-MTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSL 148
             +ST+++L       P  ++ L S +++ +G  + +    TG PTP V +   G +I S  
Sbjct: 33314 SSTSKMLKAGIRGIPPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQE 33373

Query: 149   D--FQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194
                F I    DL +L+I +   +D G Y+++  N  G  ++T  + ++
Sbjct: 33374 QGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 33421



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 96/456 (21%), Positives = 163/456 (35%), Gaps = 73/456 (16%)

Query: 5054  PPGETLERYSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGET-------LERY 5106
             PP + +E    P     ER    P +  E     P    E    P  E        +E  
Sbjct: 10981 PPPKPVEEVEVPTVTKRERKIPEPTKVPEIKPAIPLPAPEPKPKPEAEVKTIKPPPVEPE 11040

Query: 5107  STP---------PGEALERYSIPTGGPNPTGTFKTYPSKI------EREDGTPNEHFYTP 5151
              TP          G+  E  +       P G  K  P K       ER    P      P
Sbjct: 11041 PTPIAAPVTVPVVGKKAEAKAPKEEAAKPKGPIKGVPKKTPSPIEAERRKLRPGSGGEKP 11100

Query: 5152  TEERGSAYEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPV 5211
              +E    Y++                   +P  F++ +    + E+  +G     E L  
Sbjct: 11101 PDEAPFTYQL-----------------KAVPLKFVKEIKDIILTESEFVGSSAIFECLVS 11143

Query: 5212  PGVK---WYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFA 5268
             P      W ++ S +    + +    G    L I ++Q  + GEY C  V  +G  +  +
Sbjct: 11144 PSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTC--VLRLGNKEKTS 11201

Query: 5269  NVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEFEKQV 5328
                ++ +E        PV     +E ++           Q + L  EL+++    + K  
Sbjct: 11202 TAKLVVEE-------LPVRFVKTLEEEV------TVVKGQPLYLSCELNKERDVVWRKDG 11248

Query: 5329  KIVTVP--EFTPDHKSMIVSLDVLPFNFVDP---NMDSREGEDKELKIDLEVFEMPPRFI 5383
             KIV        P    ++ +L +   +  D     +      + E    ++V E+   ++
Sbjct: 11249 KIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWL 11308

Query: 5384  M-PICDFKIPENSDAVFKCSVIGIPTPEVKWYKEY--MCIEPDNIKYVISEEKGSHT-LK 5439
             + PI D  +     A+F C  I   TP +KW+K Y  +  EP++   ++ +  G+H  LK
Sbjct: 11309 VKPIRDQHVKPKGTAIFACD-IAKDTPNIKWFKGYDEIPAEPNDKTEILRD--GNHLYLK 11365

Query: 5440  IRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEI 5475
             I+N    D A Y   AV   G+      LT+G+ E+
Sbjct: 11366 IKNAMPEDIAEY---AVEIEGKRY-PAKLTLGEREV 11397



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 31/152 (20%), Positives = 70/152 (46%), Gaps = 11/152 (7%)

Query: 64    KLTIPAVTKANSGRYSLKATNGSGQATSTAELL---VKAETAPPNFVQRLQSMTVRQGSQ 120
             + T+  + +     + +KA N +G +  +A +     +    PP+ +   + M V +G+ 
Sbjct: 16075 QFTVEDLVEGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPS-IDLKEFMEVEEGTN 16133

Query: 121   VRLQVRVTGIPTPVVKFYRDGAEIQSS-----LDFQISQ--EGDLYSLLIAEAYPEDSGT 173
             V +  ++ G+P P + +++   +   +      D  +++    D  +L+I ++   D+G 
Sbjct: 16134 VNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRSDTGL 16193

Query: 174   YSVNATNSVGRATSTAELLVQGEEEVPAKKTK 205
             Y++ A N++G A+    L V G    P    K
Sbjct: 16194 YTITAVNNLGTASKEMRLNVLGRPGPPVGPIK 16225



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             + V  G T    A + G P P+++W ++G+V+       V +     R +L I    +A+
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVRE--KRVDLIQDLPRVELQIKEAVRAD 17975

Query: 75    SGRYSLKATNGSGQATSTAELLVKAETAP 103
              G+Y + A N SG A  +A + V     P
Sbjct: 17976 HGKYIISAKNSSGHAQGSAIVNVLDRPGP 18004



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 39/120 (32%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 1452  ERLYKPVFVLKPVSFKCLE-GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED 1510
             E L KPV  LK      ++ G T R +  V G+P PE  W  D  +   D T    +K D
Sbjct: 18196 EDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKD--KDATDLTRSPRVKID 18253

Query: 1511  ---GTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNI 1567
                 +    +  A  SD G++ V A N AG  S     TV  ++   KP  V  LK V++
Sbjct: 18254 TRADSSKFSLTKAKRSDGGKYVVTATNTAG--SFVAYATVNVLD---KPGPVRNLKIVDV 18308



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 21/66 (31%), Positives = 33/66 (50%)

Query: 4173  GDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCV 4232
             G  + +E  ISG P+P +TW ++G+ LKQ  +    +      L IK+ +  D G+Y   
Sbjct: 23244 GQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGIT 23303

Query: 4233  AENNSG 4238
               N  G
Sbjct: 23304 VANVVG 23309



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 41/176 (23%), Positives = 73/176 (41%), Gaps = 14/176 (7%)

Query: 43    GQVISTSTLPG---VQISFSDG-RAKLTIPAVTKANSGRYSLKATNGSGQAT----STAE 94
             G ++    LP    ++ SF++    + T+  +T+     + + A N +G  +    ST  
Sbjct: 23554 GYIVEKRDLPDGRWMKASFTNVIETQFTVSGLTEDQRYEFRVIAKNAAGAISKPSDSTGP 23613

Query: 95    LLVKAETAPPNFVQRLQ---SMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQ 151
             +  K E   P      +   ++ V  G   RL+  V G P P +++ R   EI+ S   +
Sbjct: 23614 ITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCE 23673

Query: 152   ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV---QGEEEVPAKKT 204
             I        L++ +A   D G Y + A+N  G  +    + V    G  E P + T
Sbjct: 23674 IKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDRPGPPEGPVQVT 23729



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 5/112 (4%)

Query: 5164  SDSFG--TPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKS 5221
             SDS G  T  + +E     M P F + +    V    T     +V G P+P ++W R   
Sbjct: 23608 SDSTGPITAKDEVELPRISMDPKFRDTIV---VNAGETFRLEADVHGKPLPTIEWLRGDK 23664

Query: 5222  LLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
              +E   R +++       L + +  + +GG+Y+  A N+ G      NV ++
Sbjct: 23665 EIEESARCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVL 23716



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 45/203 (22%), Positives = 85/203 (41%), Gaps = 22/203 (10%)

Query: 1190  QTQVTAFVQEPKV--GETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHI 1247
             QT  +   ++P+   G    G+V     K  EK   +   K+    V   +  ++ +F +
Sbjct: 24226 QTSASLMWEKPEHDGGSRVLGYVVEMQPKGTEKWSIVAESKVCNAVVTGLSSGQEYQFRV 24285

Query: 1248  SSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMG 1307
              ++ E+   + + R++           G   +A D++   +++  F++    Y I  G  
Sbjct: 24286 KAYNEK--GKSDPRVL-----------GVPVIAKDLTIQPSLKLPFNT----YSIQAGED 24328

Query: 1308  VTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFAS 1367
             +     + G P P I+W KDG+ +K   R  ++        L I     +D G YT  A+
Sbjct: 24329 LKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTV-LHIKEGNKDDFGKYTVTAT 24387

Query: 1368  NIKGNAICSGKLYV--EPAAPLG 1388
             N  G A  +  + V  +P  P+G
Sbjct: 24388 NSAGTATENLSVIVLEKPGPPVG 24410



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 2/95 (2%)

Query: 3248  VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3307
             VT+++G      A + G+P+PKI W K ++ L    K    + G+  T ++      D+ 
Sbjct: 29057 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 29116

Query: 3308  VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPV 3342
              YT   KN  G  T + S+ V+V +   P  ++ V
Sbjct: 29117 KYTLTVKNASG--TKAVSVMVKVLDSPGPCGKLTV 29149



 Score = 42.7 bits (99), Expect = 0.010
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 1103  CQVGGNPKPHVYWKKSGVP-LTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNK 1161
             C+V G+PKP V W + G   +  G +Y++   K  G  +L+I+    DDA  Y +   N+
Sbjct: 30949 CKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFK-GGYHQLIIASVTDDDATVYQVRATNQ 31007

Query: 1162  HGETSASASL 1171
              G  S +ASL
Sbjct: 31008 GGSVSGTASL 31017



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 54/219 (24%), Positives = 94/219 (42%), Gaps = 30/219 (13%)

Query: 5211 VPGVK--WYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFA 5268
            VP VK  W+RN  +L+P  R K E    V  L I++++  + G+Y C   ++   A+   
Sbjct: 8770 VPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAEDQGQYTCKYEDLETSAELRI 8829

Query: 5269 NVDIMPQEER----VVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSEKDVKEF 5324
              + +   +R    VV+     T +  + FD    T  + P+        EL+E     F
Sbjct: 8830 EAEPIQFTKRIQNIVVSEHQSATFECEVSFDDAIVTWYKGPT--------ELTESQKYNF 8881

Query: 5325 --EKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNMDSREGED-----KELKIDLEVFE 5377
              + +   +T+   TPD + +   +  L     +P  ++R   +     KE+K++L+  +
Sbjct: 8882 RNDGRCHYMTIHNVTPDDEGVYSVIARL-----EPRGEARSTAELYLTTKEIKLELKPPD 8936

Query: 5378 MP----PRFIMPICDFKIPENSDAVFKCSVIGIPTPEVK 5412
            +P    P   MPI      E    V     + +PTPE K
Sbjct: 8937 IPDSRVPIPTMPIRAVPPEEIPPVVAPPIPLLLPTPEEK 8975



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 12/142 (8%)

Query: 4156  EPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQ 4215
             EPP    +  +     EG + +LEC +S E    V WF+NG  + +++K++        +
Sbjct: 12282 EPPVEFTKPLEDQTVEEGATAVLECEVSRE-NAKVKWFKNGTEILKSKKYEIVADGRVRK 12340

Query: 4216  LYIKDVNSQDSGKYKCVAENNSGA---------VESVSDLTVEPVTYRENSQFENIGEIY 4266
             L I D   +D   Y C A++   +         VE +  LT   V  +E ++FE   E+ 
Sbjct: 12341 LVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFE--CELS 12398

Query: 4267  GKYSRDQQLQDQGESVRAHFYD 4288
              + ++ +  +D  E  +   YD
Sbjct: 12399 RENAKVKWFKDGAEIKKGKKYD 12420



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 70/347 (20%), Positives = 129/347 (37%), Gaps = 60/347 (17%)

Query: 2978  INAEEKDTITFE-----VTVNYEGI---SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRN 3029
             I+ E  D I  E     + V +  +   +  W K+G E+K++D+  M+   ++  L +  
Sbjct: 14389 IDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPK 14448

Query: 3030  VHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQ 3089
                 DA  YT        +AT  +  + I      KDIK  +  ++  +     P+    
Sbjct: 14449 SVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDITKSSCKLTWEPPEF--- 14505

Query: 3090  WMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRI 3149
                 D    I   + +++ +   R  IP   MS   K +      +   + F      R+
Sbjct: 14506 ----DGGTPILHYV-LERREAGRRTYIPV--MSGENKLSWTVKDLIPNGEYF-----FRV 14553

Query: 3150  RSIKK--EVQVIEKQRAVVEFEVNED-----DVDAH----------W----YKDGIEINF 3188
             +++ K    + IE +  V+  +  +      DV+ H          W    Y  G +I  
Sbjct: 14554 KAVNKVGGGEYIELKNPVIAQDPKQPPDPPVDVEVHNPTAEAMTITWKPPLYDGGSKIMG 14613

Query: 3189  QV-------QERHKYVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNAPEPPQ 3240
              +       +ER K   E  +  +  +     +  EY F V   N + ++    A  P +
Sbjct: 14614 YIIEKIAKGEERWKRCNEHLVPILTYTAKGLEEGKEYQFRVRAENAAGISEPSRATPPTK 14673

Query: 3241  VLQELQ--------PVTVQSGKPARFCAVISGRPQPKISWYKEEQLL 3279
              +  +          + V+ G      A ISG P P I+W K+E ++
Sbjct: 14674 AVDPIDAPKVILRTSLEVKRGDEIALDASISGSPYPTITWIKDENVI 14720



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 35/137 (25%), Positives = 59/137 (43%), Gaps = 18/137 (13%)

Query: 896   VEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVI 955
             V+ +  VG+ +  TT+  E  E L            VP  VE+ V    L+ GL    V 
Sbjct: 17482 VKAENIVGLGLPDTTIPIECQEKL------------VPPSVELDVK---LIEGL---VVK 17523

Query: 956   EGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTC 1015
              G +V     I G P PT  W  +  +I++   + +   +  + L I+     D+G +  
Sbjct: 17524 AGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQI 17583

Query: 1016  SAVNEAGTVSTSCYLAV 1032
             +  N AG+ + + +L V
Sbjct: 17584 TVSNAAGSKTVAVHLTV 17600



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 45/175 (25%), Positives = 70/175 (40%), Gaps = 23/175 (13%)

Query: 854   KITKSVKAPTVKPSETRVRAEPTPLPQ--FPFADTPDTYKSEAGVEVKKEVGVSITGTTV 911
             K+T  +      PS++ ++A    +P+  F   D  +  K E  +  K   G        
Sbjct: 20304 KLTGYIVEKRDLPSKSWMKANHVNVPECAFTVTDLVEGGKYEFRIRAKNTAGAI------ 20357

Query: 912   REERFEVLHGREAKVTETARVPAPVEIP--VTPPTLVSGLKNVTVIEGESVTLEC-HISG 968
                         ++ TET       E P  V  PT+  GL   T+  G+++ L    I G
Sbjct: 20358 ---------SAPSESTETIICKDEYEAPTIVLDPTIKDGL---TIKAGDTIVLNAISILG 20405

Query: 969   YPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGT 1023
              P P  +W +    I  S   QIT     + L I+ A  +D+G +T +A N  GT
Sbjct: 20406 KPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGT 20460



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 29/69 (42%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 5537  VRGSPRPTVYWYKDGK-LVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMA 5595
             V G PRP + W KDG+ L Q  R  VEE+ T    L I    K D G+Y   ATN +G A
Sbjct: 24335 VIGRPRPNISWVKDGEPLKQTTRVNVEETATS-TVLHIKEGNKDDFGKYTVTATNSAGTA 24393

Query: 5596  -ESFAALTL 5603
              E+ + + L
Sbjct: 24394 TENLSVIVL 24402



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 25/83 (30%), Positives = 38/83 (45%)

Query: 3246  QPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPED 3305
             Q +T ++G P      ISGRP PK++W  EE  L    +          TL + ++   D
Sbjct: 28655 QLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGD 28714

Query: 3306  AAVYTCEAKNDYGVATTSASLSV 3328
             +  Y    +N  GV T S ++ V
Sbjct: 28715 SGRYFLTLENTAGVKTFSVTVVV 28737



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 20/81 (24%), Positives = 39/81 (48%)

Query: 952   VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSG 1011
             VT+  G  + L+  + G P P + W + D +++      + +    A  +I+     DSG
Sbjct: 29057 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSG 29116

Query: 1012  RFTCSAVNEAGTVSTSCYLAV 1032
             ++T +  N +GT + S  + V
Sbjct: 29117 KYTLTVKNASGTKAVSVMVKV 29137



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 35/122 (28%), Positives = 54/122 (44%), Gaps = 8/122 (6%)

Query: 1530  VVAQNRAGRS----SISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNP 1585
             V A N  G S    SI+ I  VE +E     +  +  K V I+ G+ L + V  +G P P
Sbjct: 29417 VAAVNVKGMSEYSESIAEIEPVERIEIPDLELADDLKKTVTIRAGASLRLMVSVSGRPPP 29476

Query: 1586  DIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKV 1645
              I W K    +      +  I+ T+  + L +D     D+  YT  A N++G+ +    V
Sbjct: 29477 VITWSKQGIDLA----SRAIIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLV 29532

Query: 1646  NV 1647
              V
Sbjct: 29533 KV 29534



 Score = 42.4 bits (98), Expect = 0.013
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query: 950   KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAED 1009
             K VT+  G S+ L   +SG P P +TW ++   + S      T     + L++ +    D
Sbjct: 29454 KTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAIIDTT--ESYSLLIVDKVNRYD 29511

Query: 1010  SGRFTCSAVNEAGTVSTSCYLAV 1032
             +G++T  A N++G  S +  + V
Sbjct: 29512 AGKYTIEAENQSGKKSATVLVKV 29534



 Score = 42.0 bits (97), Expect = 0.017
 Identities = 27/96 (28%), Positives = 43/96 (44%), Gaps = 6/96 (6%)

Query: 3513  KYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQD 3572
             +++  G+ +  +  +   P P++TW   +R  PT      KA  D+    S LEI+    
Sbjct: 17228 QHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPT------KARIDVTPVGSKLEIRNAAH 17281

Query: 3573  RDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYLE 3608
              D G Y L   N  GS   +  +LV+ K    + LE
Sbjct: 17282 EDGGIYSLTVENPAGSKTVSVKVLVLDKPGPPRDLE 17317



 Score = 42.0 bits (97), Expect = 0.017
 Identities = 24/87 (27%), Positives = 37/87 (42%)

Query: 5517  IKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSL 5576
             +K I       GT   F  ++RG P PT  W  DG  ++       E+      L I + 
Sbjct: 17514 VKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNC 17573

Query: 5577  VKSDEGEYRCVATNKSGMAESFAALTL 5603
             ++ D GEY+   +N +G       LT+
Sbjct: 17574 LRRDTGEYQITVSNAAGSKTVAVHLTV 17600



 Score = 42.0 bits (97), Expect = 0.017
 Identities = 22/78 (28%), Positives = 38/78 (48%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             + G ++    +I G P P   W  +G  +K ++ +  E  N S  L IK+   +D+G+Y+
Sbjct: 17523 KAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQ 17582

Query: 4231  CVAENNSGAVESVSDLTV 4248
                 N +G+      LTV
Sbjct: 17583 ITVSNAAGSKTVAVHLTV 17600



 Score = 42.0 bits (97), Expect = 0.017
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 15    VVVLEGSTATFEA-HISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKA 73
             + +  G T    A  I G P+P+ SW + G+ I  S +   QI+ +   + LTI   T+ 
Sbjct: 20388 LTIKAGDTIVLNAISILGKPLPKSSWSKAGKDIRPSDI--TQITSTPTSSMLTIKYATRK 20445

Query: 74    NSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQ 108
             ++G Y++ ATN  G      ++ V     PP  V+
Sbjct: 20446 DAGEYTITATNPFGTKVEHVKVTVLDVPGPPGPVE 20480



 Score = 42.0 bits (97), Expect = 0.017
 Identities = 81/392 (20%), Positives = 136/392 (34%), Gaps = 84/392 (21%)

Query: 3084  PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3143
             P++T  W KD+  + + +R  I+  +    L+IP     D GK+ +           FV 
Sbjct: 20806 PEVT--WTKDN--INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVN 20861

Query: 3144  GRDVRIRSIKKEVQVIEKQRAVVEF---EVNEDDVDAHWYKDGIEINFQVQERHKYVVER 3200
                         V+V++    V+     ++ +D V  HW    I+   ++     Y+VE+
Sbjct: 20862 ------------VRVLDTPGPVLNLRPTDITKDSVTLHWDLPLIDGGSRITN---YIVEK 20906

Query: 3201  R-------------IHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNAPEPPQVLQELQ 3246
             R              H+     T  S+  EY F V   N   +       EP +  +   
Sbjct: 20907 REATRKSYSTATTKCHKCTYKVTGLSEGCEYFFRVMAENEYGIGEPTETTEPVKASEAPS 20966

Query: 3247  PVTVQSGKPARFCAVISGRPQPK------ISWYKEEQLLS-----------TGFKC--KF 3287
             P    +        V    P+PK      I+ Y  E                G +C  + 
Sbjct: 20967 PPDSLNIMDITKSTVSLAWPKPKHDGGSKITGYVIEAQRKGSDQWTHITTVKGLECVVRN 21026

Query: 3288  LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPE-VVSPDQEMP-VYPP 3345
             L +G+EYT  ++             A N  G +    S  V V E  + P+ ++  +Y  
Sbjct: 21027 LTEGEEYTFQVM-------------AVNSAGRSAPRESRPVIVKEQTMLPELDLRGIYQK 21073

Query: 3346  AIITPLQDTVTSE----GQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQL 3401
              +I    D +  E    G+P             V+W   D+ +K ++         +  L
Sbjct: 21074 LVIAKAGDNIKVEIPVLGRPKP----------TVTWKKGDQILKQTQRVNFETTATSTIL 21123

Query: 3402  EIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3433
              I E    D G Y   A N VG+V     + +
Sbjct: 21124 NINECVRSDSGPYPLTARNIVGEVGDVITIQV 21155



 Score = 42.0 bits (97), Expect = 0.017
 Identities = 30/107 (28%), Positives = 47/107 (43%), Gaps = 7/107 (6%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             + +VV  G +A       G P PE++W R+    +      VQI       +L+I    +
Sbjct: 24032 KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDK----VQIEKGVNYTQLSIDNCDR 24087

Query: 73    ANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGS 119
              ++G+Y LK  N SG  ++   + V     PP   Q L    VR+ S
Sbjct: 24088 NDAGKYILKLENSSGSKSAFVTVKVLDTPGPP---QNLAVKEVRKDS 24131



 Score = 42.0 bits (97), Expect = 0.017
 Identities = 19/62 (30%), Positives = 32/62 (51%)

Query: 5205  EVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEA 5264
             ++ G P+P +KWYR    L    + KM   G   +L +   ++ + G Y C A N +GE 
Sbjct: 30555 QIVGRPLPDIKWYRFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEV 30614

Query: 5265  KS 5266
             ++
Sbjct: 30615 ET 30616



 Score = 41.6 bits (96), Expect = 0.022
 Identities = 50/242 (20%), Positives = 96/242 (39%), Gaps = 42/242 (17%)

Query: 1848 EPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD-GIHYLDIVDCKSYD 1906
            + V + EG+T    C+ +  P  K  W+ NG++++   R +   +  +H L I D ++ D
Sbjct: 8752 QDVTLKEGQTCTMTCQFS-VPNVKSEWFRNGRILKPQGRHKTEVEHKVHKLTIADVRAED 8810

Query: 1907 TGEVKVTAENPEGVIEHKVKLE-IQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVD 1965
             G+     E+ E   E +++ E IQ  +  ++++            H+    + EV   D
Sbjct: 8811 QGQYTCKYEDLETSAELRIEAEPIQFTKRIQNIV---------VSEHQSATFECEVSFDD 8861

Query: 1966 R-------PVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVEL 2018
                    P + TE+++    +   R  +  +   + +         +EG Y  I  +E 
Sbjct: 8862 AIVTWYKGPTELTESQK-YNFRNDGRCHYMTIHNVTPD---------DEGVYSVIARLEP 8911

Query: 2019 KSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAP 2078
            +   +  +          EL   TKE+  E K     + ++ IPT     I   P  E P
Sbjct: 8912 RGEARSTA----------ELYLTTKEIKLELKPPDIPDSRVPIPTM---PIRAVPPEEIP 8958

Query: 2079 KI 2080
             +
Sbjct: 8959 PV 8960



 Score = 41.6 bits (96), Expect = 0.022
 Identities = 30/128 (23%), Positives = 54/128 (42%), Gaps = 2/128 (1%)

Query: 4157  PPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQL 4216
             PP +  +       R G++  L    SG+P+P V+WF++   + ++ +   +    +  L
Sbjct: 16817 PPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLAL 16876

Query: 4217  YIKDVNSQDSGKYKCVAENNSGAVESVSDLTV--EPVTYRENSQFENIGEIYGKYSRDQQ 4274
                     DSGKY  V EN++G+ +    + V   P        F+ + + Y   S    
Sbjct: 16877 EKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDRPGPPVGPVSFDEVTKDYMVISWKPP 16936

Query: 4275  LQDQGESV 4282
             L D G  +
Sbjct: 16937 LDDGGSKI 16944



 Score = 41.6 bits (96), Expect = 0.022
 Identities = 143/730 (19%), Positives = 266/730 (36%), Gaps = 104/730 (14%)

Query: 2676  LIIAATKLDDIGEYTYKVA--TSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHP 2733
             LI+      D G+YT +    + K SA + V+         ++ V E      T+    P
Sbjct: 29502 LIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKEVSRDSVTITWEIP 29561

Query: 2734  NVKGVQWIKNGVVLE---------------SNEKYAIS--VKGTIYSLRIKNCAIVDESV 2776
              + G   + N +V +               S   Y IS  V+GT+Y  R+     + E++
Sbjct: 29562 TIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLVEGTMYYFRV-----LPENI 29616

Query: 2777  YGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAFE---------------VSVSHD 2821
             YG       + A L V  V ++    +V  +  +TV                  V  +  
Sbjct: 29617 YGIGEPCETSDAVL-VSEVPLVPAKLEVVDVTKSTVTLAWEKPLYDGGSRLTGYVLEACK 29675

Query: 2822  TVPVKWFHKSVEIKPSDKHRLVS-----ERKVHKLMLQNISPSDAGEYTAVVGQLECKAK 2876
                 +W  K V +KP+     V+     E+ + ++  QN       E    V  +  +  
Sbjct: 29676 AGTERWM-KVVTLKPTVLEHTVTSLNEGEQYLFRIRAQN--EKGVSEPRETVTAVTVQDL 29732

Query: 2877  LFVETLHI-TKTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGK 2934
               + T+ + T   K I VP  +       ++    P+  W   G ++  SE+  +    K
Sbjct: 29733 RVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTK 29792

Query: 2935  LHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITS---MLKDINAEEKDTITFEVT 2991
             + +L I  T+  D+ EYT    N   + + T+  I++         I  +E D  +  ++
Sbjct: 29793 VAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVIILDKPGPPTGPIKIDEIDATSITIS 29852

Query: 2992  VNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHF---GDAADYTF-VAGKATS 3047
                  +      +G  ++  D  +     ++ S+      F    +  +Y F VA     
Sbjct: 29853 WEPPELDGGAPLSGYVVEQRDAHRPGWLPVSESVTRSTFKFTRLTEGNEYVFRVAATNRF 29912

Query: 3048  TATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWM--KDDQELQIT----D 3101
                 Y+++  IE R     I++      +   +VS   +T+ W   +DD   Q+T    +
Sbjct: 29913 GIGSYLQSEVIECR---SSIRIPGPPETLQIFDVSRDGMTLTWYPPEDDGGSQVTGYIVE 29969

Query: 3102  RIKIQKEKYVHRLLIP-------STRMSDAGKY----TVV----AGGNVSTAKLFVEGRD 3146
             R +++ +++V    +P       ST +++  +Y    T +    +G     +K  V    
Sbjct: 29970 RKEVRADRWVRVNKVPVTMTRYRSTGLTEGLEYEHRVTAINARGSGKPSRPSKPIVAMDP 30029

Query: 3147  VRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKY----VVERRI 3202
             +      +  +V +  R  V    +  + +      G  I  Q  ++H++        +I
Sbjct: 30030 IAPPGKPQNPRVTDTTRTSVSLAWSVPEDEGGSKVTGYLIEMQKVDQHEWTKCNTTPTKI 30089

Query: 3203  HRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNAPEPPQVLQEL------------QPVT 3249
                 ++   Q    EY F V   N          P   +V + L            + + 
Sbjct: 30090 REYTLTHLPQ--GAEYRFRVLACNAGGPGEPAEVPGTVKVTEMLEYPDYELDERYQEGIF 30147

Query: 3250  VQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLI-EAFPEDAAV 3308
             V+ G   R    I G+P P   W KE Q +S   K   +   + +T L+I EA   D+  
Sbjct: 30148 VRQGGVIRLTIPIKGKPFPICKWTKEGQDIS---KRAMIATSETHTELVIKEADRGDSGT 30204

Query: 3309  YTCEAKNDYG 3318
             Y    +N  G
Sbjct: 30205 YDLVLENKCG 30214



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 6/106 (5%)

Query: 4153 ITNEPPKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQF--EEV 4210
            I  EPP  + + P       G ++ L+    G     + WF+    L          E +
Sbjct: 4201 IVQEPPSFVTK-PGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSGGSCYITKEAL 4259

Query: 4211 NCSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTV-EPVTYRE 4255
              S +LY+  V + DSG Y C   N +G VE  ++L V EP T+ E
Sbjct: 4260 ESSLELYL--VKTSDSGTYTCKVSNVAGGVECSANLFVKEPATFVE 4303



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 5193  KVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGE 5252
             ++    TL     V G PVP   W + +  L+ D R+ ++ VG    L I +  + + G 
Sbjct: 15115 QIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKD-RVVIDNVGTKSELIIKDALRKDHGR 15173

Query: 5253  YMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQ 5289
             Y+  A N  G   + A V++      V+ L P VT++
Sbjct: 15174 YVITATNSCGSKFAAARVEVFDVPGPVLDLKPVVTNR 15210



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 33/141 (23%), Positives = 63/141 (44%), Gaps = 14/141 (9%)

Query: 67    IPAVTKANSGRYSLKATNGSGQAT---STAEL-LVKAETAPPNFVQ--RLQSMTVRQGSQ 120
             +P + +    R+ +KA N +G++    +T E+     +  P  F+       +  + GSQ
Sbjct: 15768 VPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPATDIQEEPEVFIDIGAQDCLVCKAGSQ 15827

Query: 121   VRLQVRVTGIPTPVVKFYRDGAEIQSSLD--FQISQEGDLYS------LLIAEAYPEDSG 172
             +R+   + G PTP   +  DG   ++  D    I ++  L +      ++I E     +G
Sbjct: 15828 IRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECKRSHTG 15887

Query: 173   TYSVNATNSVGRATSTAELLV 193
              YS+ A N  G+ T+   + V
Sbjct: 15888 KYSITAKNKAGQKTANCRVKV 15908



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 29/146 (19%), Positives = 62/146 (42%), Gaps = 9/146 (6%)

Query: 5172  EAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSL--LEPDERI 5229
             E +  +D + P   ++      V    T+     V G P P V W ++K    L    R+
Sbjct: 18191 EVVVKEDLQKPVLDLKLSGVLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRV 18250

Query: 5230  KMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQ 5289
             K++   +     ++  ++ +GG+Y+  A N  G   ++A V+++ +       P PV + 
Sbjct: 18251 KIDTRADSSKFSLTKAKRSDGGKYVVTATNTAGSFVAYATVNVLDK-------PGPVRNL 18303

Query: 5290  HVMEFDLEHTTSSRTPSPQEIVLEVE 5315
              +++   +  T    P   +   E++
Sbjct: 18304 KIVDVSSDRCTVCWDPPEDDGGCEIQ 18329



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query: 2059  ITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKI 2118
             +++P       E    +  PKI    Q  T+  G        V GKP P C+W K   ++
Sbjct: 18881 VSLPREAEGVYEAKEQLLPPKILMPEQI-TIKAGKKLRIEAHVYGKPHPTCKWKKGEDEV 18939

Query: 2119  ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2158
               S  +  +   D+   L+I+DVT +DS    + A N +G
Sbjct: 18940 VTSSHLAVH-KADSSSILIIKDVTRKDSGYYSLTAENSSG 18978



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 35/150 (23%), Positives = 64/150 (42%), Gaps = 6/150 (4%)

Query: 1240  VEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKN 1299
             +  +E+  +  EE+   + ++R I  T   +            ++E+          +K+
Sbjct: 19246 IPQEEYTATGLEEKA--QYQFRAIARTAVNISPPSEPSDPVTILAENVPPRIDLSVAMKS 19303

Query: 1300  YRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPED 1358
                ++ G  V     + G P+P ++W KDG  +K  E  +M  +Q    +L +  V  +D
Sbjct: 19304 LLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKM-AMQRNLCTLELFSVNRKD 19362

Query: 1359  EGIYTAFASNIKGNAICSGKLYV--EPAAP 1386
              G YT  A N  G+   + KL V  +P  P
Sbjct: 19363 SGDYTITAENSSGSKSATIKLKVLDKPGPP 19392



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 29/147 (19%), Positives = 62/147 (42%), Gaps = 4/147 (2%)

Query: 70    VTKANSGRYSLKATNGSGQATSTAELLVKAE--TAPPNFVQRLQSMT--VRQGSQVRLQV 125
             +T+     + + A N +G+ T +   +V  +   AP   ++ L  +    ++ S  RL++
Sbjct: 19945 LTEGKEYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKI 20004

Query: 126   RVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRA 185
              + G P P V + +    + +     +       +L++ +    D+G Y++   N  G  
Sbjct: 20005 PIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTK 20064

Query: 186   TSTAELLVQGEEEVPAKKTKTIVSTAQ 212
               T  + V G+  +P    K    TA+
Sbjct: 20065 EGTISIKVVGKPGIPTGPIKFDEVTAE 20091



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 25/110 (22%), Positives = 49/110 (44%), Gaps = 4/110 (3%)

Query: 5168  GTPNE-AIEPKDNEMPPSFIEPLTKRKVY---ENTTLGFIVEVEGLPVPGVKWYRNKSLL 5223
             GTP+E  +  +D+ + P           Y   EN+     + ++G P P V W + +  L
Sbjct: 19964 GTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPL 20023

Query: 5224  EPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
               D R+ +E      +L + + QK + G+Y     N+ G  +   ++ ++
Sbjct: 20024 ATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVV 20073



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 1/86 (1%)

Query: 5378  MPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHT 5437
             +PP F +    F +    D       IG PTP V W+K+ + ++        S E  S  
Sbjct: 22146 IPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTENNS-L 22204

Query: 5438  LKIRNVCLSDSATYRCRAVNCVGEAI 5463
             L I++ C  D   Y  +  N  GEAI
Sbjct: 22205 LTIKDACREDVGHYVVKLTNSAGEAI 22230



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKE-DGTQSLIIVPATPSDSGEWT 1529
             G++ + D  + G+P+P   W    Q++ N  T ++ IK  D   SL +  A   DSG + 
Sbjct: 22558 GESFKVDADIYGKPIPTIQWIKGDQELSN--TARLEIKSTDFATSLSVKDAVRVDSGNYI 22615

Query: 1530  VVAQNRAGRSSISVILTV 1547
             + A+N AG  S++V + V
Sbjct: 22616 LKAKNVAGERSVTVNVKV 22633



 Score = 41.2 bits (95), Expect = 0.029
 Identities = 26/99 (26%), Positives = 41/99 (41%), Gaps = 2/99 (2%)

Query: 6     PTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKL 65
             P+   P  +  V        +    G P   V+W +DGQ +  +T   V +S S     L
Sbjct: 25395 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTR--VNVSSSKTVTSL 25452

Query: 66    TIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
             +I   +K + G Y L  +N +G  T    ++V     PP
Sbjct: 25453 SIKEASKEDVGTYELCVSNSAGSITVPITIIVLDRPGPP 25491



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 56/244 (22%), Positives = 90/244 (36%), Gaps = 32/244 (13%)

Query: 3211  RQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKI 3270
             R +D  E T V  + R+     V  P  P  +  ++  T     P       +GR    I
Sbjct: 14244 RVTDVIEGTEVQFQVRAENEAGVGHPSEPTEILSIEDPTSPPSPPLDLHVTDAGRKHIAI 14303

Query: 3271  SWYKEEQLLST---GFKCKFLHDGQEYTLLLIE-------------AFPEDAAVYTCEAK 3314
             +W   E+   +   G+  +    G E  + +                 P+   V    A 
Sbjct: 14304 AWKPPEKNGGSPIIGYHVEMCPVGTEKWMRVNSRPIKDLKFKVEEGVVPDKEYVLRVRAV 14363

Query: 3315  NDYGVATTSASLSVEVPE-VVSPDQEMPVYPPAIITPLQDTVTSEGQ----PARFQCRVS 3369
             N  GV+  S     E+ E VV+ D   P   P I     D +  EG+    P  F+    
Sbjct: 14364 NAIGVSEPS-----EISENVVAKD---PDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPV 14415

Query: 3370  GTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTA 3429
              T   VSW+   K++K S    M     +  LE+ ++   D G YT    N +G  +++ 
Sbjct: 14416 PT---VSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASI 14472

Query: 3430  NLSL 3433
             N+ +
Sbjct: 14473 NVKV 14476



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 32/139 (23%), Positives = 57/139 (41%), Gaps = 9/139 (6%)

Query: 5171  NEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIK 5230
             +E +  KD +  P+         V E   L   V    +PVP V W+++   ++  +R+ 
Sbjct: 14375 SENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLT 14434

Query: 5231  MERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQH 5290
             M+       LE+    + + G Y     N +G A +  NV       +V+ LP P   + 
Sbjct: 14435 MKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINV-------KVIGLPGPC--KD 14485

Query: 5291  VMEFDLEHTTSSRTPSPQE 5309
             +   D+  ++   T  P E
Sbjct: 14486 IKASDITKSSCKLTWEPPE 14504



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 38/162 (23%), Positives = 65/162 (40%), Gaps = 7/162 (4%)

Query: 37    VSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQAT--STAE 94
             V +F D Q++ T+            R + T+  + +    +  + A N +G+     T  
Sbjct: 15034 VGYFVDKQLVGTNEWSRCTEKMIKVR-QYTVKEIREGADYKLRVSAVNAAGEGPPGETQP 15092

Query: 95    LLVKAETAPPNF---VQRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQ 151
             + V     PP     V     + +  G  +R+   VTG P P   + ++  E+       
Sbjct: 15093 VTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDR-VV 15151

Query: 152   ISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193
             I   G    L+I +A  +D G Y + ATNS G   + A + V
Sbjct: 15152 IDNVGTKSELIIKDALRKDHGRYVITATNSCGSKFAAARVEV 15193



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 31/109 (28%), Positives = 45/109 (41%), Gaps = 5/109 (4%)

Query: 5168  GTPNEAIEPKDNEMPPSFIEPLTKRK---VYENTTLGFIVEVEGLPVPGVKWYRNKSLLE 5224
             G   + IE KD  + P      + R    V+    +  I  V G P P V W  N+  L 
Sbjct: 16507 GEVTDVIEMKDRLVSPDLQLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLP 16566

Query: 5225  PDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
              +  I+   + +  S+ I N Q+   G Y   A N  GE K    VD++
Sbjct: 16567 QEATIETTAISS--SMVIKNCQRSHQGVYSLLAKNEAGERKKTIIVDVL 16613



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 45/200 (22%), Positives = 81/200 (40%), Gaps = 24/200 (12%)

Query: 3141  FVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHW----YKDGIEI-NFQVQER-- 3193
             FVE  +  +  I++ + V E+   +   EV ++ V   W    Y  G EI N+ ++ R  
Sbjct: 16701 FVETSEALV--IREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLI 16758

Query: 3194  -----HKYVVERRIHRMF-ISETRQSDAGEYTF----VAGRNRSS-----VTLYVNAPEP 3238
                  HK   +  + R + +   ++ D  EY      + G+ + S     +T       P
Sbjct: 16759 GTEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPP 16818

Query: 3239  PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3298
                L     +T++ G+        SG+P+PK+SW+K+E  +    +           L  
Sbjct: 16819 TLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTPATLALEK 16878

Query: 3299  IEAFPEDAAVYTCEAKNDYG 3318
             I+A   D+  Y    +N  G
Sbjct: 16879 IKAKRSDSGKYCVVVENSTG 16898



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 6/110 (5%)

Query: 923   EAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQ 982
             E+ + +    P  VE+ VT   ++      TV  G+++ +   + G P P +TW +E   
Sbjct: 17895 ESVIAKDILHPPEVELDVTCRDVI------TVRVGQTIRILARVKGRPEPDITWTKEGKV 17948

Query: 983   IESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
             +       +        L I+EA   D G++  SA N +G    S  + V
Sbjct: 17949 LVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNV 17998



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 36/125 (28%), Positives = 52/125 (41%), Gaps = 11/125 (8%)

Query: 5172  EAIEPKDNEMPPSFIEPLTKRK---VYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDER 5228
             EAI+PK+   PP      + RK   V     +     V G P P V W R   +     +
Sbjct: 18593 EAIKPKEILEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTW-RKVGIDNVVRK 18651

Query: 5229  IKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTH 5288
              +++ V  +  L I N  + + G+Y    VN  GE   F NV       RV+  P PV+ 
Sbjct: 18652 GQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNV-------RVLDTPGPVSD 18704

Query: 5289  QHVME 5293
               V +
Sbjct: 18705 LKVSD 18709



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 13/146 (8%)

Query: 1727  TPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTD 1786
             T  G P   V W  DG  L+ A  ++M  +   C+L+      +DSG  T  A N  G+ 
Sbjct: 19318 TVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSK 19377

Query: 1787  HTSATLIVKDE---KSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDI 1843
               +  L V D+    + V+ +++   R  L     LE    E  +T    D++E  +P+ 
Sbjct: 19378 SATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSE--ITNYIVDKRETSRPNW 19435

Query: 1844  VLYPEPV--------RVLEGETARFR 1861
                   V        +++EG   +FR
Sbjct: 19436 AQVSATVPITSCSVEKLIEGHEYQFR 19461



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 96/430 (22%), Positives = 156/430 (36%), Gaps = 78/430 (18%)

Query: 3081  VSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKL 3140
             +  P   V W KD+  L+ T R+  +  +    L I      D G Y V    +   A  
Sbjct: 22172 IGRPTPAVTWHKDNVPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEA-- 22229

Query: 3141  FVEGRDVRIRSIKKEVQVIEK----QRAVVEFEVNEDDVDAHW----YKDGIEINFQVQE 3192
                     I ++   V V++K       V   EV  D +   W    Y  G  IN  + E
Sbjct: 22230 --------IETL--NVIVLDKPGPPTGPVKMDEVTADSITLSWGPPKYDGGSSINNYIVE 22279

Query: 3193  RHK------YVVERRIHRMFISETRQSDAGEYTF-VAGRNRSSVTLYVNA---------- 3235
             +         +V   + R  I   R     EY F +A  NR   + Y+N+          
Sbjct: 22280 KRDTSTTTWQIVSATVARTTIKACRLKTGCEYQFRIAAENRYGKSTYLNSEPTVAQYPFK 22339

Query: 3236  -PEPP----QVLQELQPVTVQSGKP-----ARFCAV-ISGRPQPKISWYK--EEQLLSTG 3282
              P PP      L     + VQ  +P     +R     +  + +  I W K  +  +  T 
Sbjct: 22340 VPGPPGTPVVTLSSRDSMEVQWNEPISDGGSRVIGYHLERKERNSILWVKLNKTPIPQTK 22399

Query: 3283  FKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPV 3342
             FK   L +G EY              +   A+N  G+   S    V    V     + P 
Sbjct: 22400 FKTTGLEEGVEYE-------------FRVSAENIVGIGKPS---KVSECYVARDPCDPPG 22443

Query: 3343  YPPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKP-SRFFR--MTQFEDTY 3399
              P AII   +++VT + +   +     G+  K++ Y  +KK  P  R+ +   T   DT+
Sbjct: 22444 RPEAIIV-TRNSVTLQWKKPTYD---GGS--KITGYIVEKKELPEGRWMKASFTNIIDTH 22497

Query: 3400  QLEIAEAYPEDEGTYTFVASNAVGQVS--STANLSLEAPESILHERIEQEIEMEMKELFS 3457
               E+     +    +  +A NA G  S  S +  ++ A + +   RI  + + +   +  
Sbjct: 22498 -FEVTGLVEDHRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPKYKDTIVVH 22556

Query: 3458  EGESEHSERD 3467
              GES   + D
Sbjct: 22557 AGESFKVDAD 22566



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 25/88 (28%), Positives = 41/88 (46%)

Query: 113   MTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSG 172
             +TVR G  V L++   G P P + + +DG  ++ S   + S+  +  +L I  A  E  G
Sbjct: 27573 VTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGG 27632

Query: 173   TYSVNATNSVGRATSTAELLVQGEEEVP 200
              Y+V   N+V R      ++  G    P
Sbjct: 27633 KYTVILDNAVCRIAVPITVITLGPPSKP 27660



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 2/91 (2%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             Q +    GS  T +  ISG P P+V+W  +   +  +    V I+ +  R  LT+    +
Sbjct: 28655 QLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDR--VSITTTKDRTTLTVKDSMR 28712

Query: 73    ANSGRYSLKATNGSGQATSTAELLVKAETAP 103
              +SGRY L   N +G  T +  ++V     P
Sbjct: 28713 GDSGRYFLTLENTAGVKTFSVTVVVIGRPGP 28743



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 22/91 (24%), Positives = 50/91 (54%), Gaps = 6/91 (6%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             ++V +  G++      +SG P P ++W + G  +++  +    I  ++  + L +  V +
Sbjct: 29454 KTVTIRAGASLRLMVSVSGRPPPVITWSKQGIDLASRAI----IDTTESYSLLIVDKVNR 29509

Query: 73    ANSGRYSLKATNGSGQATSTAELLVKAETAP 103
              ++G+Y+++A N SG+ ++T  +LVK    P
Sbjct: 29510 YDAGKYTIEAENQSGKKSAT--VLVKVYDTP 29538



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 24/92 (26%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 932   VPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQI 991
             VPA + +P T    + G+  V  + GE V+++   SG P P +TW +    I+++  +Q+
Sbjct: 31021 VPAKIHLPKT----LEGMGAVHALRGEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQV 31076

Query: 992   TFQSGIARLMIREAF-AEDSGRFTCSAVNEAG 1022
                     L+       +D+G +   A N  G
Sbjct: 31077 IVTRSFTSLVFPNGVERKDAGFYVVCAKNRFG 31108



 Score = 40.8 bits (94), Expect = 0.038
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 1/93 (1%)

Query: 1556  PMFVEKL-KNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAA 1614
             P  +E L  +++I EG  L +    TG P P++ W      I   +  +  IE T     
Sbjct: 33328 PPKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTT 33387

Query: 1615  LKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1647
             L I     QD   YT +  N+ G D+    +++
Sbjct: 33388 LIIMDVQKQDGGLYTLSLGNEFGSDSATVNIHI 33420



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 57/255 (22%), Positives = 100/255 (39%), Gaps = 26/255 (10%)

Query: 10    QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPA 69
             +PL SV V+E  TA FE  IS   +   +W   G+ +  +  P  +I        L +  
Sbjct: 12111 RPLHSVEVMETETARFETEISEDDI-HANWKLKGEALLQT--PDCEIKEEGKIHSLVLHN 12167

Query: 70    VTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVTG 129
                  +G    +A N      S+A L VK        ++ L+ +TV  G        ++ 
Sbjct: 12168 CRLDQTGGVDFQAAN----VKSSAHLRVKPRVI--GLLRPLKDVTVTAGETATFDCELSY 12221

Query: 130   IPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTA 189
                P V++Y  G +++ S       EG +++L + +   ED+G   + A +      + A
Sbjct: 12222 EDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKD----FKTHA 12276

Query: 190   ELLVQGEEEVPAKKTKTI---------VSTAQISESRQTRIEKKIEAHFDARSIATVEMV 240
              L V   +E P + TK +          +  +   SR+    K  +   +       E+V
Sbjct: 12277 NLFV---KEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEIV 12333

Query: 241   IDGAAGQQLPHKTPP 255
              DG   + + H   P
Sbjct: 12334 ADGRVRKLVIHDCTP 12348



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 32/152 (21%), Positives = 61/152 (40%), Gaps = 32/152 (21%)

Query: 912   REERFEVLHGREAKVTETARVPAPVEI--PVTPPTLVSGLKNVTVIEGESVTLECHISGY 969
             +E +F V     A ++E +R   P +   P+  P ++    ++ V  G+ + L+  ISG 
Sbjct: 14648 KEYQFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRT-SLEVKRGDEIALDASISGS 14706

Query: 970   PSPTVTWYRE----------------------DYQIESSIDFQIT-------FQSGIARL 1000
             P PT+TW ++                      + Q E      +T        + G ++L
Sbjct: 14707 PYPTITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQL 14766

Query: 1001  MIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
              +R++   D G +     N+ G     C ++V
Sbjct: 14767 RVRDSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 4/70 (5%)

Query: 1469  LEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQS-LIIVPATPSDSGE 1527
             + G+T R    V GRP+P   W  +  ++  D   +VVI   GT+S LII  A   D G 
Sbjct: 15117 MAGKTLRIPAVVTGRPVPTKVWTKEEGELDKD---RVVIDNVGTKSELIIKDALRKDHGR 15173

Query: 1528  WTVVAQNRAG 1537
             + + A N  G
Sbjct: 15174 YVITATNSCG 15183



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 14/110 (12%)

Query: 933   PAPVEIPVTPPTLVSGLKN-VTVIEGESVTLECHISGYPSPTVTWY---------REDYQ 982
             P   + P  PP++   LK  + V EG +V +   I G P PT+TW+         +E   
Sbjct: 16108 PCDCQRPDMPPSI--DLKEFMEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVL 16165

Query: 983   IESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
              ++ ++  +        L+I ++   D+G +T +AVN  GT S    L V
Sbjct: 16166 YDTHVNKLVV--DDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 16213



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 2/95 (2%)

Query: 3248  VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3307
             +TV++G      A + G+P P +SW K+  LL      K        TL L     +D+ 
Sbjct: 19305 LTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSG 19364

Query: 3308  VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPV 3342
              YT  A+N  G  + SA++ ++V +   P   + +
Sbjct: 19365 DYTITAENSSG--SKSATIKLKVLDKPGPPASVKI 19397



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 42/182 (23%), Positives = 76/182 (41%), Gaps = 22/182 (12%)

Query: 3062  KHIKDIKVLEKKRAMFECEV---SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPS 3118
             K + D+  L K+ + F  ++    +P  +V W K +  L    R+ ++       L++  
Sbjct: 19985 KGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYD 20044

Query: 3119  TRMSDAGKYTV----VAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDD 3174
              + SDAGKYT+    VAG    T  + V G+   I +   +   +  +   +++   +DD
Sbjct: 20045 CQKSDAGKYTITLKNVAGTKEGTISIKVVGKP-GIPTGPIKFDEVTAEAMTLKWAPPKDD 20103

Query: 3175  VDAHWYKDGIEINFQVQERHKYVVER------RIHRMFISETRQSDAGEYTF-VAGRNRS 3227
                     G EI   + E+   V  +       + +     TR  +  EYTF V+  N+ 
Sbjct: 20104 -------GGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFRVSAENKY 20156

Query: 3228  SV 3229
              V
Sbjct: 20157 GV 20158



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 25/111 (22%), Positives = 47/111 (42%), Gaps = 3/111 (2%)

Query: 86    SGQATSTAELLVKAETAPPNFV---QRLQSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGA 142
             S  + ST  +  + E  PP      +   ++ V  G   ++   + G P P +++ +   
Sbjct: 22523 SEPSESTGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQ 22582

Query: 143   EIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLV 193
             E+ ++   +I       SL + +A   DSG Y + A N  G  + T  + V
Sbjct: 22583 ELSNTARLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 31/110 (28%), Positives = 46/110 (41%), Gaps = 4/110 (3%)

Query: 2052  ALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEW 2111
             A+++    T P    D++EL      PK  + I    V  G        V GKP P  EW
Sbjct: 23603 AISKPSDSTGPITAKDEVELPRISMDPKFRDTI---VVNAGETFRLEADVHGKPLPTIEW 23659

Query: 2112  YKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETS 2161
              +   +IE S R       D    L+++D    D    +++A N+AG  S
Sbjct: 23660 LRGDKEIEESARCE-IKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKS 23708



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 37/152 (24%), Positives = 66/152 (43%), Gaps = 14/152 (9%)

Query: 885   DTPDTYKSEAGVEVKKEVGVSITGTTVREERFE---VLHGREAKVTE----TARVPAPVE 937
             D PD    +A      E   +++G  V ++R+E   +        +E    +  + A  E
Sbjct: 24643 DLPDGRWMKASFTNVLETEFTVSGL-VEDQRYEFRVIARNAAGNFSEPSDSSGAITARDE 24701

Query: 938   IPVTPPTLVSGLKNVTVIE-GESVTLECHISGYPSPTVTWYREDYQIESS---IDFQITF 993
             I     +L    K+V V+  GE+  LE  I G P P V W ++  ++E +   ++ + T 
Sbjct: 24702 IDAPNASLDPKYKDVIVVHAGETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTI 24761

Query: 994   QSGIARLMIREAFAEDSGRFTCSAVNEAGTVS 1025
             Q     L++++    D G++     N  GT S
Sbjct: 24762 QK--TTLVVKDCIRTDGGQYILKLSNVGGTKS 24791



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 19/85 (22%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 4156  EPPKMLQEMPKH--ARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCS 4213
             EPP+++ ++        + G+ + +   I+G P PV++W ++G+ +++  + +    +  
Sbjct: 25785 EPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNH 25844

Query: 4214  HQLYIKDVNSQDSGKYKCVAENNSG 4238
               L +KD   +D+G+Y    +N +G
Sbjct: 25845 TLLTVKDCIRRDTGQYVLTLKNVAG 25869



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 3/85 (3%)

Query: 4157  PPKMLQEMPKHA---RCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCS 4213
             PPK   +   H      R G  ++L+  + G+P+P + W +    L   +K   +     
Sbjct: 29043 PPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKR 29102

Query: 4214  HQLYIKDVNSQDSGKYKCVAENNSG 4238
                 IK  +  DSGKY    +N SG
Sbjct: 29103 ATAVIKFCDRSDSGKYTLTVKNASG 29127



 Score = 40.4 bits (93), Expect = 0.050
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 10/124 (8%)

Query: 1527  EWTVVAQNRAG-----RSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATG 1581
             E+ V A+N  G     R+++S+   + + E    P   +++K+V  K G   ++  +  G
Sbjct: 30502 EFRVFAENETGLSRPRRTAMSIKTKLTSGE---APGIRKEMKDVTTKLGEAAQLSCQIVG 30558

Query: 1582  NPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTT 1641
              P PDI W +    ++  +  K+  +G      L + +   +D   YT  A N+ G   T
Sbjct: 30559 RPLPDIKWYRFGKELIQSRKYKMSSDGR--THTLTVMTEEQEDEGVYTCIATNEVGEVET 30616

Query: 1642  RCKV 1645
               K+
Sbjct: 30617 SSKL 30620



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 4/114 (3%)

Query: 916   FEVLHGREAKVTETARVPAPVEIP---VTPPTLVSGLKN-VTVIEGESVTLECHISGYPS 971
             + V    +A V++ + +  P+      V P   +S  K+ + VI    +T+    +GYP 
Sbjct: 13364 YRVSAENKAGVSDPSEILGPLTADDAFVEPTMDLSAFKDGLEVIVPNPITILVPSTGYPR 13423

Query: 972   PTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVS 1025
             PT TW   D  +E+    ++   S  A L+I  +   D G +T    N   T+S
Sbjct: 13424 PTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTIS 13477



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 28/106 (26%), Positives = 44/106 (41%), Gaps = 5/106 (4%)

Query: 17    VLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLP-----GVQISFSDGRAKLTIPAVT 71
             V EG+     A I G P P ++WF+       +  P      V     D    L IP   
Sbjct: 16128 VEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSR 16187

Query: 72    KANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQ 117
             ++++G Y++ A N  G A+    L V     PP    + +S++  Q
Sbjct: 16188 RSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESVSADQ 16233



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 3237  EPPQVLQELQPVTVQS---GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQE 3293
             EPP+++ +      Q    G   R  A+I G P PK++W KE++   T  +      G +
Sbjct: 17214 EPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVTPVGSK 17273

Query: 3294  YTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3328
               L +  A  ED  +Y+   +N  G  T S  + V
Sbjct: 17274 --LEIRNAAHEDGGIYSLTVENPAGSKTVSVKVLV 17306



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 25/85 (29%), Positives = 39/85 (45%), Gaps = 4/85 (4%)

Query: 20    GSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYS 79
             G T    A I G P P+V+W ++ +   T      +I  +   +KL I      + G YS
Sbjct: 17233 GDTLRLSAIIKGVPFPKVTWKKEDRDAPTKA----RIDVTPVGSKLEIRNAAHEDGGIYS 17288

Query: 80    LKATNGSGQATSTAELLVKAETAPP 104
             L   N +G  T + ++LV  +  PP
Sbjct: 17289 LTVENPAGSKTVSVKVLVLDKPGPP 17313



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 1105  VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGE 1164
             + G P P V WKK   PL T  R  VS         L++      DAG+YTI ++N  G 
Sbjct: 20006 IKGKPAPSVSWKKGEDPLATDTR--VSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGT 20063

Query: 1165  TSASASL 1171
                + S+
Sbjct: 20064 KEGTISI 20070



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 27/97 (27%), Positives = 40/97 (41%)

Query: 5177  KDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGN 5236
             KD  +PP+F        V     L   V   G P P V W+++   L+   R+  E   N
Sbjct: 22142 KDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPLKQTTRVNAESTEN 22201

Query: 5237  VCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
                L I +  + + G Y+    N  GEA    NV ++
Sbjct: 22202 NSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVL 22238



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 1/79 (1%)

Query: 4163  EMPKHA-RCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDV 4221
             E+P H    +  + + ++    G PQ  V W ++G  LK+  +           L IK+ 
Sbjct: 25398 ELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSIKEA 25457

Query: 4222  NSQDSGKYKCVAENNSGAV 4240
             + +D G Y+    N++G++
Sbjct: 25458 SKEDVGTYELCVSNSAGSI 25476



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 4/92 (4%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             ++++V  G++ T      G PVP V W +    + T       +  +D R  LTI    +
Sbjct: 26194 KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAY----VDTTDSRTSLTIENANR 26249

Query: 73    ANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
              +SG+Y+L   N    A+ T  + V     PP
Sbjct: 26250 NDSGKYTLTIQNVLSAASLTLVVKVLDTPGPP 26281



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             + G+ + +     G P P VTW ++   L  + ++  E  + S  L I  V   D+GKY 
Sbjct: 27284 KAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYI 27343

Query: 4231  CVAENNSGAVES 4242
                EN  G  +S
Sbjct: 27344 LTIENGVGEPKS 27355



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 2/73 (2%)

Query: 1096  GGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1155
             G  +V    VGG P+P + W K    L    +  + Y  +      VI      D+G+YT
Sbjct: 29062 GSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGK--RATAVIKFCDRSDSGKYT 29119

Query: 1156  IVVRNKHGETSAS 1168
             + V+N  G  + S
Sbjct: 29120 LTVKNASGTKAVS 29132



 Score = 40.0 bits (92), Expect = 0.065
 Identities = 29/115 (25%), Positives = 51/115 (44%), Gaps = 13/115 (11%)

Query: 1434  PARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHD 1493
             P  +     LE  D    ER  + +FV         +G   R  + + G+P P   W  +
Sbjct: 30122 PGTVKVTEMLEYPDYELDERYQEGIFVR--------QGGVIRLTIPIKGKPFPICKWTKE 30173

Query: 1494  GQQIVNDYTHKVVIKEDGTQS-LIIVPATPSDSGEWTVVAQNRAGRSSISVILTV 1547
             GQ    D + + +I    T + L+I  A   DSG + +V +N+ G+ ++ + + V
Sbjct: 30174 GQ----DISKRAMIATSETHTELVIKEADRGDSGTYDLVLENKCGKKAVYIKVRV 30224



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 141/747 (18%), Positives = 253/747 (33%), Gaps = 122/747 (16%)

Query: 261   PKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPTPSPVRSVSPAARISTSPIRS 320
             PK+R P  P  A   +   +  P      P+ V   R       +    A +    PI+ 
Sbjct: 9660  PKARVPEEPKRAVPEEKVLKLKPKREEEPPAKVTEFRKRVVKEEKVSIEAPKREPQPIKE 9719

Query: 321   VRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSS----EAEMRETTLTTSTQIRTEERW 376
             V   ++  K +A T+    E     ++E Y         E E  E T         EER 
Sbjct: 9720  VT--IMEEKERAYTLEE--EAVSVQREEEYEEYEEYDYKEFEEYEPTEEYDQYEEYEERE 9775

Query: 377   EGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDADKSAAVATVVAAVDMA 436
               RY   E+                     +  A  AK +K+   +      +   +   
Sbjct: 9776  YERYEEHEEYITEPEKPIPVKPVPEEPVPTKPKAPPAKVLKKAVPEEKVPVPIPKKLKPP 9835

Query: 437   RVREPV-----------ISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVA--- 482
               + P            IS  ++  ++ T  A  +    ++V  E EK  V +  VA   
Sbjct: 9836  PPKVPEEPKKVFEEKIRISITKREKEQVTEPAAKVPMKPKRVVAE-EKVPVPRKEVAPPV 9894

Query: 483   ----ADKAKEQELKSRTKEVITTKQEQM-----HVTHEQIRKETEKTFVPKVVISAAKA- 532
                   K  E E  +  +EV+T  +E +        HE+    TE+  VP + +   +  
Sbjct: 9895  RVPEVPKELEPEEVAFEEEVVTHVEEYLVEEEEEYIHEEEEFITEEEVVPVIPVKVPEVP 9954

Query: 533   ----------------------------KEQETRISEEITKKQK-------QVTQEAIRQ 557
                                         K+ E ++   I KK+K       +V ++ + +
Sbjct: 9955  RKPVPEEKKPVPVPKKKEAPPAKVPEVPKKPEEKVPVLIPKKEKPPPAKVPEVPKKPVPE 10014

Query: 558   E-TEITAASMVVVATAKSTKLETVPGAQEETTTQQDQMHLSYEKIMKETRKTVVPKVIVA 616
             E   +     V    AK  ++   P  +++      +   +    + E  K ++P+    
Sbjct: 10015 EKVPVPVPKKVEAPPAKVPEVPKKPVPEKKVPVPAPKKVEAPPAKVPEVPKKLIPEEKKP 10074

Query: 617   TPKVKEQDLVSRGREGITTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILRTR 676
             TP  K+   V      +  KRE V +    + +E E      I        E+E +L   
Sbjct: 10075 TPVPKK---VEAPPPKVPKKREPVPV-PVALPQEEEVLFEEEIVPEEEVLPEEEEVLPEE 10130

Query: 677   ETMATRQEQI-----QVTHGKVDVGKKAEAVATVVAAVDQARVREPREPGHLEESYAQQT 731
             E +   +E++     ++   + +V  + E V      V +  V    +P     +   + 
Sbjct: 10131 EEVLPEEEEVLPEEEEIPPEEEEVPPEEEYVPEEEEFVPEEEVLPEVKPKVPVPAPVPE- 10189

Query: 732   TLEYGYKERISAAKVAEPPQR---PASEPHVVPKAVKPRVIQAPSETHIKTTDQKGMHIS 788
                   K++++  KV  P +    PA  P  VPK V+ + I  P E  +   +       
Sbjct: 10190 -----IKKKVTEKKVVIPKKEEAPPAKVPE-VPKKVEEKRIILPKEEEVLPVE------- 10236

Query: 789   SQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAGSAIATLQKELSA 848
                   T+   E  +  ++ P        V +++ P+     + ++              
Sbjct: 10237 -----VTEEPEEEPISEEEIPEEPPSIEEVEEVAPPRVPEVIKKAV-------------- 10277

Query: 849   TSSAQKITKSVKAPTVKPSETRVRAEPTPLP----QFPFADTPDTYKSEAGVEV---KKE 901
               +   + K V+AP  K S+ ++  E  P+P    + P A  P+  K     +V   KKE
Sbjct: 10278 PEAPTPVPKKVEAPPAKVSK-KIPEEKVPVPVQKKEAPPAKVPEVPKKVPEKKVLVPKKE 10336

Query: 902   VGVSITGTTVREERFEVLHGREAKVTE 928
                   G TV EE+  V   +E  V E
Sbjct: 10337 AVPPAKGRTVLEEKVSVAFRQEVVVKE 10363



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 64/306 (20%), Positives = 116/306 (37%), Gaps = 42/306 (13%)

Query: 3946  FLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSS 4005
             F + + + EV E D+   VC     P   V WY  D  I     + I +     IL + +
Sbjct: 12465 FTKNLANIEVSETDTIKLVCEVSK-PGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQN 12523

Query: 4006  VHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVPVFHDYLDEEEELALVFDQ 4065
              H ++ G+  C L +     +T   +KV     H++ A       +++ + + L ++  +
Sbjct: 12524 AHLEDAGNYNCRLPSS----RTDGKVKV-----HELAA-------EFISKPQNLEILEGE 12567

Query: 4066  AKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVEIQVTAATPIPEQDKESKEVFQ 4125
                   S+S+E            PV    D + L    +  V A           K V  
Sbjct: 12568 KAEFVCSISKESF----------PVQWKRDDKTLESGDKYDVIA--------DGKKRVLV 12609

Query: 4126  TEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMP-KHARCREGDSIILECLISG 4184
              ++   + M    V          L+ I     K+   +P K  R +E   ++  C ++ 
Sbjct: 12610 VKDATLQDMGTYVVMVGAARAAAHLTVIE----KLRIVVPLKDTRVKEQQEVVFNCEVNT 12665

Query: 4185  EPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGA-VESV 4243
             E      WF+N   +  + K+   + +  + L I+D +  D   Y     N+ G  V+S 
Sbjct: 12666 EGAKA-KWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSA 12724

Query: 4244  SDLTVE 4249
             ++L VE
Sbjct: 12725 ANLIVE 12730



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 22/93 (23%), Positives = 46/93 (49%), Gaps = 2/93 (2%)

Query: 12    LQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVT 71
             L  + V  G+     A ++G P P+++W +   ++       + I     ++ +TI    
Sbjct: 13697 LAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKR--ITIENVPKKSTVTIVDSK 13754

Query: 72    KANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
             ++++G Y ++A N  G+AT+  E+ V  +  PP
Sbjct: 13755 RSDTGTYIIEAVNVCGRATAVVEVNVLDKPGPP 13787



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 7/102 (6%)

Query: 1468  CLEGQTARFDLKVVGRPMPETFWFHDG------QQIVNDYTHKVVIKEDGTQSLIIVP-A 1520
             C  G   R    + GRP P++ W  DG      +  V+D      ++     S+II+P  
Sbjct: 15822 CKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPEC 15881

Query: 1521  TPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKL 1562
               S +G++++ A+N+AG+ + +  + V  V    K + V  +
Sbjct: 15882 KRSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDI 15923



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 36/159 (22%), Positives = 66/159 (41%), Gaps = 20/159 (12%)

Query: 1527  EWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPD 1586
             E+ V A N AG S  S  +     +    P  ++  + + ++EG+ + +  +  G P P 
Sbjct: 16088 EFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKGVPFPT 16147

Query: 1587  IVWLKNSDIIVPHKYP--------KIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR 1638
             + W K       +K P        K+ ++ T     L I  +   D+  YT TA+N  G 
Sbjct: 16148 LTWFKAPPKKPDNKEPVLYDTHVNKLVVDDT---CTLVIPQSRRSDTGLYTITAVNNLGT 16204

Query: 1639  DTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPEL 1677
              +   ++NV      P P      P G  + + ++A ++
Sbjct: 16205 ASKEMRLNV---LGRPGP------PVGPIKFESVSADQM 16234



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 32/134 (23%), Positives = 58/134 (43%), Gaps = 10/134 (7%)

Query: 5172  EAIEPKDNEMPPSFIEPLTKRKVYE---NTTLGFIVEVEGLPVPGVKWYRNKSLLEPDER 5228
             E++  KD   PP     +T R V       T+  +  V+G P P + W +   +L  ++R
Sbjct: 17895 ESVIAKDILHPPEVELDVTCRDVITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKR 17954

Query: 5229  IKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTH 5288
             + + +      L+I    + + G+Y+  A N  G A+  A V+++ +       P P  +
Sbjct: 17955 VDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHAQGSAIVNVLDR-------PGPCQN 18007

Query: 5289  QHVMEFDLEHTTSS 5302
               V     E+ T S
Sbjct: 18008 LKVTNVTKENCTIS 18021



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 1/77 (1%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTV 1530
             GQT R   +V GRP P+  W  +G+ +V +     +I++     L I  A  +D G++ +
Sbjct: 17923 GQTIRILARVKGRPEPDITWTKEGKVLVRE-KRVDLIQDLPRVELQIKEAVRADHGKYII 17981

Query: 1531  VAQNRAGRSSISVILTV 1547
              A+N +G +  S I+ V
Sbjct: 17982 SAKNSSGHAQGSAIVNV 17998



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 3/74 (4%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             V+V  G      A + G P P+V+W + G  I      G Q+   D  A L IP  T+ +
Sbjct: 18616 VIVRAGCPIRLFAIVRGRPAPKVTWRKVG--IDNVVRKG-QVDLVDTMAFLVIPNSTRDD 18672

Query: 75    SGRYSLKATNGSGQ 88
             SG+YSL   N +G+
Sbjct: 18673 SGKYSLTLVNPAGE 18686



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 31/129 (24%), Positives = 57/129 (44%), Gaps = 20/129 (15%)

Query: 1519  PATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVR 1578
             P+ PSD    T++A+N   R  +SV +                   + +K G+ + +   
Sbjct: 19277 PSEPSDPV--TILAENVPPRIDLSVAMK----------------SLLTVKAGTNVCLDAT 19318

Query: 1579  ATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGR 1638
               G P P + W K+  ++ P +  K+ ++  +    L++ S   +DS  YT TA N +G 
Sbjct: 19319 VFGKPMPTVSWKKDGTLLKPAEGIKMAMQ--RNLCTLELFSVNRKDSGDYTITAENSSGS 19376

Query: 1639  DTTRCKVNV 1647
              +   K+ V
Sbjct: 19377 KSATIKLKV 19385



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 52/259 (20%), Positives = 93/259 (35%), Gaps = 27/259 (10%)

Query: 3272  WYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVP 3331
             W +  + LS  +  K L +G+EYT             +   A+N+ G  T S    V   
Sbjct: 19929 WQRVMKSLSLQYSAKDLTEGKEYT-------------FRVSAENENGEGTPSEITVVARD 19975

Query: 3332  EVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFF 3390
             +VV+PD ++   P          +  E    R +  + G     VSW   +  +      
Sbjct: 19976 DVVAPDLDLKGLPDLCY------LAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRV 20029

Query: 3391  RMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIE-QEIE 3449
              +        L + +    D G YT    N  G    T ++ +     I    I+  E+ 
Sbjct: 20030 SVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKVVGKPGIPTGPIKFDEVT 20089

Query: 3450  MEMKEL-FSEGESEHSERDTRDAFSDSEDIDHK----SMAAKRYASRISSTSSWPEY-FK 3503
              E   L ++  + +     T       + +++K    + A ++   R++      EY F+
Sbjct: 20090 AEAMTLKWAPPKDDGGSEITNYILEKRDSVNNKWVTCASAVQKTTFRVTRLHEGMEYTFR 20149

Query: 3504  PSFTQKLTFKYVLEGEPVV 3522
              S   K      L+ EP+V
Sbjct: 20150 VSAENKYGVGEGLKSEPIV 20168



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 32/136 (23%), Positives = 59/136 (43%), Gaps = 8/136 (5%)

Query: 66    TIPAVTKANSGRYSLKATNGSGQAT----STAELLVKAETAPPNFVQR---LQSMTVRQG 118
             T+  + +     + ++A N +G  +    ST  ++ K E   P  V        +T++ G
Sbjct: 20334 TVTDLVEGGKYEFRIRAKNTAGAISAPSESTETIICKDEYEAPTIVLDPTIKDGLTIKAG 20393

Query: 119   SQVRLQ-VRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVN 177
               + L  + + G P P   + + G +I+ S   QI+       L I  A  +D+G Y++ 
Sbjct: 20394 DTIVLNAISILGKPLPKSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTIT 20453

Query: 178   ATNSVGRATSTAELLV 193
             ATN  G      ++ V
Sbjct: 20454 ATNPFGTKVEHVKVTV 20469



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 3/100 (3%)

Query: 2388  WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV 2447
             W K G++++PSD   I     S ML I+  T++DAG Y+ T      +    V V  +DV
Sbjct: 20413 WSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFGTKVEHVKVTVLDV 20472

Query: 2448  ITPLKDVNV--IEGTKAVLECKVSVPDVTS-VKWYLNDEQ 2484
               P   V +  +   KA L     + D  S +K Y+ +++
Sbjct: 20473 PGPPGPVEISNVSAEKATLTWTPPLEDGGSPIKSYILEKR 20512



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 32/121 (26%), Positives = 53/121 (43%), Gaps = 7/121 (5%)

Query: 1530  VVAQNRAGRSSISVILTVEAVEHQVKPMF---VEKLKNVNIKEGSRLEMKVRATGNPNPD 1586
             + A N AG    +VI  VE VE ++ P F    E  + + ++ G  + + V   G P P+
Sbjct: 20748 ISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPE 20807

Query: 1587  IVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVN 1646
             + W K++     +   +  IE T+    L I      D+  +  T  N AG+ +    V 
Sbjct: 20808 VTWTKDN----INLKNRANIENTESFTLLIIPECNRYDTGKFVMTIENPAGKKSGFVNVR 20863

Query: 1647  V 1647
             V
Sbjct: 20864 V 20864



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 4/105 (3%)

Query: 2057  GKITIPTFKPDKIELSPSMEAPKIFERIQ-SQTVGQGSDAHFRVR--VVGKPDPECEWYK 2113
             G I+ P+   D I     +EAPKI   ++   TV   +   FR+   V G+P P  EW K
Sbjct: 21438 GAISPPSEPSDAITCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSK 21497

Query: 2114  NGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAG 2158
             +G ++E + ++      D    LV +D T  DS +  + A N  G
Sbjct: 21498 DGKELEGTAKLE-IKIADFSTNLVNKDSTRRDSGAYTLTATNPGG 21541



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 2/81 (2%)

Query: 3053  VEARHIEFRKHIKDIKVLEKKRAM-FECEVS-EPDITVQWMKDDQELQITDRIKIQKEKY 3110
             VEA  I+     KD  +L+   A   E +VS  P  T++W KD +EL+ T +++I+   +
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 21515

Query: 3111  VHRLLIPSTRMSDAGKYTVVA 3131
                L+   +   D+G YT+ A
Sbjct: 21516 STNLVNKDSTRRDSGAYTLTA 21536



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 40/165 (24%), Positives = 65/165 (39%), Gaps = 17/165 (10%)

Query: 1530  VVAQNRAGRSSISVI-LTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIV 1588
             V AQN  G S    + + V A +  + P F        +  G  L++ V   G P P + 
Sbjct: 22121 VSAQNEKGISDPRQLSVPVIAKDLVIPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVT 22180

Query: 1589  WLKNSDIIVPHKY-PKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1647
             W K++   VP K   ++  E T+  + L I     +D   Y     N AG       V  
Sbjct: 22181 WHKDN---VPLKQTTRVNAESTENNSLLTIKDACREDVGHYVVKLTNSAGEAIETLNV-- 22235

Query: 1648  EVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEG 1692
              +   +P P      P G  +  E+ A   + + L +G  +++ G
Sbjct: 22236 -IVLDKPGP------PTGPVKMDEVTA---DSITLSWGPPKYDGG 22270



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 22/80 (27%), Positives = 37/80 (46%)

Query: 4163  EMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVN 4222
             E  +  + R G S+ L   ISG+P P + W+++   L+ N     E       + IKD +
Sbjct: 26877 EYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDAD 26936

Query: 4223  SQDSGKYKCVAENNSGAVES 4242
               +SG Y+    N  G+  +
Sbjct: 26937 RLNSGCYELKLRNAMGSASA 26956



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 20/70 (28%), Positives = 31/70 (44%)

Query: 5528  GTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
             GT+   +  + G P PT+ WYKD K +Q       E+ T   ++ I    + + G Y   
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELK 26946

Query: 5588  ATNKSGMAES 5597
               N  G A +
Sbjct: 26947 LRNAMGSASA 26956



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 23/89 (25%), Positives = 42/89 (47%), Gaps = 4/89 (4%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             V +  GS    +A + G P P++ W +  + +       V + ++  RA   I    +++
Sbjct: 29057 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEK--VSLQYTGKRATAVIKFCDRSD 29114

Query: 75    SGRYSLKATNGSGQATSTAELLVKAETAP 103
             SG+Y+L   N SG  T    ++VK   +P
Sbjct: 29115 SGKYTLTVKNASG--TKAVSVMVKVLDSP 29141



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 3958  GDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCV 4017
             G S   +    G P P++TW    + +      II + E+YS+L +  V+  + G  T  
Sbjct: 29461 GASLRLMVSVSGRPPPVITWSKQGIDLA--SRAIIDTTESYSLLIVDKVNRYDAGKYTIE 29518

Query: 4018  LFNQYGTVKTTSMLKV 4033
               NQ G    T ++KV
Sbjct: 29519 AENQSGKKSATVLVKV 29534



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 31/145 (21%), Positives = 58/145 (40%), Gaps = 9/145 (6%)

Query: 70    VTKANSGR---YSLKATNGSG----QATSTAELLVKAETAPPNFVQRLQSMTVR--QGSQ 120
             VT  N G    + ++A N  G    + T TA  +      P   +  +   T+    G  
Sbjct: 29696 VTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRP 29755

Query: 121   VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
             V L + + G P P   ++  G++++ S    +     +  L I E    D+G Y++   N
Sbjct: 29756 VELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKN 29815

Query: 181   SVGRATSTAELLVQGEEEVPAKKTK 205
               G  + T ++++  +   P    K
Sbjct: 29816 VTGTTSETIKVIILDKPGPPTGPIK 29840



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 1/83 (1%)

Query: 2089  VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSAS 2148
             V  G      + + G+P P   W+  G K+  S+R+        V +L IR+ T  D+  
Sbjct: 29750 VPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERV-TVETHTKVAKLTIRETTIRDTGE 29808

Query: 2149  IMVKAINIAGETSSHAFLLVQAK 2171
               ++  N+ G TS    +++  K
Sbjct: 29809 YTLELKNVTGTTSETIKVIILDK 29831



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 13/104 (12%)

Query: 2610  MTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVAN---PDSKGEWLRDGKHLPLTNNIR 2666
             +TSG+       I K + D T    + A   C++     PD K  W R GK L  +   +
Sbjct: 30527 LTSGEAP----GIRKEMKDVTTKLGEAAQLSCQIVGRPLPDIK--WYRFGKELIQSRKYK 30580

Query: 2667  SESDGHKRRLIIAATKLDDIGEY----TYKVATSKTSAKLKVEA 2706
               SDG    L +   + +D G Y    T +V   +TS+KL ++A
Sbjct: 30581 MSSDGRTHTLTVMTEEQEDEGVYTCIATNEVGEVETSSKLLLQA 30624



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 27/91 (29%), Positives = 35/91 (38%)

Query: 5514  PRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFI 5573
             PR    +     P G    F   V+  P   V WY +G  +Q        + +G   L I
Sbjct: 32374 PRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESSKIHYTNTSGVLTLEI 32433

Query: 5574  TSLVKSDEGEYRCVATNKSGMAESFAALTLT 5604
                   D G YR V TN  G A  +A L +T
Sbjct: 32434 LDCHTDDSGTYRAVCTNYKGEASDYATLDVT 32464



 Score = 39.7 bits (91), Expect = 0.085
 Identities = 23/81 (28%), Positives = 36/81 (44%)

Query: 19    EGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRY 78
             EG   T     +G P PEV+W   G+ I +       I  +D    L I  V K + G Y
Sbjct: 33342 EGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLY 33401

Query: 79    SLKATNGSGQATSTAELLVKA 99
             +L   N  G  ++T  + +++
Sbjct: 33402 TLSLGNEFGSDSATVNIHIRS 33422



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 63/292 (21%), Positives = 108/292 (36%), Gaps = 28/292 (9%)

Query: 5180  EMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCS 5239
             E P  F+E L  + V E     F  ++       VKWYRN   ++  ++ K E+ G++  
Sbjct: 12820 EAPTEFVEHLEDQTVTEFDDAVFSCQLSREKA-NVKWYRNGREIKEGKKYKFEKDGSIHR 12878

Query: 5240  LEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHT 5299
             L I + +  +  EY C   +    A+ F  V+ +P E   +  PP    Q ++E      
Sbjct: 12879 LIIKDCRLDDECEYACGVEDRKSRARLF--VEEIPVE---IIRPP----QDILE------ 12923

Query: 5300  TSSRTPSPQEIVL-EVELSEKDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPN 5358
                  P    + L E+   + +V+     + +V   +     +  I  L +      D  
Sbjct: 12924 ----APGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQG 12979

Query: 5359  MDSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFKCSVIGIPTPEVKWYKEYM 5418
                   +DKE +  LE+    P+      D  +               P  E +W+KE  
Sbjct: 12980 EYRFIAKDKEARAKLEL-AAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKEN- 13037

Query: 5419  CIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTM 5470
               EP + K  I       + +I      D   Y+    N  G+A   GF+ +
Sbjct: 13038 --EPLSTK-TIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKA--EGFINL 13084



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 34/149 (22%), Positives = 62/149 (41%), Gaps = 29/149 (19%)

Query: 1527  EWTVVAQNRAGRSSIS-VILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNP 1585
             ++ V A+N AG S  S      +AV+    P  + +  ++ +K G  + +    +G+P P
Sbjct: 14651 QFRVRAENAAGISEPSRATPPTKAVDPIDAPKVILRT-SLEVKRGDEIALDASISGSPYP 14709

Query: 1586  DIVWLKNSDIIVPHKYPK--------------------------IRIEGT-KGEAALKID 1618
              I W+K+ ++IVP +  K                          + I+ + KGE+ L++ 
Sbjct: 14710 TITWIKDENVIVPEEIKKRAAPLVRRRKGEVQEEEPFVLPLTQRLSIDNSKKGESQLRVR 14769

Query: 1619  STVSQDSAWYTATAINKAGRDTTRCKVNV 1647
              ++  D   Y     N  G     C V+V
Sbjct: 14770 DSLRPDHGLYMIKVENDHGIAKAPCTVSV 14798



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 13/122 (10%)

Query: 2347  CKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESV-EGV------WMKDGQEVQPSD 2399
             C+ K+ P  + +     D K+ EG +V+    V   ++  GV      W  DG E++  +
Sbjct: 17501 CQEKLVPPSVEL-----DVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDE 17555

Query: 2400  RVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVI-TPLKDVNVIE 2458
                +  D  S +L I++  + D G Y  T+     S +  V +  +DV   P   +N+++
Sbjct: 17556 HYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILD 17615

Query: 2459  GT 2460
              T
Sbjct: 17616 VT 17617



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 2/83 (2%)

Query: 1565  VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQD 1624
             + ++ G  + +  R  G P PDI W K   ++V  K  ++ +        L+I   V  D
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREK--RVDLIQDLPRVELQIKEAVRAD 17975

Query: 1625  SAWYTATAINKAGRDTTRCKVNV 1647
                Y  +A N +G       VNV
Sbjct: 17976 HGKYIISAKNSSGHAQGSAIVNV 17998



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 9/106 (8%)

Query: 2066  PDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIY 2125
             P +I+LS +M++          TV  G++      V GKP P   W K+G  ++ ++ I 
Sbjct: 19292 PPRIDLSVAMKS--------LLTVKAGTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIK 19343

Query: 2126  WYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAK 2171
                 + N+C L +  V  +DS    + A N +G  S+   L V  K
Sbjct: 19344 MAM-QRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKVLDK 19388



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 10/94 (10%)

Query: 1445  ETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHK 1504
             E  + +++  +K   +LK        G+  R +  V GRP P   W  DG+++  + T K
Sbjct: 21457 EAPKIKVDVKFKDTVILKA-------GEAFRLEADVSGRPPPTMEWSKDGKEL--EGTAK 21507

Query: 1505  VVIK-EDGTQSLIIVPATPSDSGEWTVVAQNRAG 1537
             + IK  D + +L+   +T  DSG +T+ A N  G
Sbjct: 21508 LEIKIADFSTNLVNKDSTRRDSGAYTLTATNPGG 21541



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 4156  EPPKML--QEMPKHARCREGDSIILECLISGEPQPVVTWFQ-NGVLLKQNQKFQFEEVNC 4212
             EPP++    ++ K    R   ++ L   I G P+P V W +  G+L     + Q E  + 
Sbjct: 25103 EPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGIL---TDRAQIEVTSS 25159

Query: 4213  SHQLYIKDVNSQDSGKYKCVAENNSGA 4239
                L I +V   DSG+Y    ENNSG+
Sbjct: 25160 FTMLVIDNVTRFDSGRYNLTLENNSGS 25186



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 3/95 (3%)

Query: 3237  EPPQVLQELQ---PVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQE 3293
             EPP+V+ +++    + V++G+  +  A I+GRP P ISW K+   +    + + +     
Sbjct: 25785 EPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNH 25844

Query: 3294  YTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3328
               L + +    D   Y    KN  G  + + +  V
Sbjct: 25845 TLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKV 25879



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 93/442 (21%), Positives = 170/442 (38%), Gaps = 71/442 (16%)

Query: 2714  KNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVD 2773
             K L V        TV      V  V W K    L +  +  +    +  SL I+N    D
Sbjct: 26194 KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRT--RAYVDTTDSRTSLTIENANRND 26251

Query: 2774  ESVYGFRLGRLGASARLHVETVKIIKKP--------KDVTALENATVAFEVSVSHDTVPV 2825
                Y   +  + ++A L +  VK++  P        +DVT  E+A ++++V  +    PV
Sbjct: 26252 SGKYTLTIQNVLSAASLTL-VVKVLDTPGPPTNITVQDVTK-ESAVLSWDVPENDGGAPV 26309

Query: 2826  KWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGE--YTAVVGQLECKAKLFVETLH 2883
             K +H  +E + + K   VS       +   ++    G   Y  V G+ E    +  ET  
Sbjct: 26310 KNYH--IEKREASKKAWVSVTNNCNRLSYKVTNLQEGAIYYFRVSGENEFGVGIPAETKE 26367

Query: 2884  ITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVE---------IEMSEK-----FKI 2929
               K  +    PE    +    +S  +V   WLK   +         +E  EK      K 
Sbjct: 26368 GVKITEKPSPPEKLGVT---SISKDSVSLTWLKPEHDGGSRIVHYVVEALEKGQKNWVKC 26424

Query: 2930  VVQGKLHQLIIMNTSTEDSAEYTF-VCGNDQVSAT---LTVTPIMITSMLKDINAEEKDT 2985
              V    H ++   +   +++EY F V   +Q   +     + P++I   L+    + K+ 
Sbjct: 26425 AVAKSTHHVV---SGLRENSEYFFRVFAENQAGLSDPRELLLPVLIKEQLEPPEIDMKNF 26481

Query: 2986  ITFEVTVNYEG-------ISYKWL------KNGVEIKSTDKCQMRTKKLTHSLNIRNVHF 3032
              +  V V           IS K L      ++GV +K+T +          ++N++    
Sbjct: 26482 PSHTVYVRAGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAENLTINLKESVT 26541

Query: 3033  GDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEK----KRAMFECEVSEPDITV 3088
              DA  Y   A  ++ T   ++            +I VL++       +   +++E  +T+
Sbjct: 26542 ADAGRYEITAANSSGTTKAFI------------NIVVLDRPGPPTGPVVISDITEESVTL 26589

Query: 3089  QW--MKDDQELQITDRIKIQKE 3108
             +W   K D   Q+T+ I +++E
Sbjct: 26590 KWEPPKYDGGSQVTNYILLKRE 26611



 Score = 39.3 bits (90), Expect = 0.11
 Identities = 164/836 (19%), Positives = 293/836 (35%), Gaps = 142/836 (16%)

Query: 2563  VLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAI 2622
             ++W   DKE+    K  ++  GK     +    + D GKYT        +  ++V    +
Sbjct: 29079 IIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKVL 29138

Query: 2623  SKPLTDQTVAESQEAVFECEVA--NPDSKG-----EWLRDGKHLPLTNNIRSESDGHKRR 2675
               P     +  S+    +C +A   P   G      ++ + +     N +  E  G    
Sbjct: 29139 DSPGPCGKLTVSRVTQEKCTLAWSLPQEDGGAEITHYIVERRETSRLNWVIVE--GECPT 29196

Query: 2676  LIIAATKLDDIGEYTYKV-ATSKTSAKLKVEAVKIKKTLKNLTVTE---------TQDAV 2725
             L    T+L    EY ++V A +K    + VE+  I     + T+           T    
Sbjct: 29197 LSYVVTRLIKNNEYIFRVRAVNKYGPGVPVESEPIVAR-NSFTIPSPPGIPEEVGTGKEH 29255

Query: 2726  FTVELTHPNVKGVQWIKNGVVLESNEKYA----ISVKGTIYSLRIKNCAIVDESVYGFRL 2781
               ++ T P   G   I N +V +  +K      ++    +Y  R+K  ++++   Y FR 
Sbjct: 29256 IIIQWTKPESDGGNEISNYLVDKREKKSLRWTRVNKDYVVYDTRLKVTSLMEGCDYQFR- 29314

Query: 2782  GRLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHR 2841
                                   VTA+ NA    E S + + +  +    S    P    R
Sbjct: 29315 ----------------------VTAV-NAAGNSEPSEASNFISCR--EPSYTPGPPSAPR 29349

Query: 2842  LVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE--TLHITKTMKNIE--VPETK 2897
             +V   K H + L    P   G    V   LE + K   +   +H   T++N E  VP+ K
Sbjct: 29350 VVDTTK-HSISLAWTKPMYDGGTDIVGYVLEMQEKDTDQWYRVHTNATIRNTEFTVPDLK 29408

Query: 2898  TAS-FECEVSHFNVPSM--WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV 2954
                 +   V+  NV  M  + ++  EIE  E+ +I                    E    
Sbjct: 29409 MGQKYSFRVAAVNVKGMSEYSESIAEIEPVERIEI-----------------PDLELA-- 29449

Query: 2955  CGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKC 3014
                D +  T+T+       ++  ++      IT             W K G+++ S  + 
Sbjct: 29450 ---DDLKKTVTIRAGASLRLMVSVSGRPPPVIT-------------WSKQGIDLAS--RA 29491

Query: 3015  QMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKR 3074
              + T +    L +  V+  DA  YT  A   +   +  V  +  +       +KV E   
Sbjct: 29492 IIDTTESYSLLIVDKVNRYDAGKYTIEAENQSGKKSATVLVKVYDTPGPCPSVKVKE--- 29548

Query: 3075  AMFECEVSEPDITVQWMKD--DQELQITDRIKIQKEKYVHRLLIPSTRMSDA-GKYTVVA 3131
                   VS   +T+ W     D    + + I  ++E  +      +T+ S    + + + 
Sbjct: 29549 ------VSRDSVTITWEIPTIDGGAPVNNYIVEKREAAMRAFKTVTTKCSKTLYRISGLV 29602

Query: 3132  GGNVSTAKLFVEGR-------DVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHW----Y 3180
              G +   ++  E         +     +  EV ++  +  VV+  V +  V   W    Y
Sbjct: 29603 EGTMYYFRVLPENIYGIGEPCETSDAVLVSEVPLVPAKLEVVD--VTKSTVTLAWEKPLY 29660

Query: 3181  KDGIEINFQVQERHKYVVERRIHRMFISET-------RQSDAGEYTF-VAGRNRSSV--- 3229
               G  +   V E  K   ER +  + +  T         ++  +Y F +  +N   V   
Sbjct: 29661 DGGSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEP 29720

Query: 3230  --TLYVNAPEPPQVLQEL-------QPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLS 3280
               T+     +  +VL  +       + + V +G+P      I+GRP P  SW+     L 
Sbjct: 29721 RETVTAVTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLR 29780

Query: 3281  TGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3336
                +       +   L + E    D   YT E KN  G  TTS ++ V + +   P
Sbjct: 29781 ESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTG--TTSETIKVIILDKPGP 29834



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 32/146 (21%), Positives = 59/146 (40%), Gaps = 6/146 (4%)

Query: 3891 ESEEIASERIKKDDLRELQLSA-STRIDEFKTEQKEENMRFFENSFRKRPQRCPPSFLQE 3949
            E +E      ++  ++E++     T ++E   E  EE M    +      +     F   
Sbjct: 1241 EDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISE----SEAVESGFDSR 1296

Query: 3950 IESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLEN-YSILTLSSVHH 4008
            I++  + EG    F C   GYP P + WY +   I   + + +  L++  + L +  V  
Sbjct: 1297 IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLP 1356

Query: 4009 QNEGSITCVLFNQYGTVKTTSMLKVK 4034
            ++EG  T    N  G    +  L V+
Sbjct: 1357 EDEGIYTAFASNIKGNAICSGKLYVE 1382



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 32/124 (25%), Positives = 48/124 (38%), Gaps = 18/124 (14%)

Query: 252   KTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVR--HVRAPTPSPVRSVSP 309
             K P  IPPKP+S  P P       ++A ++ P+ +   P P     V  P   PV     
Sbjct: 10649 KVPEAIPPKPES--PPPEVFEEPEEVALEEPPAEVVEEPEPAAPPQVTVPPKKPVPEKKA 10706

Query: 310   AARISTSP--------------IRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSS 355
              A ++  P              +   + PL++ K   +  A  PEVP     E  VA   
Sbjct: 10707 PAVVAKKPELPPVKVPEVPKEVVPEKKVPLVVPKKPEAPPAKVPEVPKEVVPEKKVAVPK 10766

Query: 356   EAEM 359
             + E+
Sbjct: 10767 KPEV 10770



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 27/92 (29%), Positives = 37/92 (40%), Gaps = 7/92 (7%)

Query: 1848  EPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRK-------SKRFRVRYDGIHYLDIV 1900
             + ++V  GE       VTG P PK+ W  N  +I K       +K    R +    L I 
Sbjct: 15406 DTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIP 15465

Query: 1901  DCKSYDTGEVKVTAENPEGVIEHKVKLEIQQR 1932
                  D G   VTA N  G +   V +E+  R
Sbjct: 15466 KAVREDKGTYTVTASNRLGSVFRNVHVEVYDR 15497



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 21/67 (31%), Positives = 30/67 (44%)

Query: 3262  ISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVAT 3321
             I G+P P +SW K E  L+T  +          TL++ +    DA  YT   KN  G   
Sbjct: 20006 IKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKE 20065

Query: 3322  TSASLSV 3328
              + S+ V
Sbjct: 20066 GTISIKV 20072



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 23/69 (33%), Positives = 30/69 (43%)

Query: 5528  GTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
             G A   +  V G P PT+ W KDGK ++G      +      NL      + D G Y   
Sbjct: 21476 GEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDSTRRDSGAYTLT 21535

Query: 5588  ATNKSGMAE 5596
             ATN  G A+
Sbjct: 21536 ATNPGGFAK 21544



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 53/252 (21%), Positives = 88/252 (34%), Gaps = 20/252 (7%)

Query: 1154  YTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQEP-KVGETA--PGFV 1210
             Y  VV N H  +     L E   Y   + ++ E  Y   + A   +P KV E    PG +
Sbjct: 23080 YAAVVTNCHKNSWKIDQLQEGCSYYFRVTAENE--YGIGLPAQTADPIKVAEVPQPPGKI 23137

Query: 1211  YSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEE------------RLIKEI 1258
               +         +  + +    + +++  VE Q  H   + E             L +  
Sbjct: 23138 TVDDVTRNSVSLSWTKPEHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGE 23197

Query: 1259  EYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYP 1318
             EY      + E    D        +++   +E        +Y +  G  +     +SG P
Sbjct: 23198 EYLFRVVAVNEKGRSDPRSLAVPIVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRP 23257

Query: 1319  LPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGK 1378
              P I W KDG  +K   R  +    D   +L I     +D G Y    +N+ G    S +
Sbjct: 23258 KPTITWTKDGLPLKQTTRINVTDSLD-LTTLSIKETHKDDGGQYGITVANVVGQKTASIE 23316

Query: 1379  LYV--EPAAPLG 1388
             +    +P  P G
Sbjct: 23317 IVTLDKPDPPKG 23328



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 24/97 (24%), Positives = 38/97 (39%)

Query: 5177  KDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGN 5236
             KD  + PS   P     +     L   + V G P P + W ++   L+   R+ +E    
Sbjct: 24306 KDLTIQPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETAT 24365

Query: 5237  VCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
                L I    K + G+Y   A N  G A    +V ++
Sbjct: 24366 STVLHIKEGNKDDFGKYTVTATNSAGTATENLSVIVL 24402



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 33/137 (24%), Positives = 56/137 (40%), Gaps = 5/137 (3%)

Query: 2025  ESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERI 2084
             E+Y E+   T+D+   + +        +++E  + T P    D +E    M   K  + I
Sbjct: 25741 ETYFEVTELTEDQRYEF-RVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVI 25799

Query: 2085  QSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAE 2144
                 V  G        + G+P P   W K+G++IE   R       DN   L ++D    
Sbjct: 25800 ---VVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTE-IISTDNHTLLTVKDCIRR 25855

Query: 2145  DSASIMVKAINIAGETS 2161
             D+   ++   N+AG  S
Sbjct: 25856 DTGQYVLTLKNVAGTRS 25872



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 23/92 (25%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 1456  KPVFVLKPVSFKCL----EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDG 1511
             +P  V+  V F+ +     G+  + +  + GRP+P   W  DG +I  +     +I  D 
Sbjct: 25785 EPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEI-EERARTEIISTDN 25843

Query: 1512  TQSLIIVPATPSDSGEWTVVAQNRAGRSSISV 1543
                L +      D+G++ +  +N AG  S++V
Sbjct: 25844 HTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAV 25875



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 73/355 (20%), Positives = 134/355 (37%), Gaps = 56/355 (15%)

Query: 2563  VLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAI 2622
             V W   +K +   ++Y IE       LT+  + ++D GKY            LT+  G +
Sbjct: 27303 VTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYI-----------LTIENG-V 27350

Query: 2623  SKPLTDQTVAESQEAVFECEVANPD--SKGE----W---LRDGKHLPLTNNIRSESDGHK 2673
              +P +     +  +    C+       S+G     W   L DG   P+ N +  + D  K
Sbjct: 27351 GEPKSSTVSVKVLDTPAACQKLQVKHVSRGTVTLLWDPPLIDGGS-PIINYVIEKRDATK 27409

Query: 2674  RRLII-------AATKLDDIGEYT---YKVATSK-------TSAKLKVEAVKIKKTLKNL 2716
             R   +        + KL D+ E T   ++V                 V+A ++   +++L
Sbjct: 27410 RTWSVVSHKCSSTSFKLIDLSEKTPFFFRVLAENEIGIGEPCETTEPVKAAEVPAPIRDL 27469

Query: 2717  TVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNE-KYAISVKGTIYSLRIKNCAIVDES 2775
             ++ ++      +  T P+  G   I   VV    + +   S  G   +  I+   + ++S
Sbjct: 27470 SMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGEQTWSHAGISKTCEIEVSQLKEQS 27529

Query: 2776  VYGFRL---GRLGASARLHVE--TVK--IIKKPKDVTALENATVAFEVSVS-HDTVPVK- 2826
             V  FR+      G S  + +   TVK  II    D++ +  A V   +  + H  +P K 
Sbjct: 27530 VLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKG 27589

Query: 2827  -------WFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECK 2874
                    W    + +K S+  R         L ++N      G+YT ++    C+
Sbjct: 27590 KPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTVILDNAVCR 27644



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 4/106 (3%)

Query: 1829  TGVTTDQKEKQKPDIVLYPE---PVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK 1885
             +G+   + E   P +   PE    + +  GE+ R +  V G P P+V W+ +G  I K  
Sbjct: 27944 SGIIMTRDENVPPIVEFGPEYFDGLIIKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRM 28003

Query: 1886  RFRVR-YDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQ 1930
                +    G   L + D      G   V A+N  G  + ++K+++Q
Sbjct: 28004 NMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKAEIKVKVQ 28049



 Score = 38.9 bits (89), Expect = 0.15
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 3/93 (3%)

Query: 1841  PDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK--RFRV-RYDGIHYL 1897
             P I   P  + + EG+     C  TG P P+V W   G+ I   +  RF +   D +  L
Sbjct: 33329 PKIEALPSDISIDEGKVLTVACAFTGEPTPEVTWSCGGRKIHSQEQGRFHIENTDDLTTL 33388

Query: 1898  DIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQ 1930
              I+D +  D G   ++  N  G     V + I+
Sbjct: 33389 IIMDVQKQDGGLYTLSLGNEFGSDSATVNIHIR 33421



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 4/96 (4%)

Query: 3503  KPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHS 3562
             KP+   +     V+EGE +       A P P ++W  + + +    R  +K +    H S
Sbjct: 14386 KPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASDRLTMKND----HIS 14441

Query: 3563  SSLEIKRVQDRDSGSYRLLAINSEGSAESTASLLVI 3598
             + LE+ +    D+G Y +   N  GSA ++ ++ VI
Sbjct: 14442 AHLEVPKSVRADAGIYTITLENKLGSATASINVKVI 14477



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 4156  EPPKMLQE--MPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCS 4213
             EPP+++ +  M +    + GD++ L  +I G P P VTW +         K + +     
Sbjct: 17214 EPPELILDANMAREQHIKVGDTLRLSAIIKGVPFPKVTWKKED--RDAPTKARIDVTPVG 17271

Query: 4214  HQLYIKDVNSQDSGKYKCVAENNSGA 4239
              +L I++   +D G Y    EN +G+
Sbjct: 17272 SKLEIRNAAHEDGGIYSLTVENPAGS 17297



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 24/102 (23%), Positives = 39/102 (38%), Gaps = 3/102 (2%)

Query: 3932  ENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFI 3991
             E  +  + Q  PP  L   E   +  G       H  G P P   W   +  +  + +  
Sbjct: 18888 EGVYEAKEQLLPPKILMP-EQITIKAGKKLRIEAHVYGKPHPTCKWKKGEDEVVTSSHLA 18946

Query: 3992  IHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKV 4033
             +H  ++ SIL +  V  ++ G  +    N  GT   T  +KV
Sbjct: 18947 VHKADSSSILIIKDVTRKDSGYYSLTAENSSGT--DTQKIKV 18986



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 22/66 (33%), Positives = 28/66 (42%)

Query: 5528  GTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
             GT       V G P PTV W KDG L++               L + S+ + D G+Y   
Sbjct: 19310 GTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTIT 19369

Query: 5588  ATNKSG 5593
             A N SG
Sbjct: 19370 AENSSG 19375



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 21/71 (29%), Positives = 33/71 (46%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             R G ++ L   + G P P +TW +  V L+       +  +    L  ++VN  D+GKY 
Sbjct: 19706 RAGVTMRLYVPVKGRPPPKITWSKPNVNLRDRIGLDIKSTDFDTFLRCENVNKYDAGKYI 19765

Query: 4231  CVAENNSGAVE 4241
                EN+ G  E
Sbjct: 19766 LTLENSCGKKE 19776



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 18/69 (26%), Positives = 30/69 (43%)

Query: 5204  VEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGE 5263
             + V G P P V W +   +L+  +R+  E       L I+   + + G Y   A NI+GE
Sbjct: 21087 IPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSGPYPLTARNIVGE 21146

Query: 5264  AKSFANVDI 5272
                   + +
Sbjct: 21147 VGDVITIQV 21155



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 31/108 (28%), Positives = 46/108 (42%), Gaps = 4/108 (3%)

Query: 1829  TGVTTDQKEKQKPDIVLYP---EPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK 1885
             TG  T + E + P I + P   + + V  GET R    V G P P + W    + I +S 
Sbjct: 23611 TGPITAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESA 23670

Query: 1886  RFRVRYDGIHYLDIV-DCKSYDTGEVKVTAENPEGVIEHKVKLEIQQR 1932
             R  ++      L IV D    D G+  + A N  G     V +++  R
Sbjct: 23671 RCEIKNTDFKALLIVKDAIRIDGGQYILRASNVAGSKSFPVNVKVLDR 23718



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 32/139 (23%), Positives = 54/139 (38%), Gaps = 3/139 (2%)

Query: 1521  TPSDSGEWTVVAQNRAGRSSISVI-LTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRA 1579
             T  +   + V A N  GRS    + + V A + ++KP         N+K   +L++ V  
Sbjct: 25359 TAGEEYVFRVAAVNEKGRSDPRQLGVPVIARDIEIKPSVELPFHTFNVKAREQLKIDVPF 25418

Query: 1580  TGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRD 1639
              G P   + W K+   +   +  ++ +  +K   +L I     +D   Y     N AG  
Sbjct: 25419 KGRPQATVNWRKDGQTL--KETTRVNVSSSKTVTSLSIKEASKEDVGTYELCVSNSAGSI 25476

Query: 1640  TTRCKVNVEVEFAEPEPER 1658
             T    + V      P P R
Sbjct: 25477 TVPITIIVLDRPGPPGPIR 25495



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 39/149 (26%), Positives = 67/149 (44%), Gaps = 13/149 (8%)

Query: 892   SEAGVEVKKEVGVS-ITGTTVREERFEVLHGREAKVTETARV-PAPV-EIPVTPPTLVSG 948
             S AG+    E+ VS +   +V E  F V    E  +++   + P  V E+ +TP   +S 
Sbjct: 27510 SHAGISKTCEIEVSQLKEQSVLE--FRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSD 27567

Query: 949   LKN--VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAF 1006
             +    VTV  G +V LE    G P P+++W ++   ++ S   + +       L I+ A 
Sbjct: 27568 IPGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAK 27627

Query: 1007  AEDSGRFTCSAVNEAGTVSTSCYLAVQVS 1035
              E  G++T    N        C +AV ++
Sbjct: 27628 KEHGGKYTVILDNAV------CRIAVPIT 27650



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 33/123 (26%), Positives = 52/123 (42%), Gaps = 4/123 (3%)

Query: 1252  ERLIKEIEYRI-IKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRIL--EGMGV 1308
             ERL+++ EY   +K   +    E  E   +V I E +   +   + I N  I    G   
Sbjct: 28606 ERLVEKTEYEFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPF 28665

Query: 1309  TFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASN 1368
             T    +SG P PK+ W  +  R+K  +R  +   +D R +L +   +  D G Y     N
Sbjct: 28666 TIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKD-RTTLTVKDSMRGDSGRYFLTLEN 28724

Query: 1369  IKG 1371
               G
Sbjct: 28725 TAG 28727



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 8/126 (6%)

Query: 66    TIPAVTKANSGRYSLKATNGSGQAT----STAELLVKAETAPPN--FVQRLQS--MTVRQ 117
             T+ A+++ ++  + + A N +G  +    ST  +  + E APP      RL    +T+R 
Sbjct: 29002 TVTALSEGDTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDARLHGDLVTIRA 29061

Query: 118   GSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVN 177
             GS + L   V G P P + + +   E+       +   G   + +I      DSG Y++ 
Sbjct: 29062 GSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLT 29121

Query: 178   ATNSVG 183
               N+ G
Sbjct: 29122 VKNASG 29127



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVP-ATPSDSGEWT 1529
             G     D  V G+P P+  W    +++  D   KV ++  G ++  ++     SDSG++T
Sbjct: 29062 GSDLVLDAAVGGKPEPKIIWTKGDKEL--DLCEKVSLQYTGKRATAVIKFCDRSDSGKYT 29119

Query: 1530  VVAQNRAGRSSISVILTV 1547
             +  +N +G  ++SV++ V
Sbjct: 29120 LTVKNASGTKAVSVMVKV 29137



 Score = 38.5 bits (88), Expect = 0.19
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 2/97 (2%)

Query: 3944  PSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMP-IPRNQNFIIHSLE-NYSIL 4001
             P F +E+ +  V    +   VC   G+P+PIV WY      I     + I   +  Y  L
Sbjct: 30928 PHFKEELRNLNVRYQSNATLVCKVTGHPKPIVKWYRQGKEIIADGLKYRIQEFKGGYHQL 30987

Query: 4002  TLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQK 4038
              ++SV   +         NQ G+V  T+ L+V+   K
Sbjct: 30988 IIASVTDDDATVYQVRATNQGGSVSGTASLEVEVPAK 31024



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 39/161 (24%), Positives = 68/161 (42%), Gaps = 20/161 (12%)

Query: 3920  KTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYN 3979
             + E K+ + R F    R +       F+  +E Q V EG++  FVC    + +  V W+ 
Sbjct: 11557 EVEGKKTSARLFVTGIRLK-------FMSPLEDQTVKEGETATFVCEL-SHEKMHVVWFK 11608

Query: 3980  NDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKV-KAKQK 4038
             ND  +  ++  +I S      L +  V   +   I      Q   + +T+ LKV +A   
Sbjct: 11609 NDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKA----QVKELSSTAQLKVLEADPY 11664

Query: 4039  HDVKAH-KVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQ 4078
               VK H K  V      E++E+ L  + +K       ++G+
Sbjct: 11665 FTVKLHDKTAV------EKDEITLKCEVSKDVPVKWFKDGE 11699



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 28/93 (30%), Positives = 38/93 (40%), Gaps = 8/93 (8%)

Query: 1304  EGMGVTFHCKMSGYPLPKIAWYK------DGKRIKHGERYQMDFLQDGRASLRIPVVLPE 1357
             EG  V    K+ G P P + W+K      D K     + +    + D   +L IP     
Sbjct: 16130 EGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRS 16189

Query: 1358  DEGIYTAFASNIKGNAICSGKLYV--EPAAPLG 1388
             D G+YT  A N  G A    +L V   P  P+G
Sbjct: 16190 DTGLYTITAVNNLGTASKEMRLNVLGRPGPPVG 16222



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 26/84 (30%), Positives = 38/84 (45%), Gaps = 6/84 (7%)

Query: 1470  EGQTARFDLKVVGRPMPETFWFH------DGQQIVNDYTHKVVIKEDGTQSLIIVPATPS 1523
             EG       K+ G P P   WF       D ++ V   TH   +  D T +L+I  +  S
Sbjct: 16130 EGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVDDTCTLVIPQSRRS 16189

Query: 1524  DSGEWTVVAQNRAGRSSISVILTV 1547
             D+G +T+ A N  G +S  + L V
Sbjct: 16190 DTGLYTITAVNNLGTASKEMRLNV 16213



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 32/103 (31%), Positives = 46/103 (44%), Gaps = 6/103 (5%)

Query: 1273  EDGEEKMAVDISESEAVESGFDSR-IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRI 1331
             E  E  +A DI     VE     R +   R+  G  +    ++ G P P I W K+GK +
Sbjct: 17892 ELAESVIAKDILHPPEVELDVTCRDVITVRV--GQTIRILARVKGRPEPDITWTKEGKVL 17949

Query: 1332  KHGERYQMDFLQD-GRASLRIPVVLPEDEGIYTAFASNIKGNA 1373
                +R  +D +QD  R  L+I   +  D G Y   A N  G+A
Sbjct: 17950 VREKR--VDLIQDLPRVELQIKEAVRADHGKYIISAKNSSGHA 17990



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 22/77 (28%), Positives = 37/77 (48%), Gaps = 1/77 (1%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTV 1530
             G     D  V G+PMP   W  DG  +      K+ ++ +   +L +      DSG++T+
Sbjct: 19310 GTNVCLDATVFGKPMPTVSWKKDGTLLKPAEGIKMAMQRN-LCTLELFSVNRKDSGDYTI 19368

Query: 1531  VAQNRAGRSSISVILTV 1547
              A+N +G  S ++ L V
Sbjct: 19369 TAENSSGSKSATIKLKV 19385



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 6/120 (5%)

Query: 910   TVREERFEVLHGREAKVTETARVPAP--VEIPVTPP-TLVSGLKNVTVIE-GESVTLECH 965
             T  +  F +    +A V E A +P    VE  + P   L + L+   V+  G S+ +   
Sbjct: 20740 TKEKYNFRISAINDAGVGEPAVIPDVEIVEREMAPDFELDAELRRTLVVRAGLSIRIFVP 20799

Query: 966   ISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVS 1025
             I G P+P VTW +++  +++  + + T       L+I E    D+G+F  +  N AG  S
Sbjct: 20800 IKGRPAPEVTWTKDNINLKNRANIENT--ESFTLLIIPECNRYDTGKFVMTIENPAGKKS 20857



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 27/104 (25%), Positives = 43/104 (41%), Gaps = 4/104 (3%)

Query: 1544  ILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPK 1603
             ++  E +E     +  +  K V ++  + L + V   G P P++ W K   I+      +
Sbjct: 25096 VVAQERIEPPEIELDADLRKVVVLRASATLRLFVTIKGRPEPEVKWEKAEGILT----DR 25151

Query: 1604  IRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1647
              +IE T     L ID+    DS  Y  T  N +G  T    V V
Sbjct: 25152 AQIEVTSSFTMLVIDNVTRFDSGRYNLTLENNSGSKTAFVNVRV 25195



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 3/99 (3%)

Query: 5171  NEAIEPKDN-EMPPSFIEPLTKRKVYENT--TLGFIVEVEGLPVPGVKWYRNKSLLEPDE 5227
             NE ++ KD  E P   ++   +  V       +  ++  +G P P V W +++  L  D 
Sbjct: 27257 NEPVQAKDILEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDA 27316

Query: 5228  RIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKS 5266
             R  +E   +   L I  + + + G+Y+    N +GE KS
Sbjct: 27317 RYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKS 27355



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 29/102 (28%), Positives = 40/102 (39%), Gaps = 5/102 (4%)

Query: 1565  VNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQD 1624
             V I+ GS L +     G P P I+W K    +   +   ++  G +  A +K       D
Sbjct: 29057 VTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCD--RSD 29114

Query: 1625  SAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGT 1666
             S  YT T  N +G       V V      P P  KL + R T
Sbjct: 29115 SGKYTLTVKNASGTKAVSVMVKV---LDSPGPCGKLTVSRVT 29153



 Score = 38.1 bits (87), Expect = 0.25
 Identities = 39/154 (25%), Positives = 59/154 (38%), Gaps = 6/154 (3%)

Query: 1782  KYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVT--TDQKEKQ 1839
             K GT+     + +K        + L EG + L RI              VT  T Q  + 
Sbjct: 29675 KAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRETVTAVTVQDLRV 29734

Query: 1840  KPDIVLYPEP---VRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVR-YDGIH 1895
              P I L   P   + V  G        + G P P  +W+  G  +R+S+R  V  +  + 
Sbjct: 29735 LPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVA 29794

Query: 1896  YLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEI 1929
              L I +    DTGE  +  +N  G     +K+ I
Sbjct: 29795 KLTIRETTIRDTGEYTLELKNVTGTTSETIKVII 29828



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 8/135 (5%)

Query: 77    RYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQ----GSQVRLQVRVTGIPT 132
             R  L+  +G  +    A    + +  P  FV+ ++ + + +    GS    +  V+   T
Sbjct: 11088 RRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSP-ST 11146

Query: 133   PVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELL 192
              +  + +DG+ I+ S   +   +G    L I +    D+G Y+          TSTA+L+
Sbjct: 11147 AITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLV 11206

Query: 193   VQGEEEVPAKKTKTI 207
             V   EE+P +  KT+
Sbjct: 11207 V---EELPVRFVKTL 11218



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 40/182 (21%), Positives = 70/182 (38%), Gaps = 16/182 (8%)

Query: 3227  SSVTLYVNAPEP---PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3283
             S ++  V A +P   P +  E   + V  G+           P P +SW+K+ + +    
Sbjct: 14372 SEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEVKASD 14431

Query: 3284  KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV----------EVPEV 3333
             +    +D     L + ++   DA +YT   +N  G AT S ++ V          +  ++
Sbjct: 14432 RLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKVIGLPGPCKDIKASDI 14491

Query: 3334  VSPDQEMPVYPPAII--TPLQDTVTSEGQPA-RFQCRVSGTDLKVSWYSKDKKIKPSRFF 3390
                  ++   PP     TP+   V    +   R    V   + K+SW  KD       FF
Sbjct: 14492 TKSSCKLTWEPPEFDGGTPILHYVLERREAGRRTYIPVMSGENKLSWTVKDLIPNGEYFF 14551

Query: 3391  RM 3392
             R+
Sbjct: 14552 RV 14553



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 18/132 (13%)

Query: 3214  DAGEYTF------VAGRNRSSVTLY---VNAPEPPQVLQELQPVTVQSGKPARFCAVISG 3264
             + GEY F       AG ++ S T+       P+ P  +   + + V+ G      A I G
Sbjct: 16083 EGGEYEFRVKAVNAAGVSKPSATVGPCDCQRPDMPPSIDLKEFMEVEEGTNVNIVAKIKG 16142

Query: 3265  RPQPKISWYK--------EEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKND 3316
              P P ++W+K        +E +L      K + D    TL++ ++   D  +YT  A N+
Sbjct: 16143 VPFPTLTWFKAPPKKPDNKEPVLYDTHVNKLVVD-DTCTLVIPQSRRSDTGLYTITAVNN 16201

Query: 3317  YGVATTSASLSV 3328
              G A+    L+V
Sbjct: 16202 LGTASKEMRLNV 16213



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 76/396 (19%), Positives = 148/396 (37%), Gaps = 61/396 (15%)

Query: 3248  VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3307
             + V +G   R  A +SG+P P ++W   E+ L    +          ++++         
Sbjct: 16534 IVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQ--EATIETTAISSSMVIKNCQRSHQG 16591

Query: 3308  VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITP-LQDTVTSEGQPARFQC 3366
             VY+  AKN+ G      ++ V+V +V  P          + TP L   +T+E     +  
Sbjct: 16592 VYSLLAKNEAG--ERKKTIIVDVLDVPGP----------VGTPFLAHNLTNESCKLTWFS 16639

Query: 3367  RVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVAS-NAVGQ- 3424
                     ++ Y  +K+    R +    +  T Q    +   + +  +  +A+ N++G  
Sbjct: 16640 PEDDGGSPITNYVIEKRESDRRAWTPVTYTVTRQNATVQGLIQGKAYFFRIAAENSIGMG 16699

Query: 3425  --VSSTANLSLEAPESILHERIEQEIEMEMKELFS--------EGESEHSERDTRDAFSD 3474
               V ++  L +  P ++     + E++   K   +        +G SE            
Sbjct: 16700 PFVETSEALVIREPITVPERPEDLEVKEVTKNTVTLTWNPPKYDGGSEIINYVLESRLIG 16759

Query: 3475  SED---IDHKSMAAKRYASRISSTSSWPEYF----------KPSF-TQKLTFKYVLE--- 3517
             +E    + + ++ +++Y  +        EY           KPSF T+ +T K  L    
Sbjct: 16760 TEKFHKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPT 16819

Query: 3518  -------------GEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSS 3564
                          GE    T R    P P+++WF +   +    R  IK        + +
Sbjct: 16820 LHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHIKTTP----ATLA 16875

Query: 3565  LEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQK 3600
             LE  + +  DSG Y ++  NS GS +    + V+ +
Sbjct: 16876 LEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVVDR 16911



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 24/110 (21%), Positives = 47/110 (42%), Gaps = 4/110 (3%)

Query: 5168  GTPNEAIEP---KDNEMPPSF-IEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLL 5223
             G P+   +P   KD   PP+  ++   K  +             G P P V W+++++ +
Sbjct: 16800 GKPSFCTKPITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADV 16859

Query: 5224  EPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
               D+R  ++      +LE    ++ + G+Y     N  G  K F  V+++
Sbjct: 16860 LEDDRTHIKTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNVV 16909



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 1/101 (0%)

Query: 933   PAPVEIPVTPPTLVSGLKN-VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQI 991
             P   +  + PPTL    ++ +T+  GE+  L    SG P P V+W++++  +       I
Sbjct: 16808 PITCKDELAPPTLHLDFRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVLEDDRTHI 16867

Query: 992   TFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAV 1032
                     L   +A   DSG++     N  G+    C + V
Sbjct: 16868 KTTPATLALEKIKAKRSDSGKYCVVVENSTGSRKGFCQVNV 16908



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 1423  SPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVG 1482
             S  R +P    P  +     L E D   L  +Y+ + + K        G   + ++ V+G
Sbjct: 21042 SAGRSAPRESRPVIVKEQTMLPELD---LRGIYQKLVIAKA-------GDNIKVEIPVLG 21091

Query: 1483  RPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI-IVPATPSDSGEWTVVAQNRAGRSSI 1541
             RP P   W   G QI+   T +V  +   T +++ I     SDSG + + A+N  G   +
Sbjct: 21092 RPKPTVTW-KKGDQILKQ-TQRVNFETTATSTILNINECVRSDSGPYPLTARNIVG--EV 21147

Query: 1542  SVILTVE 1548
               ++T++
Sbjct: 21148 GDVITIQ 21154



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 37/188 (19%), Positives = 67/188 (35%), Gaps = 20/188 (10%)

Query: 1203  GETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRI 1262
             G    G++     K  +K       K+ + T+      E+  F +S+  E+ I +     
Sbjct: 22077 GSRILGYIVEMQTKGSDKWATCATVKVTEATITGLIQGEEYSFRVSAQNEKGISDPRQLS 22136

Query: 1263  IKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKI 1322
             +    ++L+                 +   F      + +L G  +       G P P +
Sbjct: 22137 VPVIAKDLV-----------------IPPAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAV 22179

Query: 1323  AWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYV- 1381
              W+KD   +K   R   +  ++  + L I     ED G Y    +N  G AI +  + V 
Sbjct: 22180 TWHKDNVPLKQTTRVNAESTEN-NSLLTIKDACREDVGHYVVKLTNSAGEAIETLNVIVL 22238

Query: 1382  -EPAAPLG 1388
              +P  P G
Sbjct: 22239 DKPGPPTG 22246



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 4/81 (4%)

Query: 4158  PKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLY 4217
             PK    +  HA    G+S  ++  I G+P P + W +    L    + + +  + +  L 
Sbjct: 22547 PKYKDTIVVHA----GESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFATSLS 22602

Query: 4218  IKDVNSQDSGKYKCVAENNSG 4238
             +KD    DSG Y   A+N +G
Sbjct: 22603 VKDAVRVDSGNYILKAKNVAG 22623



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 1/92 (1%)

Query: 4148  VFLSDITNEPPKMLQEMP-KHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQ 4206
             V + D+   P   L  MP K      G  + L   I+G P P  +WF  G  L+++++  
Sbjct: 29727 VTVQDLRVLPTIDLSTMPQKTIHVPAGRPVELVIPIAGRPPPAASWFFAGSKLRESERVT 29786

Query: 4207  FEEVNCSHQLYIKDVNSQDSGKYKCVAENNSG 4238
              E      +L I++   +D+G+Y    +N +G
Sbjct: 29787 VETHTKVAKLTIRETTIRDTGEYTLELKNVTG 29818



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             R+G  I L   I G+P P+  W + G  + +       E +   +L IK+ +  DSG Y 
Sbjct: 30149 RQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAMIATSETHT--ELVIKEADRGDSGTYD 30206

Query: 4231  CVAENNSG 4238
              V EN  G
Sbjct: 30207 LVLENKCG 30214



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 3/73 (4%)

Query: 3969  GYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQ-NEGSITCVLFNQYGTVKT 4027
             G P P +TW++    +  ++N  I + E+Y+ L + +V  + + G     L N +GTV  
Sbjct: 30654 GRPVPAMTWFHGQKLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTV-- 30711

Query: 4028  TSMLKVKAKQKHD 4040
              ++L V+ + K D
Sbjct: 30712 DAILDVEIQDKPD 30724



 Score = 37.7 bits (86), Expect = 0.32
 Identities = 45/208 (21%), Positives = 79/208 (37%), Gaps = 28/208 (13%)

Query: 5090  ETLERYSTPPGETLERYSTPP--GEALERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEH 5147
             +T+     PP  TL  Y+     GE +      T  P P  T+     KI+  D   N+ 
Sbjct: 31681 DTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITVHPEPHVTWYKSGQKIKPGD---NDK 31737

Query: 5148  FYTPTEERG--------------SAYEIWRSDSFGTPNEAIE--------PKDNEMPPSF 5185
              YT   ++G              + Y +   + +G  +   +        P D+ + P F
Sbjct: 31738 KYTFESDKGLYQLTINSVTTDDDAEYTVVARNKYGEDSCKAKLTVTLHPPPTDSTLRPMF 31797

Query: 5186  IEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVG-NVCSLEISN 5244
                L   +  E  ++ F + V G+P P +KW ++   L     I++   G +  +L I +
Sbjct: 31798 KRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALHIRD 31857

Query: 5245  IQKGEGGEYMCHAVNIIGEAKSFANVDI 5272
                 + G Y   A N  G     A++ +
Sbjct: 31858 TLPEDTGYYRVTATNTAGSTSCQAHLQV 31885



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 28/95 (29%), Positives = 38/95 (40%), Gaps = 9/95 (9%)

Query: 5     APTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTL--PGVQISFSDGR 62
             AP      Q +VV  G   T       +P  E  WF++ + +ST T+     Q SF    
Sbjct: 12999 APKIKTADQDLVVDVGKPLTMVVPYDAYPKAEAEWFKENEPLSTKTIDTTAEQTSFRILE 13058

Query: 63    AKLTIPAVTKANSGRYSLKATNGSGQATSTAELLV 97
             AK       K + GRY +   N  G+A     L V
Sbjct: 13059 AK-------KGDKGRYKIVLQNKHGKAEGFINLKV 13086



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 23/59 (38%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 5538  RGSPRPTVYWYKDGKLVQGR-RFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMA 5595
             R  P PTV W+KDGK V+   R T++      H L +   V++D G Y     NK G A
Sbjct: 14411 RAVPVPTVSWHKDGKEVKASDRLTMKNDHISAH-LEVPKSVRADAGIYTITLENKLGSA 14468



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 26/104 (25%), Positives = 41/104 (39%), Gaps = 9/104 (8%)

Query: 3937  KRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHS-- 3994
             +RP   P   L+E    EV EG + N V   +G P P +TW+      P N+  +++   
Sbjct: 16112 QRPDMPPSIDLKEF--MEVEEGTNVNIVAKIKGVPFPTLTWFKAPPKKPDNKEPVLYDTH 16169

Query: 3995  -----LENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKV 4033
                  +++   L +      + G  T    N  GT      L V
Sbjct: 16170 VNKLVVDDTCTLVIPQSRRSDTGLYTITAVNNLGTASKEMRLNV 16213



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 47/200 (23%), Positives = 73/200 (36%), Gaps = 41/200 (20%)

Query: 862   PTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGVEVK---KEVGVSITGTTVR---EER 915
             P   PS+     +P   P  PF    D  KS A +E     K+ G  +TG  V    E +
Sbjct: 16405 PASLPSDPATARDPIAPPGPPFPKVTDWTKSSADLEWSPPLKDGGSKVTGYIVEYKEEGK 16464

Query: 916   FEVLHGREAKVTET----------------------ARVPAPVEIP--------VTPPTL 945
              E   G++ +V  T                      A +  P E+         +  P L
Sbjct: 16465 EEWEKGKDKEVRGTKLVVTGLKEGAFYKFRVRAVNIAGIGEPGEVTDVIEMKDRLVSPDL 16524

Query: 946   ---VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMI 1002
                 S    + V  G  + +  ++SG P PTVTW   +  +      + T  S  + ++I
Sbjct: 16525 QLDASVRDRIVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAIS--SSMVI 16582

Query: 1003  REAFAEDSGRFTCSAVNEAG 1022
             +       G ++  A NEAG
Sbjct: 16583 KNCQRSHQGVYSLLAKNEAG 16602



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 7/113 (6%)

Query: 927   TETARVPAPVEIPVTPPTLVSGLKNVTVIEGESVTLECHISGYPSPTVTWYRED--YQIE 984
             TE   V   ++ PV    L SG+  +TV  G+++ LE  + G P P V W ++     + 
Sbjct: 18189 TEEVVVKEDLQKPVLDLKL-SGV--LTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLT 18245

Query: 985   SSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEE 1037
              S   +I  ++  ++  + +A   D G++  +A N AG  S   Y  V V ++
Sbjct: 18246 RSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATNTAG--SFVAYATVNVLDK 18296



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 7/175 (4%)

Query: 1760  CSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEEL 1819
             CS+ +   +S D G         + T+      ++K          L EG++   R+   
Sbjct: 19900 CSIGWKKPHS-DGGSRIIGYVVDFLTEENKWQRVMKSLSLQYSAKDLTEGKEYTFRVSA- 19957

Query: 1820  ERMAHEGALTGVTTDQKEKQ-KPDIVLYPEP-VRVLEGETARFRCRVT--GYPQPKVNWY 1875
             E    EG  + +T   ++    PD+ L   P +  L  E + FR ++   G P P V+W 
Sbjct: 19958 ENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWK 20017

Query: 1876  LNGQLIRKSKRFRVRYDGIHYLDIV-DCKSYDTGEVKVTAENPEGVIEHKVKLEI 1929
                  +    R  V    ++   IV DC+  D G+  +T +N  G  E  + +++
Sbjct: 20018 KGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGTKEGTISIKV 20072



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 23/68 (33%), Positives = 32/68 (47%), Gaps = 2/68 (2%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             R G SI +   I G P P VTW ++ + LK   +   E       L I + N  D+GK+ 
Sbjct: 20789 RAGLSIRIFVPIKGRPAPEVTWTKDNINLK--NRANIENTESFTLLIIPECNRYDTGKFV 20846

Query: 4231  CVAENNSG 4238
                EN +G
Sbjct: 20847 MTIENPAG 20854



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 1/90 (1%)

Query: 1844  VLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRY-DGIHYLDIVDC 1902
             V + + V +  GE  R    V+G P P + W  +G+ +  + +  ++  D    L   D 
Sbjct: 21465 VKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNKDS 21524

Query: 1903  KSYDTGEVKVTAENPEGVIEHKVKLEIQQR 1932
                D+G   +TA NP G  +H   +++  R
Sbjct: 21525 TRRDSGAYTLTATNPGGFAKHIFNVKVLDR 21554



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 4/76 (5%)

Query: 29    ISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQ 88
             I G P PEV W RD       +L    I  +     L +  V + +SG+Y L   N SG 
Sbjct: 21884 IKGRPAPEVKWARD----HGESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGS 21939

Query: 89    ATSTAELLVKAETAPP 104
              ++   + V     PP
Sbjct: 21940 KSAFVNVRVLDTPGPP 21955



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 22/90 (24%), Positives = 38/90 (42%)

Query: 5174  IEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMER 5233
             I  KD  + P      +   V     L   V + G P P + W ++   L+   RI +  
Sbjct: 23221 IVAKDLVIEPDVKPAFSSYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTD 23280

Query: 5234  VGNVCSLEISNIQKGEGGEYMCHAVNIIGE 5263
               ++ +L I    K +GG+Y     N++G+
Sbjct: 23281 SLDLTTLSIKETHKDDGGQYGITVANVVGQ 23310



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 26/117 (22%), Positives = 53/117 (45%), Gaps = 14/117 (11%)

Query: 5147  HFYTPTEERGSAYEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVYENTTLGFIVEV 5206
             +F  P++  G+   I   D    PN +++PK  ++            V+   T     ++
Sbjct: 24685 NFSEPSDSSGA---ITARDEIDAPNASLDPKYKDVIV----------VHAGETFVLEADI 24731

Query: 5207  EGLPVPGVKWYRN-KSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIG 5262
              G P+P V W ++ K L E   R++++      +L + +  + +GG+Y+    N+ G
Sbjct: 24732 RGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGG 24788



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 21/103 (20%), Positives = 44/103 (42%), Gaps = 7/103 (6%)

Query: 1445  ETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHK 1504
             +   + L+  YK V V+         G+T   +  + G+P+P+  W  DG+++       
Sbjct: 24703 DAPNASLDPKYKDVIVVHA-------GETFVLEADIRGKPIPDVVWSKDGKELEETAARM 24755

Query: 1505  VVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTV 1547
              +       +L++     +D G++ +   N  G  SI + + V
Sbjct: 24756 EIKSTIQKTTLVVKDCIRTDGGQYILKLSNVGGTKSIPITVKV 24798



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 50/193 (25%), Positives = 74/193 (38%), Gaps = 22/193 (11%)

Query: 1517  IVPATPSDSGEWTVVAQNRAGR-----SSISVILTVEAVEHQVKPMFVEKLKNVNIKEGS 1571
             +   T     E+ V A+N A        S   I+  + VE     M V+    + +K G 
Sbjct: 25746 VTELTEDQRYEFRVFARNAADSVSEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGE 25805

Query: 1572  RLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTAT 1631
              L++     G P P I W K  D I   +  +  I  T     L +   + +D+  Y  T
Sbjct: 25806 VLKINADIAGRPLPVISWAK--DGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLT 25863

Query: 1632  AINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEE 1691
               N AG  T    VN +V   +P P      P G      + A   E   L +G+ Q + 
Sbjct: 25864 LKNVAG--TRSVAVNCKV-LDKPGP------PAGPLEINGLTA---EKCSLSWGRPQEDG 25911

Query: 1692  G---DLYDKEKQQ 1701
             G   D Y  EK++
Sbjct: 25912 GADIDYYIVEKRE 25924



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 25/89 (28%), Positives = 40/89 (44%), Gaps = 7/89 (7%)

Query: 1549  AVEHQVKPMF---VEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIR 1605
             A E + +P+F    E  K + +K G+   M V   G P P+++W K    +    Y    
Sbjct: 26177 AKEREEEPLFDIDSEMRKTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAY---- 26232

Query: 1606  IEGTKGEAALKIDSTVSQDSAWYTATAIN 1634
             ++ T    +L I++    DS  YT T  N
Sbjct: 26233 VDTTDSRTSLTIENANRNDSGKYTLTIQN 26261



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 29/104 (27%), Positives = 42/104 (40%), Gaps = 4/104 (3%)

Query: 1069  LTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRY 1128
             L +EQ  P E     F +  V  +   G ++     + G P P V   + GVPL    R+
Sbjct: 26466 LIKEQLEPPEIDMKNFPSHTVYVRA--GSNLKVDIPISGKPLPKVTLSRDGVPLKATMRF 26523

Query: 1129  KVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLL 1172
                   +     L  S+T   DAG Y I   N  G T A  +++
Sbjct: 26524 NTEITAENLTINLKESVT--ADAGRYEITAANSSGTTKAFINIV 26565



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 4/73 (5%)

Query: 1096  GGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1155
             G S+     V G P P + W K G+ L +    +   +       L++      DAG+YT
Sbjct: 29461 GASLRLMVSVSGRPPPVITWSKQGIDLAS----RAIIDTTESYSLLIVDKVNRYDAGKYT 29516

Query: 1156  IVVRNKHGETSAS 1168
             I   N+ G+ SA+
Sbjct: 29517 IEAENQSGKKSAT 29529



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 2/95 (2%)

Query: 4158  PKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQL- 4216
             PK L+ M      R G+ + ++   SG+P PV+TW +   L+  N  +Q         L 
Sbjct: 31028 PKTLEGMGAVHALR-GEVVSIKIPFSGKPDPVITWQKGQDLIDNNGHYQVIVTRSFTSLV 31086

Query: 4217  YIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPV 4251
             +   V  +D+G Y   A+N  G  +   +L V  V
Sbjct: 31087 FPNGVERKDAGFYVVCAKNRFGIDQKTVELDVADV 31121



 Score = 37.4 bits (85), Expect = 0.42
 Identities = 82/398 (20%), Positives = 137/398 (34%), Gaps = 61/398 (15%)

Query: 2382  ESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTI--------PALG 2433
             +S +  W    ++++ S++  I  +    +L ++D+TK D G Y   +            
Sbjct: 31596 QSTQVTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAE 31655

Query: 2434  LSTSGRVSVYSVDVITPLKDVNVIEGTKAVLE-----------------------CKVSV 2470
             L   G   VY       +K +     T  +LE                         ++V
Sbjct: 31656 LFVKGVREVYDYYCRRTMKKIKRRTDTMRLLERPPEFTLPLYNKTAYVGENVRFGVTITV 31715

Query: 2471  PDVTSVKWYLNDEQIKPDDRVQAIV----KGTKQRLVINRTHASDEGPYKLIVGRV--ET 2524
                  V WY + ++IKP D  +       KG  Q L IN     D+  Y ++      E 
Sbjct: 31716 HPEPHVTWYKSGQKIKPGDNDKKYTFESDKGLYQ-LTINSVTTDDDAEYTVVARNKYGED 31774

Query: 2525  NCNL------------SVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVL-WNFKDKE 2571
             +C              S  +    R L +  C E Q+V FE+ +S      L W    + 
Sbjct: 31775 SCKAKLTVTLHPPPTDSTLRPMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQP 31834

Query: 2572  IKPSSKYKIEAHG-KIYKLTVLNMMKDDEGKY----TFYAGENMTSGKLTVAGGAISKPL 2626
             +      +I   G   Y L + + + +D G Y    T  AG       L V      K  
Sbjct: 31835 LSLGPNIEIIHEGLDYYALHIRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKK-- 31892

Query: 2627  TDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDI 2686
              +    E  E   + ++       E L   + +PLT  +  E+      L   A     +
Sbjct: 31893 QEFKSKEEHERHVQKQIDKTLRMAEILSGTESVPLT-QVAKEALREAAVLYKPAVSTKTV 31951

Query: 2687  -GEYTYKVATSKTSAKLKVE-AVKIKKTLKNLTVTETQ 2722
              GE+  ++   K   KL++   V   +  K  T+ E Q
Sbjct: 31952 KGEFRLEIEEKKEERKLRMPYDVPEPRKYKQTTIEEDQ 31989



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 58/281 (20%), Positives = 97/281 (34%), Gaps = 38/281 (13%)

Query: 3339  EMPVYPPAIITPLQDTVTSE----GQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQ 3394
             ++   P   +  ++D + +E    G  A F+C VS +    +W      I+ S   R   
Sbjct: 11109 QLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIA 11168

Query: 3395  FEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKE 3454
                  +L I +    D G YT V      + +STA L +E       + +E+E+ +   +
Sbjct: 11169 DGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKLVVEELPVRFVKTLEEEVTVVKGQ 11228

Query: 3455  LFSEGESEHSERDT---RD----------------------AFSDSEDID---HKSMAAK 3486
                     + ERD    +D                        +D++D D   +      
Sbjct: 11229 PLYLSCELNKERDVVWRKDGKIVVEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVEN 11288

Query: 3487  RYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPT 3546
                   SS     E  +    + +  ++V      +F C  IA  TP + WF     IP 
Sbjct: 11289 ANNLECSSCVKVVEVIRDWLVKPIRDQHVKPKGTAIFACD-IAKDTPNIKWFKGYDEIPA 11347

Query: 3547  GLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEG 3587
                   +   D +H    L+IK     D   Y   A+  EG
Sbjct: 11348 EPNDKTEILRDGNH--LYLKIKNAMPEDIAEY---AVEIEG 11383



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 36/126 (28%), Positives = 58/126 (46%), Gaps = 14/126 (11%)

Query: 1801  VEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPE---PVRVLEGET 1857
             +E + L EG+    R++ L R   +GA +  +   +E Q  D    PE    V++L G T
Sbjct: 13646 MEVTGLEEGKWYAYRVKALNR---QGA-SKPSRPTEEIQAVDTQEAPEIFLDVKLLAGLT 13701

Query: 1858  ARFRCR------VTGYPQPKVNWYLNGQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEV 1910
              +   +      VTG P+PK+ W     ++++ KR  +        + IVD K  DTG  
Sbjct: 13702 VKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRSDTGTY 13761

Query: 1911  KVTAEN 1916
              + A N
Sbjct: 13762 IIEAVN 13767



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 21/63 (33%), Positives = 31/63 (49%)

Query: 1732  PTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT 1791
             P   V W  DGK ++A++RL M N+     L+   +   D+GI T    NK G+   S  
Sbjct: 14414 PVPTVSWHKDGKEVKASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASIN 14473

Query: 1792  LIV 1794
             + V
Sbjct: 14474 VKV 14476



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 33/148 (22%), Positives = 59/148 (39%), Gaps = 6/148 (4%)

Query: 1503  HKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKP--MFVE 1560
             HKV      ++   +      D+ E+ V A N  G+   S        + ++ P  + ++
Sbjct: 16764 HKVTNDNLLSRKYTVKGLKEGDTYEYRVSAVNIVGQGKPSFCTKPITCKDELAPPTLHLD 16823

Query: 1561  KLKNVNIKEGSRLEMKVRATGNPNPDIVWLKN-SDIIVPHKYPKIRIEGTKGEAALKIDS 1619
                 + I+ G    +  R +G P P + W K+ +D++   +  +  I+ T    AL+   
Sbjct: 16824 FRDKLTIRVGEAFALTGRYSGKPKPKVSWFKDEADVL---EDDRTHIKTTPATLALEKIK 16880

Query: 1620  TVSQDSAWYTATAINKAGRDTTRCKVNV 1647
                 DS  Y     N  G     C+VNV
Sbjct: 16881 AKRSDSGKYCVVVENSTGSRKGFCQVNV 16908



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 44/222 (19%), Positives = 79/222 (35%), Gaps = 18/222 (8%)

Query: 3154  KEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQS 3213
             K++  ++  +  V    N+ D D      G  + +Q +    ++  + +  +    T   
Sbjct: 17414 KDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVEYQEEGTQDWIKFKTVTNLECVVTGLQ 17473

Query: 3214  DAGEYTF------VAGRNRSSVTLYVNAPE---PPQV---LQELQPVTVQSGKPARFCAV 3261
                 Y F      + G      T+ +   E   PP V   ++ ++ + V++G   RF A+
Sbjct: 17474 QGKTYRFRVKAENIVGLGLPDTTIPIECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAI 17533

Query: 3262  ISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVAT 3321
             I G P P   W  +   + T        D     L +      D   Y     N  G  T
Sbjct: 17534 IRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKT 17593

Query: 3322  TSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPAR 3363
              +  L+  V +V  P    P  P  I+    + +T   QP +
Sbjct: 17594 VAVHLT--VLDVPGP----PTGPINILDVTPEHMTISWQPPK 17629



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 32/121 (26%), Positives = 45/121 (37%), Gaps = 3/121 (2%)

Query: 1297  IKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLP 1356
             I+   +  G  V F   + G P+P   W  DG  IK  E Y ++   +  + L I   L 
Sbjct: 17517 IEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVE-TDNFSSVLTIKNCLR 17575

Query: 1357  EDEGIYTAFASNIKGNAICSGKLYV--EPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSP 1414
              D G Y    SN  G+   +  L V   P  P G    +        I    P+    SP
Sbjct: 17576 RDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVTPEHMTISWQPPKDDGGSP 17635

Query: 1415  I 1415
             +
Sbjct: 17636 V 17636



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 26/87 (29%), Positives = 38/87 (43%), Gaps = 4/87 (4%)

Query: 1836  KEKQKPDIVLYPEPVRVL---EGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD 1892
             + +  PD  L  E  R L    G + R    + G P P+V W     +  K++      +
Sbjct: 20769 EREMAPDFELDAELRRTLVVRAGLSIRIFVPIKGRPAPEVTW-TKDNINLKNRANIENTE 20827

Query: 1893  GIHYLDIVDCKSYDTGEVKVTAENPEG 1919
                 L I +C  YDTG+  +T ENP G
Sbjct: 20828 SFTLLIIPECNRYDTGKFVMTIENPAG 20854



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 32/101 (31%), Positives = 45/101 (44%), Gaps = 5/101 (4%)

Query: 113   MTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLI-AEAYPEDS 171
             +T+R    +RL V + G P P VK+ RD  E   SLD    +    Y+LLI       DS
Sbjct: 21870 VTIRACCTLRLFVPIKGRPAPEVKWARDHGE---SLDKASIESTSSYTLLIVGNVNRFDS 21926

Query: 172   GTYSVNATNSVGRATSTAELLVQGEEEVPAK-KTKTIVSTA 211
             G Y +   NS G  ++   + V      P   K K +  T+
Sbjct: 21927 GKYILTVENSSGSKSAFVNVRVLDTPGPPQDLKVKEVTKTS 21967



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 29/104 (27%), Positives = 44/104 (42%), Gaps = 4/104 (3%)

Query: 1544  ILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPK 1603
             I+  E +E     + +E  K +NI+ G  L + V   G P P++ W K    I       
Sbjct: 22931 IIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEI----RDA 22986

Query: 1604  IRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1647
               I+ T    +L +D+    DS  YT T  N +G  +    V V
Sbjct: 22987 AIIDVTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKSAFVTVRV 23030



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query: 29    ISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYSLKATNGSGQ 88
             I G P PEV W +    I  + +  V  SF+     L +  V + +SG+Y+L   N SG 
Sbjct: 22966 IKGRPTPEVKWGKVDGEIRDAAIIDVTSSFTS----LVLDNVNRYDSGKYTLTLENSSGT 23021

Query: 89    ATSTAELLVKAETAPP 104
              ++   + V    +PP
Sbjct: 23022 KSAFVTVRVLDTPSPP 23037



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 950   KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAED 1009
             K + V  G S  +     G P+P +TW RE+ +    +  QI       +L I      D
Sbjct: 24032 KGIVVRAGGSARIHIPFKGRPTPEITWSREEGEFTDKV--QIEKGVNYTQLSIDNCDRND 24089

Query: 1010  SGRFTCSAVNEAGTVSTSCYLAVQV 1034
             +G++     N +G  S S ++ V+V
Sbjct: 24090 AGKYILKLENSSG--SKSAFVTVKV 24112



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 26/114 (22%), Positives = 50/114 (43%), Gaps = 6/114 (5%)

Query: 5166  SFGTPNEAIEPK---DNEMPPSFIEPLTKRKVYE---NTTLGFIVEVEGLPVPGVKWYRN 5219
             S   P+E + P    D+   P    PL   +V +    T++     + G P P ++WY++
Sbjct: 26850 SISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKLRAGISGKPAPTIEWYKD 26909

Query: 5220  KSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
                L+ +  + +E   ++ S+ I +  +   G Y     N +G A +   V I+
Sbjct: 26910 DKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMGSASATIRVQIL 26963



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 3951  ESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQN 4010
             ++  V  G S      +QG P P   W   D  +    +  IH+ +++S LT+ + +  +
Sbjct: 28365 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRAD--IHTTDSFSTLTVENCNRND 28422

Query: 4011  EGSITCVLFNQYGTVKTTSMLKV 4033
              G  T  + N  G+   T  +KV
Sbjct: 28423 AGKYTLTVENNSGSKSITFTVKV 28445



 Score = 37.0 bits (84), Expect = 0.55
 Identities = 20/65 (30%), Positives = 33/65 (50%)

Query: 135   VKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATSTAELLVQ 194
             V +Y    ++++S  ++I+ E  +  L + +    D GTY     N  G  +S AEL V+
Sbjct: 31600 VTWYFGVRQLENSEKYEITYEDGVAILYVKDITKLDDGTYRCKVVNDYGEDSSYAELFVK 31659

Query: 195   GEEEV 199
             G  EV
Sbjct: 31660 GVREV 31664



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 21/93 (22%), Positives = 46/93 (49%), Gaps = 3/93 (3%)

Query: 1456  KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSL 1515
             KP   L+      +EG+     +     P+P   W  DG+++    + ++ +K D   + 
Sbjct: 14386 KPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVSWHKDGKEV--KASDRLTMKNDHISAH 14443

Query: 1516  IIVP-ATPSDSGEWTVVAQNRAGRSSISVILTV 1547
             + VP +  +D+G +T+  +N+ G ++ S+ + V
Sbjct: 14444 LEVPKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 56/291 (19%), Positives = 107/291 (36%), Gaps = 36/291 (12%)

Query: 2311  KYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLS-DQKVCE 2369
             KY +T  R  Q    + +     GE       +    K +++P  + +   ++ +Q +  
Sbjct: 17173 KYKVTGLRDGQTYKFRVLAVNAAGESDPAHVPEPVLVKDRLEPPELILDANMAREQHIKV 17232

Query: 2370  GDIVQLEVKVS-LESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFT 2428
             GD ++L   +  +   +  W K+ ++     R+ +        L I +   ED G YS T
Sbjct: 17233 GDTLRLSAIIKGVPFPKVTWKKEDRDAPTKARIDVT--PVGSKLEIRNAAHEDGGIYSLT 17290

Query: 2429  IPALGLSTSGRVSVYSVDVITPLKDVNVIE----------------GTKAVLECKVSVPD 2472
             +     S +  V V  +D   P +D+ V E                G   +    V   D
Sbjct: 17291 VENPAGSKTVSVKVLVLDKPGPPRDLEVSEIRKDSCYLTWKEPLDDGGSVITNYVVERRD 17350

Query: 2473  VTSVKWY-LNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE 2531
             V S +W  L+    K     + + +G +    +   +    GP+              VE
Sbjct: 17351 VASAQWSPLSATSKKKSHFAKHLNEGNQYLFRVAAENQYGRGPF--------------VE 17396

Query: 2532  KIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKE-IKPSSKYKIE 2581
               K I+ L  L        +  V++  + + ++WN  D++   P + Y +E
Sbjct: 17397 TPKPIKALDPLHPPGPPKDLHHVDVDKTEVSLVWNKPDRDGGSPITGYLVE 17447



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 1850  VRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHY-LDIVDCKSYDTG 1908
             + V  G+T R   RV G P+P + W   G+++ + KR  +  D     L I +    D G
Sbjct: 17918 ITVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHG 17977

Query: 1909  EVKVTAENPEG 1919
             +  ++A+N  G
Sbjct: 17978 KYIISAKNSSG 17988



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 23/81 (28%), Positives = 34/81 (41%), Gaps = 1/81 (1%)

Query: 2088  TVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSA 2147
             TV  G       RV G+P+P+  W K G  + R  R+        V EL I++    D  
Sbjct: 17919 TVRVGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRV-ELQIKEAVRADHG 17977

Query: 2148  SIMVKAINIAGETSSHAFLLV 2168
               ++ A N +G     A + V
Sbjct: 17978 KYIISAKNSSGHAQGSAIVNV 17998



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 5527  IGTAAYFQCLVRGSPRPTVYWYKDGK-LVQGRRFTVEESGTGFHNLFITSLVKSDEGEYR 5585
             +G        V+G P P + W K+GK LV+ +R  + +       L I   V++D G+Y 
Sbjct: 17922 VGQTIRILARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRV-ELQIKEAVRADHGKYI 17980

Query: 5586  CVATNKSGMAESFAALTL 5603
               A N SG A+  A + +
Sbjct: 17981 ISAKNSSGHAQGSAIVNV 17998



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 33/106 (31%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 921   GREAKVTETARVPAPVEIPVTPPTL---VSGLKNVTVIEGESVTLECHISGYPSPTVTWY 977
             GR A++ E  +   P EI + PP +    S  K V V  G  + L   + G P+P VTW 
Sbjct: 18586 GRPAELKEAIK---PKEI-LEPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWR 18641

Query: 978   REDYQIESSI-DFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAG 1022
             +    I++ +   Q+     +A L+I  +  +DSG+++ + VN AG
Sbjct: 18642 KVG--IDNVVRKGQVDLVDTMAFLVIPNSTRDDSGKYSLTLVNPAG 18685



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 24/105 (22%), Positives = 50/105 (47%), Gaps = 7/105 (6%)

Query: 921   GREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVI--EGESVTLECHISGYPSPTVTWYR 978
             G  +++T  AR     +  V P   + GL ++  +  E  +  L+  I G P+P+V+W +
Sbjct: 19964 GTPSEITVVAR-----DDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSVSWKK 20018

Query: 979   EDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCSAVNEAGT 1023
              +  + +     +   +    L++ +    D+G++T +  N AGT
Sbjct: 20019 GEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAGT 20063



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 1478  LKVVGRPMPETFWFHDGQQI-VNDYTHKVVIKEDGTQSLIIVP-ATPSDSGEWTVVAQNR 1535
             + ++G+P+P++ W   G+ I  +D T    I    T S++ +  AT  D+GE+T+ A N 
Sbjct: 20401 ISILGKPLPKSSWSKAGKDIRPSDITQ---ITSTPTSSMLTIKYATRKDAGEYTITATNP 20457

Query: 1536  AGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGS 1571
              G     V +TV  V     P+   ++ NV+ ++ +
Sbjct: 20458 FGTKVEHVKVTVLDVPGPPGPV---EISNVSAEKAT 20490



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 1845  LYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIH-YLDIVDCK 1903
             +Y + V    G+  +    V G P+P V W    Q++++++R           L+I +C 
Sbjct: 21070 IYQKLVIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECV 21129

Query: 1904  SYDTGEVKVTAENPEGVIEHKVKLEI 1929
               D+G   +TA N  G +   + +++
Sbjct: 21130 RSDSGPYPLTARNIVGEVGDVITIQV 21155



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 24/95 (25%), Positives = 46/95 (48%), Gaps = 3/95 (3%)

Query: 3237  EPPQVLQELQ---PVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQE 3293
             +PP++  + +    + V +G+  +  A I G+P P I W K +Q LS   + +       
Sbjct: 22539 DPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIKSTDFA 22598

Query: 3294  YTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3328
              +L + +A   D+  Y  +AKN  G  + + ++ V
Sbjct: 22599 TSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKV 22633



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 27/77 (35%), Positives = 36/77 (46%), Gaps = 4/77 (5%)

Query: 4163  EMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSH-QLYIKDV 4221
             E+ K    R G S+ L   I G P P V W   G +  + +     +V  S   L + +V
Sbjct: 22947 ELRKIINIRAGGSLRLFVPIKGRPTPEVKW---GKVDGEIRDAAIIDVTSSFTSLVLDNV 23003

Query: 4222  NSQDSGKYKCVAENNSG 4238
             N  DSGKY    EN+SG
Sbjct: 23004 NRYDSGKYTLTLENSSG 23020



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 19/71 (26%), Positives = 32/71 (45%)

Query: 957   GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSGRFTCS 1016
             GE V +     G P PTVTW +++  + S   + I      + L I +    D+G++  +
Sbjct: 27286 GEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILT 27345

Query: 1017  AVNEAGTVSTS 1027
               N  G   +S
Sbjct: 27346 IENGVGEPKSS 27356



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 30/133 (22%), Positives = 55/133 (41%), Gaps = 8/133 (6%)

Query: 62    RAKLTIPAVTKANSGRYSLKATNGSGQATSTAEL----LVKAETAPPNFVQR--LQSMTV 115
             + + T+  +      ++ + A NG+G+  S         V   TAP   +     Q+  V
Sbjct: 28310 KTRYTVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVV 28369

Query: 116   RQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175
             R G+ +RL +   G PTP   + +  + +  SL   I       +L +      D+G Y+
Sbjct: 28370 RAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNRNDAGKYT 28427

Query: 176   VNATNSVGRATST 188
             +   N+ G  + T
Sbjct: 28428 LTVENNSGSKSIT 28440



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 26/103 (25%), Positives = 37/103 (35%), Gaps = 6/103 (5%)

Query: 5203  IVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIG 5262
             ++ + G P P   W+   S L   ER+ +E    V  L I      + GEY     N+ G
Sbjct: 29759 VIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAKLTIRETTIRDTGEYTLELKNVTG 29818

Query: 5263  EAKSFANVDIMPQEERVVALPPPVTHQHVMEFDLEHTTSSRTP 5305
                    V I+ +        PP     + E D    T S  P
Sbjct: 29819 TTSETIKVIILDKP------GPPTGPIKIDEIDATSITISWEP 29855



 Score = 36.6 bits (83), Expect = 0.72
 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 1105  VGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGE 1164
             + G P P   W  +G  L    R  V+    T   KL I  T   D GEYT+ ++N  G 
Sbjct: 29762 IAGRPPPAASWFFAGSKLRESER--VTVETHTKVAKLTIRETTIRDTGEYTLELKNVTGT 29819

Query: 1165  TSASASLL 1172
             TS +  ++
Sbjct: 29820 TSETIKVI 29827



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 1864  VTGYPQPKVNWYLNGQLIRKSKRFRVRYD-GIHYLDIVDCKSYDTGEVKVTAENPEGVIE 1922
             V G P P V+W  +G L++ ++  ++     +  L++      D+G+  +TAEN  G   
Sbjct: 19319 VFGKPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKS 19378

Query: 1923  HKVKLEI 1929
               +KL++
Sbjct: 19379 ATIKLKV 19385



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 20/78 (25%), Positives = 34/78 (43%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             +E  +  L+  I G+P P V+W +    L  + +   E    +  L + D    D+GKY 
Sbjct: 19995 KENSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYT 20054

Query: 4231  CVAENNSGAVESVSDLTV 4248
                +N +G  E    + V
Sbjct: 20055 ITLKNVAGTKEGTISIKV 20072



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 2101  VVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGET 2160
             + GKP P  +W K   ++  + R+      D    L ++D    DS + ++KA N+AGE 
Sbjct: 22567 IYGKPIPTIQWIKGDQELSNTARLE-IKSTDFATSLSVKDAVRVDSGNYILKAKNVAGER 22625

Query: 2161  S 2161
             S
Sbjct: 22626 S 22626



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 82/420 (19%), Positives = 148/420 (35%), Gaps = 53/420 (12%)

Query: 2066  PDKIELSPSMEAPKI---FERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSD 2122
             P  I +   +EAP I    E  +   +  G      V + G+P PE +W K   +I  + 
Sbjct: 22928 PGPIIVEEKLEAPDIDLDLELRKIINIRAGGSLRLFVPIKGRPTPEVKWGKVDGEIRDAA 22987

Query: 2123  RIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQL--------- 2173
              I       +   LV+ +V   DS    +   N +G  S  AF+ V+             
Sbjct: 22988 IID---VTSSFTSLVLDNVNRYDSGKYTLTLENSSGTKS--AFVTVRVLDTPSPPVNLKV 23042

Query: 2174  ---------ITFTQELQDVVAKEKDTMATFECETSEPFVKV-------KWYKDGMEVHEG 2217
                      IT+   L D  +K K+ +      T + +  V        W  D  ++ EG
Sbjct: 23043 TEITKDSVSITWEPPLLDGGSKIKNYIVEKREATRKSYAAVVTNCHKNSWKID--QLQEG 23100

Query: 2218  DKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIE 2277
               Y      +  +   L   T+D    +      E  +   K+ V+      V       
Sbjct: 23101 CSYYFRVTAENEYGIGLPAQTADPIKVA------EVPQPPGKITVDDVTRNSVSLSWTKP 23154

Query: 2278  VPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNL----TVKDVTKEDQ 2333
               +  S  ++ IV  +    + +     +KS         +G + L     V +  + D 
Sbjct: 23155 EHDGGSKIIQYIVEMQAKHSEKWSECARVKSLQAVITNLTQGEEYLFRVVAVNEKGRSDP 23214

Query: 2334  GEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGV-WMKDG 2392
                +  I  K    +  +KP         S   V  G  +++EV +S      + W KDG
Sbjct: 23215 RSLAVPIVAKDLVIEPDVKP-------AFSSYSVQVGQDLKIEVPISGRPKPTITWTKDG 23267

Query: 2393  QEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLK 2452
               ++ + R+++        L I++  K+D G Y  T+  +    +  + + ++D   P K
Sbjct: 23268 LPLKQTTRINVTDSLDLTTLSIKETHKDDGGQYGITVANVVGQKTASIEIVTLDKPDPPK 23327



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 22/97 (22%), Positives = 41/97 (42%), Gaps = 3/97 (3%)

Query: 3943  PPSFLQEIESQEVY---EGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYS 3999
             PP  + +++ ++V     G+         G P P+++W  + + I       I S +N++
Sbjct: 25786 PPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHT 25845

Query: 4000  ILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAK 4036
             +LT+     ++ G     L N  GT       KV  K
Sbjct: 25846 LLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDK 25882



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 35/151 (23%), Positives = 59/151 (39%), Gaps = 14/151 (9%)

Query: 1527  EWTVVAQNRAGRSSISVILTVEAVEHQVKP---MFVEKLKNVNIKEGSRLEMKVRATGNP 1583
             E+ V A+N  G S    I  +   E  + P   +       V ++ G  + +++   G P
Sbjct: 27532 EFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLSDIPGAQVTVRIGHNVHLELPYKGKP 27591

Query: 1584  NPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRC 1643
              P I WLK+   +   ++  +R   T+ +  L I +   +    YT         D   C
Sbjct: 27592 KPSISWLKDGLPLKESEF--VRFSKTENKITLSIKNAKKEHGGKYTVIL------DNAVC 27643

Query: 1644  KVNVEVEFAEPEPERKLIIPRGTYRAKEIAA 1674
             ++ V +      P  K   P+G  R  EI A
Sbjct: 27644 RIAVPITVITLGPPSK---PKGPIRFDEIKA 27671



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 21/85 (24%), Positives = 41/85 (48%)

Query: 111   QSMTVRQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPED 170
             Q +T + GS   + V ++G P P V +  +   ++ +    I+   D  +L + ++   D
Sbjct: 28655 QLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGD 28714

Query: 171   SGTYSVNATNSVGRATSTAELLVQG 195
             SG Y +   N+ G  T +  ++V G
Sbjct: 28715 SGRYFLTLENTAGVKTFSVTVVVIG 28739



 Score = 36.2 bits (82), Expect = 0.94
 Identities = 27/113 (23%), Positives = 44/113 (38%), Gaps = 11/113 (9%)

Query: 3944  PSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNF-IIHSLENYSILT 4002
             P F + + + E  EG S  F     G P P + W  +  P+    N  IIH   +Y  L 
Sbjct: 31795 PMFKRLLANAECQEGQSVCFEIRVSGIPPPTLKWEKDGQPLSLGPNIEIIHEGLDYYALH 31854

Query: 4003  LSSVHHQNEGSITCVLFNQYGTVKTTSMLKV----------KAKQKHDVKAHK 4045
             +     ++ G       N  G+    + L+V          K+K++H+    K
Sbjct: 31855 IRDTLPEDTGYYRVTATNTAGSTSCQAHLQVERLRYKKQEFKSKEEHERHVQK 31907



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 32/119 (26%), Positives = 50/119 (42%), Gaps = 3/119 (2%)

Query: 1530  VVAQNRAGRSSISVIL-TVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIV 1588
             V A N  G S  S I   V A +   KP    +  ++ + EG +L + V     P P + 
Sbjct: 14360 VRAVNAIGVSEPSEISENVVAKDPDCKPTIDLETHDIIVIEGEKLSIPVPFRAVPVPTVS 14419

Query: 1589  WLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1647
             W K+   +      ++ ++     A L++  +V  D+  YT T  NK G  T    V V
Sbjct: 14420 WHKDGKEV--KASDRLTMKNDHISAHLEVPKSVRADAGIYTITLENKLGSATASINVKV 14476



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query: 5177  KDNEMPPSFIEPLTKR----KVYENTTLGFIVEVEGLPVPGVKWYRNKSLLE-PDERI-- 5229
             +D+E+PP+    L+ R    KV     +    +V GLP+P ++W +N++++E P + +  
Sbjct: 15389 QDDEVPPTIKLRLSVRGDTIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQI 15448

Query: 5230  ---KMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDI 5272
                ++ R      L I    + + G Y   A N +G    F NV +
Sbjct: 15449 TKEEVSRSEAKTELSIPKAVREDKGTYTVTASNRLGSV--FRNVHV 15492



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 2/66 (3%)

Query: 4173  GDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCV 4232
             G  I +   +SG+P P VTW  N   L Q    +   ++ S  + IK+      G Y  +
Sbjct: 16539 GGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSS--MVIKNCQRSHQGVYSLL 16596

Query: 4233  AENNSG 4238
             A+N +G
Sbjct: 16597 AKNEAG 16602



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 1482  GRPMPETFWFHDGQQIV-NDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAG 1537
             G+P P+  WF D   ++ +D TH  +     T +L  + A  SDSG++ VV +N  G
Sbjct: 16844 GKPKPKVSWFKDEADVLEDDRTH--IKTTPATLALEKIKAKRSDSGKYCVVVENSTG 16898



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 35/111 (31%), Positives = 47/111 (42%), Gaps = 15/111 (13%)

Query: 4156  EPPKMLQE--MPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCS 4213
             EPP++  +  M K    R G  I L  ++ G P P VTW + G+     +K Q + V+  
Sbjct: 18602 EPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRKVGI-DNVVRKGQVDLVDTM 18660

Query: 4214  HQLYIKDVNSQDSGKYKCVAENNSG------------AVESVSDLTVEPVT 4252
               L I +    DSGKY     N +G                VSDL V  VT
Sbjct: 18661 AFLVIPNSTRDDSGKYSLTLVNPAGEKAVFVNVRVLDTPGPVSDLKVSDVT 18711



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 35/131 (26%), Positives = 55/131 (41%), Gaps = 8/131 (6%)

Query: 3515  VLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRD 3574
             V  G  V     +   P P ++W  +     T L+     +  +  +  +LE+  V  +D
Sbjct: 19307 VKAGTNVCLDATVFGKPMPTVSWKKDG----TLLKPAEGIKMAMQRNLCTLELFSVNRKD 19362

Query: 3575  SGSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLKR-AERTHENVEALVERGEDRIK- 3632
             SG Y + A NS GS  +T  L V+ K      ++  K  ++R   + E  +E G   I  
Sbjct: 19363 SGDYTITAENSSGSKSATIKLKVLDKPGPPASVKINKMYSDRAMLSWEPPLEDGGSEITN 19422

Query: 3633  --VDLRFTGSP 3641
               VD R T  P
Sbjct: 19423 YIVDKRETSRP 19433



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 18/59 (30%), Positives = 27/59 (45%)

Query: 3375  VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3433
             VSW      +KP+   +M    +   LE+     +D G YT  A N+ G  S+T  L +
Sbjct: 19327 VSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATIKLKV 19385



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 27/110 (24%), Positives = 45/110 (40%), Gaps = 4/110 (3%)

Query: 1530  VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNI--KEGSRLEMKVRATGNPNPDI 1587
             V A+N  G  + S I  V   +     + ++ L ++    KE S   +K+   G P P +
Sbjct: 19955 VSAENENGEGTPSEITVVARDDVVAPDLDLKGLPDLCYLAKENSNFRLKIPIKGKPAPSV 20014

Query: 1588  VWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1637
              W K  D +      ++ +E +     L +      D+  YT T  N AG
Sbjct: 20015 SWKKGEDPLATD--TRVSVESSAVNTTLIVYDCQKSDAGKYTITLKNVAG 20062



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 44/193 (22%), Positives = 80/193 (41%), Gaps = 16/193 (8%)

Query: 3248  VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3307
             + V +G+  R  A + G+P P I W + ++ +    +C+  +   +  L++ +A   D  
Sbjct: 23635 IVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGG 23694

Query: 3308  VYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDT-VTSEGQPARFQC 3366
              Y   A N  G    S S  V V  +  P       PP    P+Q T VTSE     +  
Sbjct: 23695 QYILRASNVAG----SKSFPVNVKVLDRPG------PPE--GPVQVTGVTSEKCSLTWSP 23742

Query: 3367  RVSGTDLKVSWYSKDKKIKPSRFFRMTQFE-DTYQLEIAEAYPEDEGTYTFVASN--AVG 3423
              +      +S Y  +K+      + +   E  T  L++ +    +E  +  +A N   VG
Sbjct: 23743 PLQDGGSDISHYVVEKRETSRLAWTVVASEVVTNSLKVTKLLEGNEYVFRIMAVNKYGVG 23802

Query: 3424  QVSSTANLSLEAP 3436
             +   +A + ++ P
Sbjct: 23803 EPLESAPVLMKNP 23815



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIV-PATPSDSGEWT 1529
             G+T R +  V G+P+P   W    ++I  + + +  IK    ++L+IV  A   D G++ 
Sbjct: 23640 GETFRLEADVHGKPLPTIEWLRGDKEI--EESARCEIKNTDFKALLIVKDAIRIDGGQYI 23697

Query: 1530  VVAQNRAGRSSISVILTV 1547
             + A N AG  S  V + V
Sbjct: 23698 LRASNVAGSKSFPVNVKV 23715



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 16/67 (23%), Positives = 34/67 (50%)

Query: 4173  GDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCV 4232
             G++  LE  + G+P P + W +    ++++ + + +  +    L +KD    D G+Y   
Sbjct: 23640 GETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIKNTDFKALLIVKDAIRIDGGQYILR 23699

Query: 4233  AENNSGA 4239
             A N +G+
Sbjct: 23700 ASNVAGS 23706



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 38/172 (22%), Positives = 69/172 (40%), Gaps = 18/172 (10%)

Query: 5111  GEALERYSIPTGG---PNPTGTFKTYPSKIEREDGTPNEHFYTPTEERGSAYEIWRSDSF 5167
             G  +ER  +P G     N T   +TY    E  + T ++ +      R +A      DS 
Sbjct: 25718 GYIVERRELPDGRWLKCNYTNIQETY---FEVTELTEDQRYEFRVFARNAA------DSV 25768

Query: 5168  GTPNEAIEP---KDNEMPPSFIEPLTKRKVY---ENTTLGFIVEVEGLPVPGVKWYRNKS 5221
               P+E+  P   KD+  PP  +  +  R V        L    ++ G P+P + W ++  
Sbjct: 25769 SEPSESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGI 25828

Query: 5222  LLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIM 5273
              +E   R ++    N   L + +  + + G+Y+    N+ G      N  ++
Sbjct: 25829 EIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVL 25880



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 1/77 (1%)

Query: 1844  VLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFR-VRYDGIHYLDIVDC 1902
             V + + + V  GE  +    + G P P ++W  +G  I +  R   +  D    L + DC
Sbjct: 25793 VKFRDVIVVKAGEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDC 25852

Query: 1903  KSYDTGEVKVTAENPEG 1919
                DTG+  +T +N  G
Sbjct: 25853 IRRDTGQYVLTLKNVAG 25869



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 99/447 (22%), Positives = 148/447 (33%), Gaps = 73/447 (16%)

Query: 950   KNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAED 1009
             K + V  G S T+     G P P V W + D  + +      T       L I  A   D
Sbjct: 26194 KTLIVKAGASFTMTVPFRGRPVPNVLWSKPDTDLRTRAYVDTT--DSRTSLTIENANRND 26251

Query: 1010  SGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSL 1069
             SG++T +  N     S +  L V+V +     T    +  T E    V S DV   D   
Sbjct: 26252 SGKYTLTIQNVLSAASLT--LVVKVLDTPGPPTNITVQDVTKESA--VLSWDVPEND--- 26304

Query: 1070  TEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYK 1129
                    G P   Y I K    K     SV   C         + +K + +     Y ++
Sbjct: 26305 ------GGAPVKNYHIEKREASKKA-WVSVTNNCN-------RLSYKVTNLQEGAIYYFR 26350

Query: 1130  VSYNKQTG-----ECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQ 1184
             VS   + G     E K  + +T      E       K G TS S                
Sbjct: 26351 VSGENEFGVGIPAETKEGVKITEKPSPPE-------KLGVTSISKD-------------- 26389

Query: 1185  QEMLYQTQVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDT-VVVRTYVEDQ 1243
                     +T    E   G     +V    EK    ++  ++  +AK T  VV    E+ 
Sbjct: 26390 -----SVSLTWLKPEHDGGSRIVHYVVEALEK---GQKNWVKCAVAKSTHHVVSGLRENS 26441

Query: 1244  EFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRIL 1303
             E+    F E      + R  +  L  L++E         +   E     F S     R  
Sbjct: 26442 EYFFRVFAENQAGLSDPR--ELLLPVLIKE--------QLEPPEIDMKNFPSHTVYVR-- 26489

Query: 1304  EGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYT 1363
              G  +     +SG PLPK+   +DG  +K   R+  +   +   ++ +   +  D G Y 
Sbjct: 26490 AGSNLKVDIPISGKPLPKVTLSRDGVPLKATMRFNTEITAE-NLTINLKESVTADAGRYE 26548

Query: 1364  AFASNIKGNAICSGKLYV--EPAAPLG 1388
               A+N  G       + V   P  P G
Sbjct: 26549 ITAANSSGTTKAFINIVVLDRPGPPTG 26575



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 32/130 (24%), Positives = 57/130 (43%), Gaps = 6/130 (4%)

Query: 3310  TCEAKNDYGVATTSASLSVEVP-EVVSPDQEMPVYP-PAIITPLQDTVTSE---GQPARF 3364
             T  ++ ++ V   +A  S+  P EVV P   +  Y  P I  PL+ T   +   G   + 
Sbjct: 26833 TQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAGTSVKL 26892

Query: 3365  QCRVSGTDLK-VSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVG 3423
             +  +SG     + WY  DK+++ +    +    D   + I +A   + G Y     NA+G
Sbjct: 26893 RAGISGKPAPTIEWYKDDKELQTNALVCVENTTDLASILIKDADRLNSGCYELKLRNAMG 26952

Query: 3424  QVSSTANLSL 3433
               S+T  + +
Sbjct: 26953 SASATIRVQI 26962



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 37/148 (25%), Positives = 60/148 (40%), Gaps = 10/148 (6%)

Query: 884   ADTPDTYKSEAGVEVKKEVGVSITGTTVREE-RFEVLHGREAKVTETARVPAPVEIP--V 940
             AD  D +K  A   VK     ++T     EE +F V     A   ++  V   ++    +
Sbjct: 28295 ADLGDWHKVNAEACVKTRY--TVTDLQAGEEYKFRVSAINGAGKGDSCEVTGTIKAVDRL 28352

Query: 941   TPPTLV--SGLKNVTVIE-GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGI 997
             T P L   +  K   V+  G S+ L     G P+PT  W + D  +    D   T     
Sbjct: 28353 TAPELDIDANFKQTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRADIHTT--DSF 28410

Query: 998   ARLMIREAFAEDSGRFTCSAVNEAGTVS 1025
             + L +      D+G++T +  N +G+ S
Sbjct: 28411 STLTVENCNRNDAGKYTLTVENNSGSKS 28438



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 34/155 (21%), Positives = 55/155 (35%), Gaps = 15/155 (9%)

Query: 4171  REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYK 4230
             R G SI L     G P P   W +    L  + +      +    L +++ N  D+GKY 
Sbjct: 28370 RAGASIRLFIAYQGRPTPTAVWSKPDSNL--SLRADIHTTDSFSTLTVENCNRNDAGKYT 28427

Query: 4231  CVAENNSGAVESVSDLTV-------EPVTYRENSQFENIGEIYGKYSRDQQLQDQGESVR 4283
                ENNSG+      + V        P+T      F+++         D  L D G  + 
Sbjct: 28428 LTVENNSGSKSITFTVKVLDTPGPPGPIT------FKDVTRGSATLMWDAPLLDGGARIH 28481

Query: 4284  AHFYDYPAGPFTPWTNVKEYSVRDYFQSLETIEQI 4318
              +  +        W  + E   R  F+  +  E +
Sbjct: 28482 HYVVEKREASRRSWQVISEKCTRQIFKVNDLAEGV 28516



 Score = 35.8 bits (81), Expect = 1.2
 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 6/101 (5%)

Query: 2062  PTFKPDKIELSPSMEAP--KIFERIQSQT-VGQGSDAHFRVRVVGKPDPECEWYKNGVKI 2118
             P   P  ++++  +E P  ++ ER Q    V QG      + + GKP P C+W K G  I
Sbjct: 30118 PAEVPGTVKVTEMLEYPDYELDERYQEGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDI 30177

Query: 2119  ERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGE 2159
              +   I      +   ELVI++    DS +  +   N  G+
Sbjct: 30178 SKRAMIA---TSETHTELVIKEADRGDSGTYDLVLENKCGK 30215



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 24/119 (20%), Positives = 55/119 (46%), Gaps = 3/119 (2%)

Query: 99   AETAPPNFVQRLQSMTVRQGSQVRLQVRVT-GIPTPVVKFYRDGAEIQSSLDFQISQEGD 157
            ++T P   ++ +++ TV + +    ++ +    P   + +Y+   +++ S  F+IS +GD
Sbjct: 8651 SQTEPVTLIKDIENQTVLKDNDAVFEIDIKINYPEIKLSWYKGTEKLEPSDKFEISIDGD 8710

Query: 158  LYSLLIAEAYPEDSGTYSVNATNSVGRATSTA--ELLVQGEEEVPAKKTKTIVSTAQIS 214
             ++L +     +D G Y +     +  A  T       +  ++V  K+ +T   T Q S
Sbjct: 8711 RHTLRVKNCQLKDQGNYRLVCGPHIASAKLTVIEPAWERHLQDVTLKEGQTCTMTCQFS 8769



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 29/100 (29%), Positives = 41/100 (41%), Gaps = 8/100 (8%)

Query: 252   KTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPS--PIRHSPSPVRHVRAP---TPSPVRS 306
             K P  IPPKP+S  P  P  A K  +  ++ P+  P +   +PV+   AP    P     
Sbjct: 10565 KVPEAIPPKPESPPPEVPE-APKEVVPEKKVPAAPPKKPEVTPVKVPEAPKEVVPEKKVP 10623

Query: 307   VSPAARISTSPIRSVRSP--LLMRKTQASTVATGPEVPPP 344
             V P  +    P +    P   +  K     +   PE PPP
Sbjct: 10624 VPPPKKPEVPPTKVPEVPKVAVPEKKVPEAIPPKPESPPP 10663



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 40/185 (21%), Positives = 70/185 (37%), Gaps = 15/185 (8%)

Query: 10    QPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRA-KLTIP 68
             +P Q ++   G+   F A ++   V EV W R+  V+       +    S+G+  +L I 
Sbjct: 12916 RPPQDILEAPGADVVFLAELNKDKV-EVQWLRNNMVVVQGDKHQMM---SEGKIHRLQIC 12971

Query: 69    AVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQVRLQVRVT 128
              +   + G Y   A +   +A        K +TA        Q + V  G  + + V   
Sbjct: 12972 DIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTAD-------QDLVVDVGKPLTMVVPYD 13024

Query: 129   GIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATNSVGRATST 188
               P    +++++   + +     I    +  S  I EA   D G Y +   N  G+A   
Sbjct: 13025 AYPKAEAEWFKENEPLSTKT---IDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGF 13081

Query: 189   AELLV 193
               L V
Sbjct: 13082 INLKV 13086



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 6/107 (5%)

Query: 1568  KEGSRLEMKVRATGNPNPDIVW-----LKNSDIIVPHKYPK-IRIEGTKGEAALKIDSTV 1621
             K GS++ +     G P P   W      K +     H  P+  ++E  +  + + I    
Sbjct: 15823 KAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPEDAQLETAENSSVIIIPECK 15882

Query: 1622  SQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYR 1668
                +  Y+ TA NKAG+ T  C+V V      P+  +   I RG+ R
Sbjct: 15883 RSHTGKYSITAKNKAGQKTANCRVKVMDVPGPPKDLKVSDITRGSCR 15929



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 2871  LECKAKLFVETLHI-TKTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFK 2928
             +EC+ KL   ++ +  K ++ + V    T  F   +    VP+  W  +G EI+  E + 
Sbjct: 17499 IECQEKLVPPSVELDVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYT 17558

Query: 2929  IVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV 2966
             +        L I N    D+ EY     N   S T+ V
Sbjct: 17559 VETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKTVAV 17596



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 3237  EPPQVLQELQP---VTVQSGKPARFCAVISGRPQPKISWYK 3274
             EPP++  +      V V++G P R  A++ GRP PK++W K
Sbjct: 18602 EPPEIDLDASMRKLVIVRAGCPIRLFAIVRGRPAPKVTWRK 18642



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 5/117 (4%)

Query: 2388  WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV 2447
             W K   EV  S  + +     S +L+I+D+T++D+G YS T      + + ++ V  +D 
Sbjct: 18932 WKKGEDEVVTSSHLAVHKADSSSILIIKDVTRKDSGYYSLTAENSSGTDTQKIKVVVMDA 18991

Query: 2448  ITPLK---DVNVIEGTKAVLECKVSVPDVTS--VKWYLNDEQIKPDDRVQAIVKGTK 2499
               P +   D++ I+     L   + + D  S    + +    +   D V A+   TK
Sbjct: 18992 PGPPQPPFDISDIDADACSLSWHIPLEDGGSNITNYIVEKCDVSRGDWVTALASVTK 19048



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 35/172 (20%), Positives = 62/172 (36%), Gaps = 20/172 (11%)

Query: 1492  HDGQQIVNDYTHKVVIKEDGTQSLIIVPA------------TPSDSGEWTVVAQNRAGRS 1539
             +DG   +  Y  ++ + E+    ++  PA            T +   +  + A N  G  
Sbjct: 21781 YDGGSEITGYMVEIALPEEDEWQIVTPPAGLKATSYTITGLTENQEYKIRIYAMNSEGLG 21840

Query: 1540  SISVILTVEAVEHQVKPMFVEK----LKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDI 1595
               +++      E ++ P  +E      K V I+    L + V   G P P++ W ++   
Sbjct: 21841 EPALVPGTPKAEDRMLPPEIELDADLRKVVTIRACCTLRLFVPIKGRPAPEVKWARDHG- 21899

Query: 1596  IVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV 1647
                    K  IE T     L + +    DS  Y  T  N +G  +    V V
Sbjct: 21900 ---ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKSAFVNVRV 21948



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 25/84 (29%), Positives = 36/84 (42%), Gaps = 3/84 (3%)

Query: 1457  PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLI 1516
             P F L   +F  L G+  + D+  +GRP P   W  D   +    T +V  +     SL+
Sbjct: 22148 PAFKLLFNTFTVLAGEDLKVDVPFIGRPTPAVTWHKDNVPL--KQTTRVNAESTENNSLL 22205

Query: 1517  -IVPATPSDSGEWTVVAQNRAGRS 1539
              I  A   D G + V   N AG +
Sbjct: 22206 TIKDACREDVGHYVVKLTNSAGEA 22229



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 34/138 (24%), Positives = 59/138 (42%), Gaps = 7/138 (5%)

Query: 1238  TYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDIS-ESEAVESGFDSR 1296
             T V + +F +S   E   +  E+R+I       + +  +    +    E E      D +
Sbjct: 23573 TNVIETQFTVSGLTED--QRYEFRVIAKNAAGAISKPSDSTGPITAKDEVELPRISMDPK 23630

Query: 1297  IKNYRILEGMGVTFHCK--MSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVV 1354
              ++  I+   G TF  +  + G PLP I W +  K I+   R ++    D +A L +   
Sbjct: 23631 FRD-TIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEIK-NTDFKALLIVKDA 23688

Query: 1355  LPEDEGIYTAFASNIKGN 1372
             +  D G Y   ASN+ G+
Sbjct: 23689 IRIDGGQYILRASNVAGS 23706



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 36/175 (20%), Positives = 71/175 (40%), Gaps = 7/175 (4%)

Query: 1964  VDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKK 2023
             +  P +TTE  +  ++    R    K   ++  + S  K   + G       VE K + +
Sbjct: 27447 IGEPCETTEPVKAAEVPAPIRDLSMKDSTKTSVILSWTKPDFDGGSVITEYVVERKGKGE 27506

Query: 2024  DESYEELLRKTKDELLHWTKELTEEEKKALAEEGK-----ITIPTFKPDKIELSPSMEAP 2078
                    + KT +  +   KE +  E +  A+  K     +TI      ++ ++P ++  
Sbjct: 27507 QTWSHAGISKTCEIEVSQLKEQSVLEFRVFAKNEKGLSDPVTIGPITVKELIITPEVDLS 27566

Query: 2079  KIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNV 2133
              I       TV  G + H  +   GKP P   W K+G+ ++ S+ + +   E+ +
Sbjct: 27567 DIPGA--QVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFSKTENKI 27619



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 2/74 (2%)

Query: 11    PLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAV 70
             P   V V  G     E    G P P +SW +DG  +  S    V+ S ++ +  L+I   
Sbjct: 27569 PGAQVTVRIGHNVHLELPYKGKPKPSISWLKDGLPLKESEF--VRFSKTENKITLSIKNA 27626

Query: 71    TKANSGRYSLKATN 84
              K + G+Y++   N
Sbjct: 27627 KKEHGGKYTVILDN 27640



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 21/75 (28%), Positives = 35/75 (46%)

Query: 5206  VEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAK 5265
             V+G PVP V W+++   +E    +++  V    SL + +  +   G Y   A N  G AK
Sbjct: 27982 VQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAK 28041

Query: 5266  SFANVDIMPQEERVV 5280
             +   V +     +VV
Sbjct: 28042 AEIKVKVQDTPGKVV 28056



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 8/97 (8%)

Query: 2355  PIAILQGLSDQKV-CE-GDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHM 2411
             P A L G+++Q + C+ G    ++V +S      V W  +   ++ +DRV I   K    
Sbjct: 28645 PTADLTGITNQLITCKAGSPFTIDVPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTT 28704

Query: 2412  LLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVI 2448
             L ++D  + D+G Y  T     L  +  V  +SV V+
Sbjct: 28705 LTVKDSMRGDSGRYFLT-----LENTAGVKTFSVTVV 28736



 Score = 35.4 bits (80), Expect = 1.6
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 4/76 (5%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             + + V +G        I G P P   W ++GQ IS   +    I+ S+   +L I    +
Sbjct: 30144 EGIFVRQGGVIRLTIPIKGKPFPICKWTKEGQDISKRAM----IATSETHTELVIKEADR 30199

Query: 73    ANSGRYSLKATNGSGQ 88
              +SG Y L   N  G+
Sbjct: 30200 GDSGTYDLVLENKCGK 30215



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 4172  EGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKC 4231
             E D +IL+C IS    PV  WF++G  +K ++    +       L +K     D G+Y C
Sbjct: 12031 EKDEVILQCEISKADAPV-KWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTC 12089



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 34/121 (28%), Positives = 43/121 (35%), Gaps = 6/121 (4%)

Query: 1530  VVAQNRAGRSSISVILTVEAVEHQVKP---MFVEKLKNVNIKEGSRLEMKVRATGNPNPD 1586
             V A N AG         V   E Q  P   + V     + I  G  L +    TG P P 
Sbjct: 15076 VSAVNAAGEGPPGETQPVTVAEPQEPPAVELDVSVKGGIQIMAGKTLRIPAVVTGRPVPT 15135

Query: 1587  IVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVN 1646
              VW K    +   +   I   GTK E  +K    + +D   Y  TA N  G      +V 
Sbjct: 15136 KVWTKEEGELDKDRV-VIDNVGTKSELIIK--DALRKDHGRYVITATNSCGSKFAAARVE 15192

Query: 1647  V 1647
             V
Sbjct: 15193 V 15193



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 4/108 (3%)

Query: 1829  TGVTTDQKEKQKPDIVL---YPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSK 1885
             TG  T + E   P I +   Y + + V  GE+ +    + G P P + W    Q +  + 
Sbjct: 22529 TGAITARDEVDPPRISMDPKYKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTA 22588

Query: 1886  RFRVR-YDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQR 1932
             R  ++  D    L + D    D+G   + A+N  G     V +++  R
Sbjct: 22589 RLEIKSTDFATSLSVKDAVRVDSGNYILKAKNVAGERSVTVNVKVLDR 22636



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 21/94 (22%), Positives = 41/94 (43%), Gaps = 1/94 (1%)

Query: 1840  KPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIH-YLD 1898
             +P + L      +  GE  +    V G P+P ++W  +G+ ++++ R  V        L 
Sbjct: 24311 QPSLKLPFNTYSIQAGEDLKIEIPVIGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLH 24370

Query: 1899  IVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQR 1932
             I +    D G+  VTA N  G     + + + ++
Sbjct: 24371 IKEGNKDDFGKYTVTATNSAGTATENLSVIVLEK 24404



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 19/70 (27%), Positives = 36/70 (51%), Gaps = 4/70 (5%)

Query: 3531  PTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAE 3590
             P P + W+ +++ + T     ++  +DL    +S+ IK     +SG Y L   N+ GSA 
Sbjct: 26900 PAPTIEWYKDDKELQTNALVCVENTTDL----ASILIKDADRLNSGCYELKLRNAMGSAS 26955

Query: 3591  STASLLVIQK 3600
             +T  + ++ K
Sbjct: 26956 ATIRVQILDK 26965



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 6/82 (7%)

Query: 2299  WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDG-----KKTTCKLKMKP 2353
             W  ++  L S+ +Y+I +      LT+  VT+ D G+Y   I+      K +T  +K+  
Sbjct: 27305 WRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLD 27364

Query: 2354  RPIAILQGLSDQKVCEGDIVQL 2375
              P A  Q L  + V  G +  L
Sbjct: 27365 TP-AACQKLQVKHVSRGTVTLL 27385



 Score = 35.0 bits (79), Expect = 2.1
 Identities = 24/89 (26%), Positives = 39/89 (43%), Gaps = 9/89 (10%)

Query: 5207  EGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGEAKS 5266
             +G P P + W ++   L+  E ++  +  N  +L I N +K  GG+Y      I+  A  
Sbjct: 27588 KGKPKPSISWLKDGLPLKESEFVRFSKTENKITLSIKNAKKEHGGKYTV----ILDNAVC 27643

Query: 5267  FANVDIMPQEERVVALPPPVTHQHVMEFD 5295
                V I      V+ L PP   +  + FD
Sbjct: 27644 RIAVPI-----TVITLGPPSKPKGPIRFD 27667



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 6/78 (7%)

Query: 4172  EGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKC 4231
             E D I L+C +S +    V WF++G  +  + K+  +       L IK  + +D G+Y C
Sbjct: 11676 EKDEITLKCEVSKDVP--VKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVC 11733

Query: 4232  VAENNSGAVESVSDLTVE 4249
                 + G  ++ +++TVE
Sbjct: 11734 ----DCGTDKTKANVTVE 11747



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 4190  VTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAEN 4235
             V W +N +++ Q  K Q       H+L I D+  +D G+Y+ +A++
Sbjct: 12942 VQWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKD 12987



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 19/74 (25%), Positives = 33/74 (44%)

Query: 949   LKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAE 1008
             L  +TV  G  + L   ++G P P +TW + D  ++      I      + + I ++   
Sbjct: 13697 LAGLTVKAGTKIELPATVTGKPEPKITWTKADMILKQDKRITIENVPKKSTVTIVDSKRS 13756

Query: 1009  DSGRFTCSAVNEAG 1022
             D+G +   AVN  G
Sbjct: 13757 DTGTYIIEAVNVCG 13770



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 33/155 (21%), Positives = 60/155 (38%), Gaps = 17/155 (10%)

Query: 4095  DTELLSFPVEIQVTAATPIPEQDKESKEVFQTEELEP--KAMPQDQVTQSPKHRFVFLSD 4152
             D + ++ P ++  T    +P   +  K  F+ + +    ++ P D   + P       +D
Sbjct: 15750 DWKRVNEPDKLITTCECVVPNLKELRKYRFRVKAVNEAGESEPSDTTGEIPA------TD 15803

Query: 4153  ITNEPPKMLQEMPKHAR-CREGDSIILECLISGEPQPVVTWFQNGVLLKQN--------Q 4203
             I  EP   +    +    C+ G  I +  +I G P P  +W  +G   K          +
Sbjct: 15804 IQEEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDGVHDIPE 15863

Query: 4204  KFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSG 4238
               Q E    S  + I +     +GKY   A+N +G
Sbjct: 15864 DAQLETAENSSVIIIPECKRSHTGKYSITAKNKAG 15898



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 6/96 (6%)

Query: 3083  EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA----GGNVSTA 3138
             +P  TV W KD   L+  + IK+  ++ +  L + S    D+G YT+ A    G   +T 
Sbjct: 19322 KPMPTVSWKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 19381

Query: 3139  KLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDD 3174
             KL V  +     S+K  +  +   RA++ +E   +D
Sbjct: 19382 KLKVLDKPGPPASVK--INKMYSDRAMLSWEPPLED 19415



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 2/86 (2%)

Query: 19    EGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRY 78
             E S    +  I G P P VSW +    ++T T   V +  S     L +    K+++G+Y
Sbjct: 19996 ENSNFRLKIPIKGKPAPSVSWKKGEDPLATDT--RVSVESSAVNTTLIVYDCQKSDAGKY 20053

Query: 79    SLKATNGSGQATSTAELLVKAETAPP 104
             ++   N +G    T  + V  +   P
Sbjct: 20054 TITLKNVAGTKEGTISIKVVGKPGIP 20079



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 2346  TCKLKMKPRPIAILQGLSDQKVCE-GDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHI 2403
             TC+  ++   I +     D  + + G+  +LE  VS      + W KDG+E++ + ++ I
Sbjct: 21451 TCRDDVEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEI 21510

Query: 2404  VIDKQSHMLLIEDMTKEDAGNYSFT 2428
              I   S  L+ +D T+ D+G Y+ T
Sbjct: 21511 KIADFSTNLVNKDSTRRDSGAYTLT 21535



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 2/77 (2%)

Query: 4163  EMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVN 4222
             E+ K    R G S  +     G P P +TW +     +   K Q E+     QL I + +
Sbjct: 24029 ELRKGIVVRAGGSARIHIPFKGRPTPEITWSREEG--EFTDKVQIEKGVNYTQLSIDNCD 24086

Query: 4223  SQDSGKYKCVAENNSGA 4239
               D+GKY    EN+SG+
Sbjct: 24087 RNDAGKYILKLENSSGS 24103



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 28/101 (27%), Positives = 42/101 (41%), Gaps = 3/101 (2%)

Query: 1456  KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSL 1515
             KP   L   +F     +  + D+   GRP     W  DGQ +  + T   V       SL
Sbjct: 25394 KPSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTL-KETTRVNVSSSKTVTSL 25452

Query: 1516  IIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKP 1556
              I  A+  D G + +   N AG  SI+V +T+  ++    P
Sbjct: 25453 SIKEASKEDVGTYELCVSNSAG--SITVPITIIVLDRPGPP 25491



 Score = 34.7 bits (78), Expect = 2.7
 Identities = 35/124 (28%), Positives = 52/124 (41%), Gaps = 18/124 (14%)

Query: 1527  EWTVVAQNRAGRSSI-SVILTVEAVEHQVKPMF-VEKLKN--VNIKEGSRLEMKVRATGN 1582
             E+ V A+N AG S       +V   E Q++P   +  + N  +  K GS   + V  +G 
Sbjct: 28615 EFRVKAKNDAGYSEPREAFSSVIIKEPQIEPTADLTGITNQLITCKAGSPFTIDVPISGR 28674

Query: 1583  PNPDIVW------LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKA 1636
             P P + W      LK +D        ++ I  TK    L +  ++  DS  Y  T  N A
Sbjct: 28675 PAPKVTWKLEEMRLKETD--------RVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTA 28726

Query: 1637  GRDT 1640
             G  T
Sbjct: 28727 GVKT 28730



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 23/73 (31%), Positives = 30/73 (41%), Gaps = 3/73 (4%)

Query: 5528  GTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCV 5587
             G       +V G P PT  W K+   +   R  ++  GT    L I   ++ D G Y   
Sbjct: 15119 GKTLRIPAVVTGRPVPTKVWTKEEGELDKDRVVIDNVGTK-SELIIKDALRKDHGRYVIT 15177

Query: 5588  ATNKSGMAESFAA 5600
             ATN  G    FAA
Sbjct: 15178 ATNSCG--SKFAA 15188



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 159/825 (19%), Positives = 288/825 (34%), Gaps = 117/825 (14%)

Query: 2453  DVNVIEGTKAVLECKVSVP------DVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINR 2506
             DV +IEG        V  P       V + KW  +  +IK D+            L I  
Sbjct: 17513 DVKLIEGLVVKAGTTVRFPAIIRGVPVPTAKWTTDGSEIKTDEHYTVETDNFSSVLTIKN 17572

Query: 2507  THASDEGPYKLIVGRVETNCNLSVEKIKI-IRG-------LRDLTCTETQNVVFEVELSH 2558
                 D G Y++ V     +  ++V    + + G       + D+T  E   + ++     
Sbjct: 17573 CLRRDTGEYQITVSNAAGSKTVAVHLTVLDVPGPPTGPINILDVT-PEHMTISWQPPKDD 17631

Query: 2559  SGIDVLWNFKDKEIKPSSKYKIEAHGKIY-KLTVLNMMKDDEGKYTFYAGENMTSGKL-- 2615
              G  V+    +K+      + + + G    KL + ++ K  E  +   A   +  G    
Sbjct: 17632 GGSPVINYIVEKQDTRKDTWGVVSSGSSKTKLKIPHLQKGCEYVFRVRAENKIGVGPPLD 17691

Query: 2616  ---TVAGGAISKP-------LTDQTV-----------AESQEAVFECEVANPDSKGEWLR 2654
                TVA    S P       +TD T            ++    +    +   +  G+W+R
Sbjct: 17692 STPTVAKHKFSPPSPPGKPVVTDITENAATVSWTLPKSDGGSPITGYYMERREVTGKWVR 17751

Query: 2655  DGKH--LPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKT 2712
               K     L   +    +G+     + A  L  + + +      K    +K     I   
Sbjct: 17752 VNKTPIADLKFRVTGLYEGNTYEFRVFAENLAGLSKPSPSSDPIKACRPIKPPGPPINPK 17811

Query: 2713  LKNLTVTETQDAVFT--------------VELTHPNVKGVQWI---KNGVVLESNEKYAI 2755
             LK+ +  ET D V+T              VE   P     QW    K+ ++ +   +   
Sbjct: 17812 LKDKS-RETADLVWTKPLSDGGSPILGYVVECQKPGT--AQWNRINKDELIRQCAFRVPG 17868

Query: 2756  SVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDV-TALENATVAF 2814
              ++G  Y  RIK   IV E         + A   LH   V++    +DV T     T+  
Sbjct: 17869 LIEGNEYRFRIKAANIVGEGEPRELAESVIAKDILHPPEVELDVTCRDVITVRVGQTIRI 17928

Query: 2815  EVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEY--TAVVGQL 2871
                V     P + W  +   +    +  L+ +    +L ++    +D G+Y  +A     
Sbjct: 17929 LARVKGRPEPDITWTKEGKVLVREKRVDLIQDLPRVELQIKEAVRADHGKYIISAKNSSG 17988

Query: 2872  ECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEI--------EM 2923
               +    V  L      +N++V  T      C +S  N        G EI        + 
Sbjct: 17989 HAQGSAIVNVLDRPGPCQNLKV--TNVTKENCTISWENPLD---NGGSEITNFIVEYRKP 18043

Query: 2924  SEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV---TPIMITSMLKDINA 2980
             ++K   +V   + + +I      ++  Y  VC  ++V    T+   TPI+  + + D   
Sbjct: 18044 NQKGWSIVASDVTKRLIKANLLANNEYYFRVCAENKVGVGPTIETKTPILAINPI-DRPG 18102

Query: 2981  EEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTF 3040
             E ++    +    +  +  KW +   +  S +      ++L  S +   VH G   +  +
Sbjct: 18103 EPENLHIADKGKTF--VYLKWRRPDYDGGSPNLSYHVERRLKGSDDWERVHKGSIKETHY 18160

Query: 3041  VAGKATSTATL--------------YVEARHI----EFRKHIKDIK---VLEKKRA---M 3076
             +  +                     +V+   +    + +K + D+K   VL  K      
Sbjct: 18161 MVDRCVENQIYEFRVQTKNEGGESDWVKTEEVVVKEDLQKPVLDLKLSGVLTVKAGDTIR 18220

Query: 3077  FECEV-SEPDITVQWMKDDQELQIT--DRIKIQKEKYVHRLLIPSTRMSDAGKYTV---- 3129
              E  V  +P   V W KD     +T   R+KI       +  +   + SD GKY V    
Sbjct: 18221 LEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGKYVVTATN 18280

Query: 3130  VAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDD 3174
              AG  V+ A + V  +   +R++K  +  +   R  V ++  EDD
Sbjct: 18281 TAGSFVAYATVNVLDKPGPVRNLK--IVDVSSDRCTVCWDPPEDD 18323



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 5/71 (7%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVP-ATPSDSGEWT 1529
             G + R  + + GRP PE  W  D   + N    +  I+   + +L+I+P     D+G++ 
Sbjct: 20791 GLSIRIFVPIKGRPAPEVTWTKDNINLKN----RANIENTESFTLLIIPECNRYDTGKFV 20846

Query: 1530  VVAQNRAGRSS 1540
             +  +N AG+ S
Sbjct: 20847 MTIENPAGKKS 20857



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 31/110 (28%), Positives = 45/110 (40%), Gaps = 16/110 (14%)

Query: 1058  ESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLV---EGGSVVFGCQVGGNPKPHVY 1114
             ESR V++ + ++            P    + + QKLV    G ++     V G PKP V 
Sbjct: 21050 ESRPVIVKEQTML-----------PELDLRGIYQKLVIAKAGDNIKVEIPVLGRPKPTVT 21098

Query: 1115  WKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGE 1164
             WKK    L    R  V++        L I+     D+G Y +  RN  GE
Sbjct: 21099 WKKGDQILKQTQR--VNFETTATSTILNINECVRSDSGPYPLTARNIVGE 21146



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 35/119 (29%), Positives = 52/119 (43%), Gaps = 13/119 (10%)

Query: 1527  EWTVVAQNRAGRSS--------ISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVR 1578
             E+ V+A+N AG  S        I+    VEA + +V   F +    V +K G    ++  
Sbjct: 21428 EFRVIAKNAAGAISPPSEPSDAITCRDDVEAPKIKVDVKFKD---TVILKAGEAFRLEAD 21484

Query: 1579  ATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAG 1637
              +G P P + W K+   +      +I+I         K DST  +DS  YT TA N  G
Sbjct: 21485 VSGRPPPTMEWSKDGKELEGTAKLEIKIADFSTNLVNK-DST-RRDSGAYTLTATNPGG 21541



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 24/88 (27%), Positives = 40/88 (45%)

Query: 3233  VNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQ 3292
             V AP+    ++    V +++G+  R  A +SGRP P + W K+ + L    K +      
Sbjct: 21456 VEAPKIKVDVKFKDTVILKAGEAFRLEADVSGRPPPTMEWSKDGKELEGTAKLEIKIADF 21515

Query: 3293  EYTLLLIEAFPEDAAVYTCEAKNDYGVA 3320
                L+  ++   D+  YT  A N  G A
Sbjct: 21516 STNLVNKDSTRRDSGAYTLTATNPGGFA 21543



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 34/155 (21%), Positives = 59/155 (38%), Gaps = 7/155 (4%)

Query: 1238  TYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDI-SESEAVESGFDSR 1296
             T + D  F ++   E      E+R+I      +  E  E   A+    E +      D +
Sbjct: 22491 TNIIDTHFEVTGLVED--HRYEFRVIARNAAGVFSEPSESTGAITARDEVDPPRISMDPK 22548

Query: 1297  IKNYRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVL 1355
              K+  ++  G        + G P+P I W K  + + +  R ++    D   SL +   +
Sbjct: 22549 YKDTIVVHAGESFKVDADIYGKPIPTIQWIKGDQELSNTARLEIK-STDFATSLSVKDAV 22607

Query: 1356  PEDEGIYTAFASNIKG--NAICSGKLYVEPAAPLG 1388
               D G Y   A N+ G  +   + K+   P  P G
Sbjct: 22608 RVDSGNYILKAKNVAGERSVTVNVKVLDRPGPPEG 22642



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 40/200 (20%), Positives = 75/200 (37%), Gaps = 17/200 (8%)

Query: 3239  PQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3298
             P V        V++ +  +      GRPQ  ++W K+ Q L    +          +L +
Sbjct: 25395 PSVELPFHTFNVKAREQLKIDVPFKGRPQATVNWRKDGQTLKETTRVNVSSSKTVTSLSI 25454

Query: 3299  IEAFPEDAAVYTCEAKNDYGVATTSASLSVEVP-EVVSPDQEMPVYPPAIITPLQDTVTS 3357
              EA  ED   Y     N  G        S+ VP  ++  D+  P  P  I     D++T 
Sbjct: 25455 KEASKEDVGTYELCVSNSAG--------SITVPITIIVLDRPGPPGPIRIDEVSCDSITI 25506

Query: 3358  EGQPARFQ--CRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYT 3415
                P  +   C++S      ++  + K+   + +  ++Q      ++I       E  + 
Sbjct: 25507 SWNPPEYDGGCQIS------NYIVEKKETTSTTWHIVSQAVARTSIKIVRLTTGSEYQFR 25560

Query: 3416  FVASNAVGQVSSTANLSLEA 3435
               A N  G+ S + + ++ A
Sbjct: 25561 VCAENRYGKSSYSESSAVVA 25580



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 23/101 (22%), Positives = 46/101 (45%), Gaps = 2/101 (1%)

Query: 2370  GDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFT 2428
             G+++++   ++   +  + W KDG E++   R  I+      +L ++D  + D G Y  T
Sbjct: 25804 GEVLKINADIAGRPLPVISWAKDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLT 25863

Query: 2429  IPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVS 2469
             +  +  + S  V+   +D   P      I G  A  +C +S
Sbjct: 25864 LKNVAGTRSVAVNCKVLDKPGPPAGPLEINGLTAE-KCSLS 25903



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 24/110 (21%), Positives = 48/110 (43%), Gaps = 1/110 (0%)

Query: 3233  VNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQ 3292
             + APE    +     V  ++G+  +      GRP P ++W K+E+ L +  +    +   
Sbjct: 27266 LEAPEIDLDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNLGSDARYSIENTDS 27325

Query: 3293  EYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPV 3342
                L + +    D   Y    +N  G    S+++SV+V +  +  Q++ V
Sbjct: 27326 SSLLTIPQVTRNDTGKYILTIENGVG-EPKSSTVSVKVLDTPAACQKLQV 27374



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 28/108 (25%), Positives = 41/108 (37%), Gaps = 17/108 (15%)

Query: 2388  WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIP-ALGLSTSGRVSVYSVD 2446
             W KD + +    R  I     S +L I  +T+ D G Y  TI   +G   S  VSV  +D
Sbjct: 27305 WRKDEKNLGSDARYSIENTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLD 27364

Query: 2447  ----------------VITPLKDVNVIEGTKAVLECKVSVPDVTSVKW 2478
                              +T L D  +I+G   ++   +   D T   W
Sbjct: 27365 TPAACQKLQVKHVSRGTVTLLWDPPLIDGGSPIINYVIEKRDATKRTW 27412



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 2089  VGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSAS 2148
             +  G     +  V G+P P   W+K+GV+IE+   +           L +RD T +    
Sbjct: 27970 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNME-ITDVLGSTSLFVRDATRDHRGV 28028

Query: 2149  IMVKAINIAGETSSHAFLLVQ 2169
               V+A N +G   +   + VQ
Sbjct: 28029 YTVEAKNASGSAKAEIKVKVQ 28049



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 7/84 (8%)

Query: 5204  VEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVNIIGE 5263
             V + G P P V W   +  L+  +R+ +    +  +L + +  +G+ G Y     N  G 
Sbjct: 28669 VPISGRPAPKVTWKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLENTAG- 28727

Query: 5264  AKSFANVDIMPQEERVVALPPPVT 5287
              K+F+   +      V+  P PVT
Sbjct: 28728 VKTFSVTVV------VIGRPGPVT 28745



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 33/142 (23%), Positives = 54/142 (38%), Gaps = 6/142 (4%)

Query: 1238  TYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAV-ESGFDSR 1296
             T V D  F +++  E      E+R++      ++ +  E    V   +  A  ++  D+R
Sbjct: 28994 TIVSDNFFTVTALSEG--DTYEFRVLAKNAAGVISKGSESTGPVTCRDEYAPPKAELDAR 29051

Query: 1297  IKN--YRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVV 1354
             +      I  G  +     + G P PKI W K  K +   E+  + +    RA+  I   
Sbjct: 29052 LHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLCEKVSLQY-TGKRATAVIKFC 29110

Query: 1355  LPEDEGIYTAFASNIKGNAICS 1376
                D G YT    N  G    S
Sbjct: 29111 DRSDSGKYTLTVKNASGTKAVS 29132



 Score = 34.3 bits (77), Expect = 3.6
 Identities = 31/146 (21%), Positives = 58/146 (39%), Gaps = 15/146 (10%)

Query: 3083  EPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA--GGNVSTAKL 3140
             +P+  + W K D+EL + +++ +Q        +I     SD+GKYT+            +
Sbjct: 29074 KPEPKIIWTKGDKELDLCEKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSV 29133

Query: 3141  FVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHK----- 3195
              V+  D      K  V  + +++  + + + ++D        G EI   + ER +     
Sbjct: 29134 MVKVLDSPGPCGKLTVSRVTQEKCTLAWSLPQED-------GGAEITHYIVERRETSRLN 29186

Query: 3196  -YVVERRIHRMFISETRQSDAGEYTF 3220
               +VE     +    TR     EY F
Sbjct: 29187 WVIVEGECPTLSYVVTRLIKNNEYIF 29212



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 46/185 (24%), Positives = 71/185 (38%), Gaps = 15/185 (8%)

Query: 4     QAPT-FTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFS-DG 61
             +APT F + L+   V E   A F   +S      V W+R+G+ I      G +  F  DG
Sbjct: 12820 EAPTEFVEHLEDQTVTEFDDAVFSCQLSREKA-NVKWYRNGREIKE----GKKYKFEKDG 12874

Query: 62    RA-KLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120
                +L I      +   Y+     G     S A L V  E  P   ++  Q +    G+ 
Sbjct: 12875 SIHRLIIKDCRLDDECEYAC----GVEDRKSRARLFV--EEIPVEIIRPPQDILEAPGAD 12928

Query: 121   VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
             V     +      V ++ R+   +      Q+  EG ++ L I +  P D G Y   A +
Sbjct: 12929 VVFLAELNKDKVEV-QWLRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKD 12987

Query: 181   SVGRA 185
                RA
Sbjct: 12988 KEARA 12992



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 2/93 (2%)

Query: 3084  PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVE 3143
             P  T  W   D+ L+  DR+K++       L+I  +  SD G YT+     V T    ++
Sbjct: 13422 PRPTATWCFGDKVLETGDRVKMKTLSAYAELVISPSERSDKGIYTLKLENRVKTISGEID 13481

Query: 3144  GRDVRIRSIKKEVQV--IEKQRAVVEFEVNEDD 3174
                +   S  KE++   I K    + +E  +DD
Sbjct: 13482 VNVIARPSAPKELKFGDITKDSVHLTWEPPDDD 13514



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 33/122 (27%), Positives = 53/122 (43%), Gaps = 23/122 (18%)

Query: 3237  EPPQVLQELQP---VTVQSGKPARFCAVISGRPQPKISWY---KEEQLLSTGFKCKFLHD 3290
             E P+V  ++     +  ++G   R  AVI GRP PK SW    K ++ +  G     +HD
Sbjct: 15806 EEPEVFIDIGAQDCLVCKAGSQIRIPAVIKGRPTPKSSWEFDGKAKKAMKDG-----VHD 15860

Query: 3291  GQE----------YTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEM 3340
               E            +++ E        Y+  AKN  G  T  A+  V+V +V  P +++
Sbjct: 15861 IPEDAQLETAENSSVIIIPECKRSHTGKYSITAKNKAGQKT--ANCRVKVMDVPGPPKDL 15918

Query: 3341  PV 3342
              V
Sbjct: 15919 KV 15920



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 25/97 (25%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 2253  NVKTTAKLIVE-GAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGK 2311
             +VK    L+V+ G  V F   ++ + VP +                KW  +  E+K++  
Sbjct: 17513 DVKLIEGLVVKAGTTVRFPAIIRGVPVPTA----------------KWTTDGSEIKTDEH 17556

Query: 2312  YTITSRRGRQNLTVKDVTKEDQGEYSFVID---GKKT 2345
             YT+ +      LT+K+  + D GEY   +    G KT
Sbjct: 17557 YTVETDNFSSVLTIKNCLRRDTGEYQITVSNAAGSKT 17593



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 5399  FKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNC 5458
             F   + G+P P  KW  +   I+ D   Y +  +  S  L I+N    D+  Y+    N 
Sbjct: 17530 FPAIIRGVPVPTAKWTTDGSEIKTDE-HYTVETDNFSSVLTIKNCLRRDTGEYQITVSNA 17588

Query: 5459  VGEAICRGFLTMGD 5472
              G       LT+ D
Sbjct: 17589 AGSKTVAVHLTVLD 17602



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 4171  REGDSIILECLISGEPQPVVTWF--QNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGK 4228
             + GD+I LE  + G+P P V W   ++   L ++ + + +    S +  +      D GK
Sbjct: 18214 KAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRSDGGK 18273

Query: 4229  YKCVAENNSGAVESVSDLTV 4248
             Y   A N +G+  + + + V
Sbjct: 18274 YVVTATNTAGSFVAYATVNV 18293



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 2/67 (2%)

Query: 4182  ISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCVAENNSGAVE 4241
             I G P P V W ++    +   K   E  +    L + +VN  DSGKY    EN+SG+  
Sbjct: 21884 IKGRPAPEVKWARDHG--ESLDKASIESTSSYTLLIVGNVNRFDSGKYILTVENSSGSKS 21941

Query: 4242  SVSDLTV 4248
             +  ++ V
Sbjct: 21942 AFVNVRV 21948



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 6/87 (6%)

Query: 4158  PKMLQEMPKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQN-QKFQFEEVNCSHQL 4216
             PK    +  HA    G++ +LE  I G+P P V W ++G  L++   + + +       L
Sbjct: 24711 PKYKDVIVVHA----GETFVLEADIRGKPIPDVVWSKDGKELEETAARMEIKSTIQKTTL 24766

Query: 4217  YIKDVNSQDSGKYKCVAENNSGAVESV 4243
              +KD    D G+Y  +  +N G  +S+
Sbjct: 24767 VVKDCIRTDGGQY-ILKLSNVGGTKSI 24792



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 7/117 (5%)

Query: 1273  EDGEEKMAVDISESEAVESGFDSRIKNYRILE-GMGVTFHCKMSGYPLPKIAWYKDGKRI 1331
             E  E   A DI E+  ++   D  ++   I + G  V       G P P + W KD K +
Sbjct: 27255 EMNEPVQAKDILEAPEID--LDVALRTSVIAKAGEDVQVLIPFKGRPPPTVTWRKDEKNL 27312

Query: 1332  KHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG---NAICSGKLYVEPAA 1385
                 RY ++   D  + L IP V   D G Y     N  G   ++  S K+   PAA
Sbjct: 27313 GSDARYSIE-NTDSSSLLTIPQVTRNDTGKYILTIENGVGEPKSSTVSVKVLDTPAA 27368



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 27/110 (24%), Positives = 41/110 (37%), Gaps = 9/110 (8%)

Query: 1058  ESRDVVMTDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKK 1117
             +S  ++MT     +E   P     P +    +++    G S+     V G P P V W K
Sbjct: 27942 QSSGIIMT----RDENVPPIVEFGPEYFDGLIIKS---GESLRIKALVQGRPVPRVTWFK 27994

Query: 1118  SGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSA 1167
              GV +    R  +      G   L +     D  G YT+  +N  G   A
Sbjct: 27995 DGVEIEK--RMNMEITDVLGSTSLFVRDATRDHRGVYTVEAKNASGSAKA 28042



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 20/80 (25%), Positives = 33/80 (41%)

Query: 3955  VYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSI 4014
             +  G+S       QG P P VTW+ + + I +  N  I  +   + L +      + G  
Sbjct: 27970 IKSGESLRIKALVQGRPVPRVTWFKDGVEIEKRMNMEITDVLGSTSLFVRDATRDHRGVY 28029

Query: 4015  TCVLFNQYGTVKTTSMLKVK 4034
             T    N  G+ K    +KV+
Sbjct: 28030 TVEAKNASGSAKAEIKVKVQ 28049



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 23/92 (25%), Positives = 38/92 (41%), Gaps = 4/92 (4%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             Q+ VV  G++        G P P   W +    +S        I  +D  + LT+    +
Sbjct: 28365 QTHVVRAGASIRLFIAYQGRPTPTAVWSKPDSNLSLRA----DIHTTDSFSTLTVENCNR 28420

Query: 73    ANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
              ++G+Y+L   N SG  + T  + V     PP
Sbjct: 28421 NDAGKYTLTVENNSGSKSITFTVKVLDTPGPP 28452



 Score = 33.9 bits (76), Expect = 4.7
 Identities = 23/78 (29%), Positives = 35/78 (44%), Gaps = 11/78 (14%)

Query: 1471  GQTARFDLKVVGRPMPETFWFHDGQQI-----VNDYTHKVVIKEDGTQSLIIVPATPSDS 1525
             G+     + + GRP P   WF  G ++     V   TH  V K      L I   T  D+
Sbjct: 29753 GRPVELVIPIAGRPPPAASWFFAGSKLRESERVTVETHTKVAK------LTIRETTIRDT 29806

Query: 1526  GEWTVVAQNRAGRSSISV 1543
             GE+T+  +N  G +S ++
Sbjct: 29807 GEYTLELKNVTGTTSETI 29824



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 11/107 (10%)

Query: 5200  LGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGNVCSLEISNIQKGEGGEYMCHAVN 5259
             L  +V  +  P    +W++     EP     ++      S  I   +KG+ G Y     N
Sbjct: 13017 LTMVVPYDAYPKAEAEWFKEN---EPLSTKTIDTTAEQTSFRILEAKKGDKGRYKIVLQN 13073

Query: 5260  IIGEAKSFANVDIMPQEERVVALPPPVTHQHVME-FDLEHTTSSRTP 5305
               G+A+ F N+       +V+ +P PV +  V E FD E + +   P
Sbjct: 13074 KHGKAEGFINL-------KVIDVPGPVRNLEVTETFDGEVSLAWEEP 13113



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%)

Query: 4173  GDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCV 4232
             G ++ +  +++G P P   W +    L ++ +   + V    +L IKD   +D G+Y   
Sbjct: 15119 GKTLRIPAVVTGRPVPTKVWTKEEGELDKD-RVVIDNVGTKSELIIKDALRKDHGRYVIT 15177

Query: 4233  AENNSGA 4239
             A N+ G+
Sbjct: 15178 ATNSCGS 15184



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 33/134 (24%), Positives = 63/134 (47%), Gaps = 19/134 (14%)

Query: 2324  TVKDVTKEDQGEYSFVI-----DGKKTTCKLKMKPR-----PIAILQGLSDQKVC----E 2369
             + KD+T+    EY+F +     +G+ T  ++ +  R     P   L+GL D  +C    E
Sbjct: 19941 SAKDLTEGK--EYTFRVSAENENGEGTPSEITVVARDDVVAPDLDLKGLPD--LCYLAKE 19996

Query: 2370  GDIVQLEVKVSLESVEGVWMKDGQEVQPSD-RVHIVIDKQSHMLLIEDMTKEDAGNYSFT 2428
                 +L++ +  +    V  K G++   +D RV +     +  L++ D  K DAG Y+ T
Sbjct: 19997 NSNFRLKIPIKGKPAPSVSWKKGEDPLATDTRVSVESSAVNTTLIVYDCQKSDAGKYTIT 20056

Query: 2429  IPALGLSTSGRVSV 2442
             +  +  +  G +S+
Sbjct: 20057 LKNVAGTKEGTISI 20070



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 1/87 (1%)

Query: 1461  LKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPA 1520
             L  + +   E    R  + + G+P P   W      +  D T   V       +LI+   
Sbjct: 19987 LPDLCYLAKENSNFRLKIPIKGKPAPSVSWKKGEDPLATD-TRVSVESSAVNTTLIVYDC 20045

Query: 1521  TPSDSGEWTVVAQNRAGRSSISVILTV 1547
               SD+G++T+  +N AG    ++ + V
Sbjct: 20046 QKSDAGKYTITLKNVAGTKEGTISIKV 20072



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 3374  KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVG 3423
             K SW    K I+PS   ++T    +  L I  A  +D G YT  A+N  G
Sbjct: 20410 KSSWSKAGKDIRPSDITQITSTPTSSMLTIKYATRKDAGEYTITATNPFG 20459



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 42/155 (27%), Positives = 58/155 (37%), Gaps = 34/155 (21%)

Query: 5440  IRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSN 5499
             +RN+   +  T++  AVN  G +  R        E   VI K+      +++ EL L+  
Sbjct: 21024 VRNLTEGEEYTFQVMAVNSAGRSAPR--------ESRPVIVKEQ-----TMLPELDLRGI 21070

Query: 5500  YTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYK-DGKLVQGRR 5558
             Y                        A  G     +  V G P+PTV W K D  L Q +R
Sbjct: 21071 YQKLVI-------------------AKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQR 21111

Query: 5559  FTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSG 5593
                E + T    L I   V+SD G Y   A N  G
Sbjct: 21112 VNFETTATS-TILNINECVRSDSGPYPLTARNIVG 21145



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 6/94 (6%)

Query: 1456  KPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSL 1515
             KP F     S+    GQ  + ++ + GRP P   W  DG  +       V    D T +L
Sbjct: 23233 KPAFS----SYSVQVGQDLKIEVPISGRPKPTITWTKDGLPLKQTTRINVTDSLDLT-TL 23287

Query: 1516  IIVPATPSDSGEWTVVAQNRAGRSSISV-ILTVE 1548
              I      D G++ +   N  G+ + S+ I+T++
Sbjct: 23288 SIKETHKDDGGQYGITVANVVGQKTASIEIVTLD 23321



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 24/96 (25%), Positives = 46/96 (47%), Gaps = 3/96 (3%)

Query: 3048  TATLYVEARHIEFRKHIKDIKVLEKKRAM-FECEV-SEPDITVQWMKDDQELQITDRIKI 3105
             TA   VE   I      +D  V+        E +V  +P  T++W++ D+E++ + R +I
Sbjct: 23615 TAKDEVELPRISMDPKFRDTIVVNAGETFRLEADVHGKPLPTIEWLRGDKEIEESARCEI 23674

Query: 3106  QKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLF 3141
             +   +   L++      D G+Y ++   NV+ +K F
Sbjct: 23675 KNTDFKALLIVKDAIRIDGGQY-ILRASNVAGSKSF 23709



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 31/135 (22%), Positives = 57/135 (42%), Gaps = 16/135 (11%)

Query: 2241  AEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWY 2300
             +E    ++V+D+       + V+   V  VK  + +++    +G    ++S       W 
Sbjct: 25772 SESTGPIIVKDDVEPPRVMMDVKFRDVIVVKAGEVLKINADIAGRPLPVIS-------WA 25824

Query: 2301  HNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTT------CKLKMKPR 2354
              + +E++   +  I S      LTVKD  + D G+Y   +     T      CK+  KP 
Sbjct: 25825 KDGIEIEERARTEIISTDNHTLLTVKDCIRRDTGQYVLTLKNVAGTRSVAVNCKVLDKPG 25884

Query: 2355  PIA---ILQGLSDQK 2366
             P A    + GL+ +K
Sbjct: 25885 PPAGPLEINGLTAEK 25899



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 2/70 (2%)

Query: 1107  GNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHGETS 1166
             G P P V W+K    L +  RY +     +    L I     +D G+Y + + N  GE  
Sbjct: 27297 GRPPPTVTWRKDEKNLGSDARYSIENTDSSS--LLTIPQVTRNDTGKYILTIENGVGEPK 27354

Query: 1167  ASASLLEEAD 1176
             +S   ++  D
Sbjct: 27355 SSTVSVKVLD 27364



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 29/99 (29%), Positives = 38/99 (38%), Gaps = 11/99 (11%)

Query: 1305  GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTA 1364
             G  V       G P P I+W KDG  +K  E  +     + + +L I     E  G YT 
Sbjct: 27578 GHNVHLELPYKGKPKPSISWLKDGLPLKESEFVRFS-KTENKITLSIKNAKKEHGGKYTV 27636

Query: 1365  FASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIR 1403
                 I  NA+C        A P+   T  P  +P   IR
Sbjct: 27637 ----ILDNAVC------RIAVPITVITLGPPSKPKGPIR 27665



 Score = 33.5 bits (75), Expect = 6.1
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 2299  WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVID 2341
             W   ++ LK   + +IT+ + R  LTVKD  + D G Y   ++
Sbjct: 28681 WKLEEMRLKETDRVSITTTKDRTTLTVKDSMRGDSGRYFLTLE 28723



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 3/83 (3%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKAN 74
             + ++ G T    A ++G PVP   W ++   +       V I     +++L I    + +
Sbjct: 15114 IQIMAGKTLRIPAVVTGRPVPTKVWTKEEGELDKDR---VVIDNVGTKSELIIKDALRKD 15170

Query: 75    SGRYSLKATNGSGQATSTAELLV 97
              GRY + ATN  G   + A + V
Sbjct: 15171 HGRYVITATNSCGSKFAAARVEV 15193



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 5/78 (6%)

Query: 1465  SFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQS-----LIIVP 1519
             + K   G+       V G PMP+  W  +   I        + KE+ ++S     L I  
Sbjct: 15407 TIKVKAGEPVHIPADVTGLPMPKIEWSKNETVIEKPTDALQITKEEVSRSEAKTELSIPK 15466

Query: 1520  ATPSDSGEWTVVAQNRAG 1537
             A   D G +TV A NR G
Sbjct: 15467 AVREDKGTYTVTASNRLG 15484



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 6/79 (7%)

Query: 15    VVVLEGSTATFEAHISGFPVPEVSWFRDGQVI-STSTLPGVQISFSDGRAKLTIPAVTKA 73
             +VV  G      A++SG P P V+W  + + +   +T+    IS S     + I    ++
Sbjct: 16534 IVVHAGGVIRIIAYVSGKPPPTVTWNMNERTLPQEATIETTAISSS-----MVIKNCQRS 16588

Query: 74    NSGRYSLKATNGSGQATST 92
             + G YSL A N +G+   T
Sbjct: 16589 HQGVYSLLAKNEAGERKKT 16607



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 19/79 (24%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 3955  VYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHHQNEGSI 4014
             V+ G     + +  G P P VTW  N+  +P  Q   I +    S + + +    ++G  
Sbjct: 16536 VHAGGVIRIIAYVSGKPPPTVTWNMNERTLP--QEATIETTAISSSMVIKNCQRSHQGVY 16593

Query: 4015  TCVLFNQYGTVKTTSMLKV 4033
             + +  N+ G  K T ++ V
Sbjct: 16594 SLLAKNEAGERKKTIIVDV 16612



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 10/144 (6%)

Query: 3190  VQERHKYVVERRIHRMFISETR---QSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQ 3246
             ++E H Y+V+R +    I E R   +++ GE  +V       V +  +  +P   L+   
Sbjct: 18155 IKETH-YMVDRCVENQ-IYEFRVQTKNEGGESDWV---KTEEVVVKEDLQKPVLDLKLSG 18209

Query: 3247  PVTVQSGKPARFCAVISGRPQPKISWYKEEQL--LSTGFKCKFLHDGQEYTLLLIEAFPE 3304
              +TV++G   R  A + G+P P+++W K++    L+   + K           L +A   
Sbjct: 18210 VLTVKAGDTIRLEAGVRGKPFPEVAWTKDKDATDLTRSPRVKIDTRADSSKFSLTKAKRS 18269

Query: 3305  DAAVYTCEAKNDYGVATTSASLSV 3328
             D   Y   A N  G     A+++V
Sbjct: 18270 DGGKYVVTATNTAGSFVAYATVNV 18293



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 32/128 (25%), Positives = 52/128 (40%), Gaps = 7/128 (5%)

Query: 62    RAKLTIPAVTKANSGRYSLKATN--GSGQATSTAELLVKAETAPPNFVQRLQSMT----V 115
             R + T+ ++ +     + + A N  G G+     E +   E   P  +    SM     V
Sbjct: 18559 RKEFTVTSLDENQEYEFRVCAQNQVGIGRPAELKEAIKPKEILEPPEIDLDASMRKLVIV 18618

Query: 116   RQGSQVRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYS 175
             R G  +RL   V G P P V + + G +       Q+     +  L+I  +  +DSG YS
Sbjct: 18619 RAGCPIRLFAIVRGRPAPKVTWRKVGID-NVVRKGQVDLVDTMAFLVIPNSTRDDSGKYS 18677

Query: 176   VNATNSVG 183
             +   N  G
Sbjct: 18678 LTLVNPAG 18685



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 2914  WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV 2966
             W K+G  ++ +E  K+ +Q  L  L + + + +DS +YT    N   S + T+
Sbjct: 19329 WKKDGTLLKPAEGIKMAMQRNLCTLELFSVNRKDSGDYTITAENSSGSKSATI 19381



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 21/92 (22%), Positives = 40/92 (43%), Gaps = 2/92 (2%)

Query: 13    QSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTK 72
             +++++  G T      + G P P+++W +    ++     G+ I  +D    L    V K
Sbjct: 19701 KTLILRAGVTMRLYVPVKGRPPPKITWSKPN--VNLRDRIGLDIKSTDFDTFLRCENVNK 19758

Query: 73    ANSGRYSLKATNGSGQATSTAELLVKAETAPP 104
              ++G+Y L   N  G+   T  + V     PP
Sbjct: 19759 YDAGKYILTLENSCGKKEYTIVVKVLDTPGPP 19790



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 27/99 (27%), Positives = 43/99 (43%), Gaps = 8/99 (8%)

Query: 5402  SVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGE 5461
             S++G P P+  W K    I P +I  + S    S  L I+     D+  Y   A N  G 
Sbjct: 20402 SILGKPLPKSSWSKAGKDIRPSDITQITSTPTSS-MLTIKYATRKDAGEYTITATNPFGT 20460

Query: 5462  AICRGFLTM-------GDSEIFAVIAKKSKVTLSSLMEE 5493
              +    +T+       G  EI  V A+K+ +T +  +E+
Sbjct: 20461 KVEHVKVTVLDVPGPPGPVEISNVSAEKATLTWTPPLED 20499



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 20/89 (22%), Positives = 39/89 (43%), Gaps = 2/89 (2%)

Query: 3248  VTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAA 3307
             V  ++G   +    + GRP+P ++W K +Q+L    +  F        L + E    D+ 
Sbjct: 21075 VIAKAGDNIKVEIPVLGRPKPTVTWKKGDQILKQTQRVNFETTATSTILNINECVRSDSG 21134

Query: 3308  VYTCEAKNDYGVATTSASLSVEVPEVVSP 3336
              Y   A+N  G       ++++V ++  P
Sbjct: 21135 PYPLTARNIVG--EVGDVITIQVHDIPGP 21161



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 20/69 (28%), Positives = 31/69 (44%)

Query: 1729  IGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHT 1788
             IG P   + W+ DG+PL+   R+ +        L        D G  T  ATN  GT   
Sbjct: 24336 IGRPRPNISWVKDGEPLKQTTRVNVEETATSTVLHIKEGNKDDFGKYTVTATNSAGTATE 24395

Query: 1789  SATLIVKDE 1797
             + ++IV ++
Sbjct: 24396 NLSVIVLEK 24404



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 29/137 (21%), Positives = 57/137 (41%), Gaps = 7/137 (5%)

Query: 1516  IIVPATPSDSGEWTVVAQNRAGRSS-----ISVILTVEAVEHQVKPMFVEKLKNVNIKEG 1570
             II   T +   E+ V A+N  G  S     +  I  +++    V  + +E  + V  + G
Sbjct: 26828 IISGLTQNSQYEFRVFARNAVGSISNPSEVVGPITCIDSYGGPVIDLPLEYTEVVKYRAG 26887

Query: 1571  SRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTA 1630
             + ++++   +G P P I W K+   +  +    + +E T   A++ I      +S  Y  
Sbjct: 26888 TSVKLRAGISGKPAPTIEWYKDDKELQTNAL--VCVENTTDLASILIKDADRLNSGCYEL 26945

Query: 1631  TAINKAGRDTTRCKVNV 1647
                N  G  +   +V +
Sbjct: 26946 KLRNAMGSASATIRVQI 26962



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 25/93 (26%), Positives = 39/93 (41%), Gaps = 2/93 (2%)

Query: 1305  GMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTA 1364
             G  V     +SG P P I WYKD K ++      ++   D  AS+ I      + G Y  
Sbjct: 26887 GTSVKLRAGISGKPAPTIEWYKDDKELQTNALVCVENTTD-LASILIKDADRLNSGCYEL 26945

Query: 1365  FASNIKGNAICSGKLYV-EPAAPLGAPTYIPTL 1396
                N  G+A  + ++ + +   P G P    T+
Sbjct: 26946 KLRNAMGSASATIRVQILDKPGPPGGPIEFKTV 26978



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 35/145 (24%), Positives = 62/145 (42%), Gaps = 10/145 (6%)

Query: 1527  EWTVVAQNRAGRS-SISVILTVEAVEHQVKPMFV--EKLKNVNI-KEGSRLEMKVRATGN 1582
             ++ V A N AG+  S  V  T++AV+    P        K  ++ + G+ + + +   G 
Sbjct: 28325 KFRVSAINGAGKGDSCEVTGTIKAVDRLTAPELDIDANFKQTHVVRAGASIRLFIAYQGR 28384

Query: 1583  PNPDIVWLK-NSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTT 1641
             P P  VW K +S++ +     +  I  T   + L +++    D+  YT T  N +G  + 
Sbjct: 28385 PTPTAVWSKPDSNLSL-----RADIHTTDSFSTLTVENCNRNDAGKYTLTVENNSGSKSI 28439

Query: 1642  RCKVNVEVEFAEPEPERKLIIPRGT 1666
                V V      P P     + RG+
Sbjct: 28440 TFTVKVLDTPGPPGPITFKDVTRGS 28464



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 24/106 (22%), Positives = 45/106 (42%), Gaps = 5/106 (4%)

Query: 1829  TGVTTDQKEKQKP----DIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKS 1884
             TG  T + E   P    D  L+ + V +  G        V G P+PK+ W    + +   
Sbjct: 29032 TGPVTCRDEYAPPKAELDARLHGDLVTIRAGSDLVLDAAVGGKPEPKIIWTKGDKELDLC 29091

Query: 1885  KRFRVRYDGIHYLDIVD-CKSYDTGEVKVTAENPEGVIEHKVKLEI 1929
             ++  ++Y G     ++  C   D+G+  +T +N  G     V +++
Sbjct: 29092 EKVSLQYTGKRATAVIKFCDRSDSGKYTLTVKNASGTKAVSVMVKV 29137



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 44/209 (21%), Positives = 77/209 (36%), Gaps = 20/209 (9%)

Query: 1203  GETAPGFVYSEYEKEYEKEQALIRKK--MAKDTVVVRTYVEDQEFHISSFEERLIKEIEY 1260
             G    G+V    +   E+   ++  K  + + TV      E   F I +  E+ + E   
Sbjct: 29663 GSRLTGYVLEACKAGTERWMKVVTLKPTVLEHTVTSLNEGEQYLFRIRAQNEKGVSEPRE 29722

Query: 1261  RIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFHCKMSGYPLP 1320
              +   T+++L          +D+S             K   +  G  V     ++G P P
Sbjct: 29723 TVTAVTVQDL-----RVLPTIDLSTMPQ---------KTIHVPAGRPVELVIPIAGRPPP 29768

Query: 1321  KIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLY 1380
               +W+  G +++  ER  ++      A L I      D G YT    N+ G    + K+ 
Sbjct: 29769 AASWFFAGSKLRESERVTVE-THTKVAKLTIRETTIRDTGEYTLELKNVTGTTSETIKVI 29827

Query: 1381  V--EPAAPLGAPTYIPTLEPVSRIRSLSP 1407
             +  +P  P G P  I  ++  S   S  P
Sbjct: 29828 ILDKPGPPTG-PIKIDEIDATSITISWEP 29855



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 58/261 (22%), Positives = 104/261 (39%), Gaps = 33/261 (12%)

Query: 1171  LLEEADYELLMKSQQEM-LYQTQVTAFVQEPKV--GETAPGFVYSEYEKEYEKEQALIRK 1227
             LLE  +YE  + ++ E  L + + TA   + K+  GE APG       KE +     + +
Sbjct: 30495 LLEATEYEFRVFAENETGLSRPRRTAMSIKTKLTSGE-APGI-----RKEMKDVTTKLGE 30548

Query: 1228  KMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKT----TLEELLEEDGEEKMAVDI 1283
                    +V   + D +++   F + LI+  +Y++       TL  + EE  +E +   I
Sbjct: 30549 AAQLSCQIVGRPLPDIKWY--RFGKELIQSRKYKMSSDGRTHTLTVMTEEQEDEGVYTCI 30606

Query: 1284  SESEAVESGFDSRI---------------KNYRILEGMGVTFHCKMSGYPLPKIAWYKDG 1328
             + +E  E    S++               + Y    G  +  H    G P+P + W+   
Sbjct: 30607 ATNEVGEVETSSKLLLQATPQFHPGYPLKEKYYGAVGSTLRLHVMYIGRPVPAMTWFHGQ 30666

Query: 1329  KRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG--NAICSGKLYVEPAAP 1386
             K +++ E   ++  +     +   V      G Y    SN+ G  +AI   ++  +P  P
Sbjct: 30667 KLLQNSENITIENTEHYTHLVMKNVQRKTHAGKYKVQLSNVFGTVDAILDVEIQDKPDKP 30726

Query: 1387  LGAPTYIPTLEPVSRIRSLSP 1407
              G P  I  L   S + S  P
Sbjct: 30727 TG-PIVIEALLKNSAVISWKP 30746



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 37/149 (24%), Positives = 64/149 (42%), Gaps = 20/149 (13%)

Query: 3517  EGEPVVFTCRLIACP-TPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDS 3575
             EG  V + C++     + ++TW+   R +    +  I  E  +    + L +K +   D 
Sbjct: 31581 EGGHVKYVCKIENYDQSTQVTWYFGVRQLENSEKYEITYEDGV----AILYVKDITKLDD 31636

Query: 3576  GSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLKRAERTHENVEALVERGEDRIKVDL 3635
             G+YR   +N  G   S A L V  KG  E Y  + +R  +        ++R  D +++  
Sbjct: 31637 GTYRCKVVNDYGEDSSYAELFV--KGVREVYDYYCRRTMKK-------IKRRTDTMRLLE 31687

Query: 3636  R---FTGSPFNKKQDVEQK---GMMRTIH 3658
             R   FT   +NK   V +    G+  T+H
Sbjct: 31688 RPPEFTLPLYNKTAYVGENVRFGVTITVH 31716


>gi|110349715 titin isoform N2-B [Homo sapiens]
          Length = 26926

 Score = 6527 bits (16935), Expect = 0.0
 Identities = 3364/3622 (92%), Positives = 3414/3622 (94%), Gaps = 79/3622 (2%)

Query: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD 60
            MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD
Sbjct: 1    MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSD 60

Query: 61   GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120
            GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ
Sbjct: 61   GRAKLTIPAVTKANSGRYSLKATNGSGQATSTAELLVKAETAPPNFVQRLQSMTVRQGSQ 120

Query: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180
            VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN
Sbjct: 121  VRLQVRVTGIPTPVVKFYRDGAEIQSSLDFQISQEGDLYSLLIAEAYPEDSGTYSVNATN 180

Query: 181  SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV 240
            SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV
Sbjct: 181  SVGRATSTAELLVQGEEEVPAKKTKTIVSTAQISESRQTRIEKKIEAHFDARSIATVEMV 240

Query: 241  IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT 300
            IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT
Sbjct: 241  IDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKAQLARQQSPSPIRHSPSPVRHVRAPT 300

Query: 301  PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR 360
            PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR
Sbjct: 301  PSPVRSVSPAARISTSPIRSVRSPLLMRKTQASTVATGPEVPPPWKQEGYVASSSEAEMR 360

Query: 361  ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAKEVKQDA 420
            ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAK      
Sbjct: 361  ETTLTTSTQIRTEERWEGRYGVQEQVTISGAAGAAASVSASASYAAEAVATGAK------ 414

Query: 421  DKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVV 480
                                                         +V+++A+K+A    V
Sbjct: 415  ---------------------------------------------EVKQDADKSAAVATV 429

Query: 481  VAA-DKAKEQE----LKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQ 535
            VAA D A+ +E       +T +  TT    +    EQ+RKE EKT V KVV++A KAKEQ
Sbjct: 430  VAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQEQVRKEAEKTAVTKVVVAADKAKEQ 489

Query: 536  E--TRISEEITKKQKQ--VTQEAIRQETEITAASMVVVATAKSTKLETVPGAQEETTTQQ 591
            E  +R  E IT KQ+Q  VT E IR+ETE T    VV++ AK+ + ET     EE T +Q
Sbjct: 490  ELKSRTKEVITTKQEQMHVTHEQIRKETEKTFVPKVVISAAKAKEQET--RISEEITKKQ 547

Query: 592  DQMHLSYEKIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEA 651
             Q+  + E IMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEA
Sbjct: 548  KQV--TQEAIMKETRKTVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEA 605

Query: 652  EKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQ 711
            EKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQ
Sbjct: 606  EKTALSTIAVATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQ 665

Query: 712  ARVREPREPGHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQA 771
            ARVREPREPGHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQA
Sbjct: 666  ARVREPREPGHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQA 725

Query: 772  PSETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYE 831
            PSETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYE
Sbjct: 726  PSETHIKTTDQKGMHISSQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYE 785

Query: 832  ASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYK 891
            ASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYK
Sbjct: 786  ASIAGSAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYK 845

Query: 892  SEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKN 951
            SEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKN
Sbjct: 846  SEAGVEVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKN 905

Query: 952  VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSG 1011
            VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSG
Sbjct: 906  VTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSG 965

Query: 1012 RFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTE 1071
            RFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTE
Sbjct: 966  RFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTE 1025

Query: 1072 EQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVS 1131
            EQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVS
Sbjct: 1026 EQAGPGEPAAPYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVS 1085

Query: 1132 YNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQT 1191
            YNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQT
Sbjct: 1086 YNKQTGECKLVISMTFADDAGEYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQT 1145

Query: 1192 QVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFE 1251
            QVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFE
Sbjct: 1146 QVTAFVQEPKVGETAPGFVYSEYEKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFE 1205

Query: 1252 ERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFH 1311
            ERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFH
Sbjct: 1206 ERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESEAVESGFDSRIKNYRILEGMGVTFH 1265

Query: 1312 CKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1371
            CKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG
Sbjct: 1266 CKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKG 1325

Query: 1372 NAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPAR 1431
            NAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPAR
Sbjct: 1326 NAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPAR 1385

Query: 1432 MSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWF 1491
            MSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWF
Sbjct: 1386 MSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWF 1445

Query: 1492 HDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVE 1551
            HDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVE
Sbjct: 1446 HDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVE 1505

Query: 1552 HQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKG 1611
            HQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKG
Sbjct: 1506 HQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKG 1565

Query: 1612 EAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKE 1671
            EAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKE
Sbjct: 1566 EAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKE 1625

Query: 1672 IAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGD 1731
            IAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGD
Sbjct: 1626 IAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGD 1685

Query: 1732 PTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT 1791
            PTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT
Sbjct: 1686 PTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSAT 1745

Query: 1792 LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVR 1851
            LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVR
Sbjct: 1746 LIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVR 1805

Query: 1852 VLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVK 1911
            VLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVK
Sbjct: 1806 VLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGIHYLDIVDCKSYDTGEVK 1865

Query: 1912 VTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTT 1971
            VTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTT
Sbjct: 1866 VTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTT 1925

Query: 1972 ETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELL 2031
            ETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELL
Sbjct: 1926 ETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELL 1985

Query: 2032 RKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQ 2091
            RKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQ
Sbjct: 1986 RKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQ 2045

Query: 2092 GSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMV 2151
            GSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMV
Sbjct: 2046 GSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMV 2105

Query: 2152 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2211
            KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG
Sbjct: 2106 KAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDG 2165

Query: 2212 MEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVK 2271
            MEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVK
Sbjct: 2166 MEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVK 2225

Query: 2272 ELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKE 2331
            ELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKE
Sbjct: 2226 ELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKE 2285

Query: 2332 DQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKD 2391
            DQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKD
Sbjct: 2286 DQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKD 2345

Query: 2392 GQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL 2451
            GQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL
Sbjct: 2346 GQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPL 2405

Query: 2452 KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASD 2511
            KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASD
Sbjct: 2406 KDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASD 2465

Query: 2512 EGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKE 2571
            EGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKE
Sbjct: 2466 EGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKE 2525

Query: 2572 IKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTV 2631
            IKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTV
Sbjct: 2526 IKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTV 2585

Query: 2632 AESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTY 2691
            AESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTY
Sbjct: 2586 AESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTY 2645

Query: 2692 KVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNE 2751
            KVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNE
Sbjct: 2646 KVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNE 2705

Query: 2752 KYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENAT 2811
            KYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENAT
Sbjct: 2706 KYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENAT 2765

Query: 2812 VAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQL 2871
            VAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQL
Sbjct: 2766 VAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQL 2825

Query: 2872 ECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVV 2931
            ECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVV
Sbjct: 2826 ECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVV 2885

Query: 2932 QGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVT 2991
            QGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVT
Sbjct: 2886 QGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVT 2945

Query: 2992 VNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATL 3051
            VNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATL
Sbjct: 2946 VNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATL 3005

Query: 3052 YVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYV 3111
            YVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYV
Sbjct: 3006 YVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYV 3065

Query: 3112 HRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVN 3171
            HRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVN
Sbjct: 3066 HRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVN 3125

Query: 3172 EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL 3231
            EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL
Sbjct: 3126 EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTL 3185

Query: 3232 YVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDG 3291
            YVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDG
Sbjct: 3186 YVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDG 3245

Query: 3292 QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPL 3351
            QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPL
Sbjct: 3246 QEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPL 3305

Query: 3352 QDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDE 3411
            QDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDE
Sbjct: 3306 QDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDE 3365

Query: 3412 GTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKE-----LFSEGESEHSER 3466
            GTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKE     L +E E  HS  
Sbjct: 3366 GTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAE 3425

Query: 3467 DTRDAFSDSEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLEGEPVVFTCR 3526
                  +++ ++  +S     Y ++  S     E   P F ++++   +  G+    +  
Sbjct: 3426 LQLSKINETLELLSESPV---YPTKFDSEK---EGTGPIFIKEVSNADISMGDVATLSVT 3479

Query: 3527 LIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSE 3586
            +I  P P++ WF N   +          + D H    SL I   +  D G Y  +A N  
Sbjct: 3480 VIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDH----SLIILFTKLEDEGEYTCMASNDY 3535

Query: 3587 GSAESTASLLVIQKGQDEKYLE 3608
            G    +A L +  KG+  K  E
Sbjct: 3536 GKTICSAYLKINSKGEGHKDTE 3557



 Score =  652 bits (1681), Expect = 0.0
 Identities = 607/2311 (26%), Positives = 989/2311 (42%), Gaps = 301/2311 (13%)

Query: 1451 LERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED 1510
            +E   KP+FV K  +    EG      ++  G P P+  W  +   IV     K+ I+  
Sbjct: 1504 VEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGT 1563

Query: 1511 GTQSLIIVPATPSDSGEW-TVVAQNRAGRSSISVILTVEAV------------------- 1550
              ++ + + +T S    W T  A N+AGR +    + VE                     
Sbjct: 1564 KGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRA 1623

Query: 1551 ----------------------------EHQVKPMFVEKLKNVNIKEGSRLEMKVRAT-- 1580
                                        E Q KP F +KL ++ +K       + R T  
Sbjct: 1624 KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPI 1683

Query: 1581 GNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDT 1640
            G+P   + WL +   +      ++R+    G  +L      S+DS   T  A NK G D 
Sbjct: 1684 GDPTMVVEWLHDGKPLEAAN--RLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDH 1741

Query: 1641 TRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQ 1700
            T   + V+ E +  E  +   +P G    + I   ELE    R   E    G   D++++
Sbjct: 1742 TSATLIVKDEKSLVEESQ---LPEGRKGLQRIE--ELE----RMAHEGALTGVTTDQKEK 1792

Query: 1701 QKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYC 1760
            QKP        +R+     A F CR+T  G P   V W  +G+ +  + R R+  + G  
Sbjct: 1793 QKPDIVLYPEPVRVLEGETARFRCRVT--GYPQPKVNWYLNGQLIRKSKRFRVRYD-GIH 1849

Query: 1761 SLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELE 1820
             LD     S D+G +   A N  G         V + K  +E  Q  + R  L+R  E  
Sbjct: 1850 YLDIVDCKSYDTGEVKVTAENPEG---------VIEHKVKLEIQQREDFRSVLRRAPEPR 1900

Query: 1821 RMAHEGALTGVTTDQKEKQKP-DIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQ 1879
               H      +  + ++  +P D     E V++   E      R+T    P+ +  L  +
Sbjct: 1901 PEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAE------RITHEKVPEESEELRSK 1954

Query: 1880 LIRKSKRFRVRYDGIHYLDIVDCKSYDTGE-------------VKVTAENPEGVIEHKVK 1926
              R+++     Y+ I  +++   K  ++ E              K   E  +  +  + K
Sbjct: 1955 FKRRTEEGY--YEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGK 2012

Query: 1927 LEIQQREDFRSVLRRAPEPRPEFH------VHEPGKLQFEVQKVDRPVDTTET-KEVVKL 1979
            + I   +  +  L  + E    F       V +     F V+ V +P    E  K  VK+
Sbjct: 2013 ITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKI 2072

Query: 1980 KRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELL 2039
            +R++RI      +   EL  +     E+     + A+ +       ++  LL + K +L+
Sbjct: 2073 ERSDRIYWYWPEDNVCELVIR-DVTAEDSASIMVKAINIAGETSSHAF--LLVQAK-QLI 2128

Query: 2040 HWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRV 2099
             +T+EL +     +A+E K T+ TF+ +  E                             
Sbjct: 2129 TFTQELQD----VVAKE-KDTMATFECETSE----------------------------- 2154

Query: 2100 RVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVT---AEDSASIMVKAINI 2156
                 P  + +WYK+G+++   D+ Y    +  V  L I  +    AED + ++V+  N+
Sbjct: 2155 -----PFVKVKWYKDGMEVHEGDK-YRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENV 2208

Query: 2157 AGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHE 2216
                 + A L+V+   ++ F +ELQD+   E  +    EC  S   ++ KWY + +E+  
Sbjct: 2209 ----KTTAKLIVEGA-VVEFVKELQDIEVPESYS-GELECIVSPENIEGKWYHNDVELKS 2262

Query: 2217 GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDI 2276
              KY + S R    L++  +   D  +YS V+   +  KTT KL ++   +  ++ L D 
Sbjct: 2263 NGKYTITSRRGRQNLTVKDVTKEDQGEYSFVI---DGKKTTCKLKMKPRPIAILQGLSDQ 2319

Query: 2277 EVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEY 2336
            +V E    +LE  VS E++EG W  +  E++ + +  I   +    L ++D+TKED G Y
Sbjct: 2320 KVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2379

Query: 2337 SFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGV-WMKDGQEV 2395
            SF I     +   ++    + ++  L D  V EG    LE KVS+  V  V W  + +++
Sbjct: 2380 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2439

Query: 2396 QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVN 2455
            +P DRV  ++      L+I      D G Y   +  +   T+  +SV  + +I  L+D+ 
Sbjct: 2440 KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRV--ETNCNLSVEKIKIIRGLRDLT 2497

Query: 2456 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2515
              E    V E ++S   +  V W   D++IKP  + +    G   +L +      DEG Y
Sbjct: 2498 CTETQNVVFEVELSHSGI-DVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKY 2556

Query: 2516 KLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPS 2575
                G   T+  L+V    I + L D T  E+Q  VFE E+++      W    K +  +
Sbjct: 2557 TFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLT 2616

Query: 2576 SKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQ 2635
            +  + E+ G   +L +     DD G+YT+    + TS KL V    I K L + TV E+Q
Sbjct: 2617 NNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQ 2676

Query: 2636 EAVFECEVANPDSKG-EWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVA 2694
            +AVF  E+ +P+ KG +W+++G  L           G    L I    + D   Y +++ 
Sbjct: 2677 DAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLG 2736

Query: 2695 TSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYA 2754
                SA+L VE VKI K  K++T  E     F V ++H  V  V+W    V ++ ++K+ 
Sbjct: 2737 RLGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHR 2795

Query: 2755 ISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDVTALENATVAF 2814
            +  +  ++ L ++N +  D   Y   +G+L   A+L VET+ I K  K++   E  T +F
Sbjct: 2796 LVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVPETKTASF 2855

Query: 2815 EVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECK 2874
            E  VSH  VP  W    VEI+ S+K ++V + K+H+L++ N S  D+ EYT V G  +  
Sbjct: 2856 ECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVS 2915

Query: 2875 AKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGK 2934
            A L V  + IT  +K+I   E  T +FE  V++  +   WLKNGVEI+ ++K ++  +  
Sbjct: 2916 ATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKL 2975

Query: 2935 LHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTP--IMITSMLKDINAEEKDTITFEVTV 2992
             H L I N    D+A+YTFV G    +ATL V    I     +KDI   EK    FE  V
Sbjct: 2976 THSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEV 3035

Query: 2993 NYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLY 3052
            +   I+ +W+K+  E++ TD+ +++ +K  H L I +    DA  YT VAG   STA L+
Sbjct: 3036 SEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLF 3095

Query: 3053 VEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQEL--QITDRIKIQKEKY 3110
            VE R +  R   K+++V+EK+RA+ E EV+E D+   W KD  E+  Q+ +R K   E+ 
Sbjct: 3096 VEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERR 3155

Query: 3111 VHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR------- 3163
            +HR+ I  TR SDAG+YT VAG N S+  L+V   +     + +E+Q +  Q        
Sbjct: 3156 IHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPP--QVLQELQPVTVQSGKPARFC 3213

Query: 3164 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA- 3222
            AV+            WYK+  E       + K++ + + + + + E    DA  YT  A 
Sbjct: 3214 AVIS---GRPQPKISWYKE--EQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAK 3268

Query: 3223 ---GRNRSSVTLYVNAPE-----------PPQVLQELQPVTVQSGKPARFCAVISGRPQP 3268
               G   +S +L V  PE           PP ++  LQ      G+PARF   +SG    
Sbjct: 3269 NDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL- 3327

Query: 3269 KISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSV 3328
            K+SWY +++ +      +       Y L + EA+PED   YT  A N  G  +++A+LS+
Sbjct: 3328 KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3387

Query: 3329 EVPEVVSPDQ------------------------------------------EMPVYP-- 3344
            E PE +  ++                                          E PVYP  
Sbjct: 3388 EAPESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTK 3447

Query: 3345 ---------PAIITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQ 3394
                     P  I  + +   S G  A     V G    K+ W+     + PS  ++   
Sbjct: 3448 FDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVF 3507

Query: 3395 FEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKE 3454
              D + L I     EDEG YT +ASN  G+   +A L +                     
Sbjct: 3508 DGDDHSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKIN-------------------- 3547

Query: 3455 LFSEGESEHSERDTRDAFSDSEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKY 3514
              S+GE  H + +T  A + S +             ++           P F ++L    
Sbjct: 3548 --SKGEG-HKDTETESAVAKSLE-------------KLGGPCP------PHFLKELKPIR 3585

Query: 3515 VLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLH--HHSSSLEIKRVQD 3572
              +G P +F   ++  P P +TWF  N+ + T +   I     +H  + S +  +   Q 
Sbjct: 3586 CAQGLPAIFEYTVVGEPAPTVTWFKENKQLCTSVYYTI-----IHNPNGSGTFIVNDPQR 3640

Query: 3573 RDSGSYRLLAINSEGSAESTASLLVIQKGQD 3603
             DSG Y   A N  G +   A LLV+ +  D
Sbjct: 3641 EDSGLYICKAENMLGESTCAAELLVLLEDTD 3671



 Score =  575 bits (1483), Expect = e-163
 Identities = 842/3673 (22%), Positives = 1401/3673 (38%), Gaps = 591/3673 (16%)

Query: 164  AEAYPEDSGTYSVNATNSVGRATSTA--------ELLVQGEEEVPAKKTKTIVSTAQISE 215
            AEA    +     +A  S   AT  A        E ++   E+   + T T V      E
Sbjct: 406  AEAVATGAKEVKQDADKSAAVATVVAAVDMARVREPVISAVEQTAQRTTTTAVHIQPAQE 465

Query: 216  SRQTRIEKKIEAHFDARSIATVEMVIDGAAGQQLPHKTPPRIPPKPKSRSPTPPSIAAKA 275
              +   EK         ++  V +  D A  Q+L  +T   I  K +    T   I  + 
Sbjct: 466  QVRKEAEKT--------AVTKVVVAADKAKEQELKSRTKEVITTKQEQMHVTHEQIRKET 517

Query: 276  QLARQQSPSPIRHSPSPVRHVRAPTPSPVRSVSPAARIS---TSPIRSVRSPLLMRKTQA 332
            +                   V     S  ++     RIS   T   + V    +M++T+ 
Sbjct: 518  EKT----------------FVPKVVISAAKAKEQETRISEEITKKQKQVTQEAIMKETRK 561

Query: 333  STVATGPEVPPPWKQEGYVASSSEA--EMRETTLTTSTQIRTEERWEGRYGVQEQVTISG 390
            + V       P  K++  V+   E     RE    T  ++R E          E+  +S 
Sbjct: 562  TVVPKVIVATPKVKEQDLVSRGREGITTKREQVQITQEKMRKEA---------EKTALST 612

Query: 391  AAGAAASVSASASY--AAEAVATGAKEV-----KQDADKSA-AVATVVAAVDMARVREPV 442
             A A A      +     E +AT  +++     K D  K A AVATVVAAVD ARVREP 
Sbjct: 613  IAVATAKAKEQETILRTRETMATRQEQIQVTHGKVDVGKKAEAVATVVAAVDQARVREPR 672

Query: 443  ISAVEQTAQRTTTTAVHIQPAQEQVRKEAEK----TAVTKVVVAADKAKEQELKSRTKEV 498
                 + +    TT  +    +    K AE      +   VV  A K +  +  S T  +
Sbjct: 673  EPGHLEESYAQQTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSET-HI 731

Query: 499  ITTKQEQMHVTHEQIRKETE-----------------------KTFVPKV---------- 525
             TT Q+ MH++  QI+K T+                       K  VPK           
Sbjct: 732  KTTDQKGMHIS-SQIKKTTDLTTERLVHVDKRPRTASPHFTVSKISVPKTEHGYEASIAG 790

Query: 526  -VISAAKAKEQETRISEEITKKQKQVTQEA--IRQETEITAASMVVVATAKST-KLETVP 581
              I+  + +   T  +++ITK  K  T +    R   E T       A    T K E   
Sbjct: 791  SAIATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTYKSEAGV 850

Query: 582  GAQEE-------TTTQQDQMHLSYEKIMK--ETRKTVVPKVIVATPKVKEQDL----VSR 628
              ++E       TT ++++  + + +  K  ET +   P  I  TP      L    V  
Sbjct: 851  EVKKEVGVSITGTTVREERFEVLHGREAKVTETARVPAPVEIPVTPPTLVSGLKNVTVIE 910

Query: 629  GRE-------------GITTKREQVQITQEKMRKEAEKTALSTIAVATAKAKEQETILRT 675
            G                +T  RE  QI      +   ++ ++ + +  A A++       
Sbjct: 911  GESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLMIREAFAEDSG----- 965

Query: 676  RETMATRQEQIQVTHG---KVDVGKKAEAVATVVA---AVDQARVREPREPGHLEESYAQ 729
            R T +   E   V+      V V ++ E   T V      ++ R  E R+    + S  +
Sbjct: 966  RFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVMTDTSLTE 1025

Query: 730  QTTLEYGYKERISAAKVAEPPQRPASEPHVVPKAVKPRVIQAPSETH-IKTTDQKGMHIS 788
            +                   P  PA+ P+ + K V  ++++  S     +       H+ 
Sbjct: 1026 EQA----------------GPGEPAA-PYFITKPVVQKLVEGGSVVFGCQVGGNPKPHVY 1068

Query: 789  SQIKKTTDLTTERLVHVDKRPRTASPHFTVSKIS---------VPKTEHGYEASIAGSAI 839
             + K    LTT     V    +T      +S            V + +HG E S + S +
Sbjct: 1069 WK-KSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYTIVVRNKHG-ETSASASLL 1126

Query: 840  ATLQKELSATSSAQKITKSVKAPTVKPSETRVRAEPTPLPQFPFADTPDTY-KSEAGVEV 898
                 EL   S  + + ++     V+  +    A     P F +++    Y K +A +  
Sbjct: 1127 EEADYELLMKSQQEMLYQTQVTAFVQEPKVGETA-----PGFVYSEYEKEYEKEQALIRK 1181

Query: 899  KKEVGVSITGTTVREERFEV--LHGREAKVTETARVPAPVE------------IPVTPPT 944
            K      +  T V ++ F +     R  K  E   +   +E            + ++   
Sbjct: 1182 KMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEEDGEEKMAVDISESE 1241

Query: 945  LV-----SGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITF-QSGIA 998
             V     S +KN  ++EG  VT  C +SGYP P + WY++  +I+    +Q+ F Q G A
Sbjct: 1242 AVESGFDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKRIKHGERYQMDFLQDGRA 1301

Query: 999  RLMIREAFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVT----EKFTTEEK 1054
             L I     ED G +T  A N  G    S  L V+ +      T   T     +  +   
Sbjct: 1302 SLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPTLEPVSRIRSLSP 1361

Query: 1055 RFVESRDVVMTDTSLTEEQAGPGE--PAA--------------------PYFITKPVVQK 1092
            R V    + M+   ++  +  P    PA                     P F+ KPV  K
Sbjct: 1362 RSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFK 1421

Query: 1093 LVEGGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAG 1152
             +EG +  F  +V G P P  +W   G  +   Y +KV   K+ G   L+I      D+G
Sbjct: 1422 CLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVI-KEDGTQSLIIVPATPSDSG 1480

Query: 1153 EYTIVVRNKHGETSASASLLEEADYELLMKSQQEMLYQTQVTAFVQ-EPKV---GETAPG 1208
            E+T+V +N+ G +S S  L  EA    +     E L    +    + E KV   G   P 
Sbjct: 1481 EWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPD 1540

Query: 1209 FV------------YSEYEKEYEKEQALIR-----------------KKMAKDTVVVRTY 1239
             V            Y +   E  K +A ++                  K  +DT   +  
Sbjct: 1541 IVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVN 1600

Query: 1240 VEDQEFHISSFEERLIKEIEYR---IIKTTLEELLEEDGEEKMAV-DISESEAVESGF-D 1294
            VE +        + +I    YR   I    LE L    G+E+    D+ + E  +  F  
Sbjct: 1601 VEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFK 1660

Query: 1295 SRIKNYRILEGMGVTFHCKMS--GYPLPKIAWYKDGKRIKHGERYQMDFLQDGRASLRIP 1352
             ++ + R+       F C+++  G P   + W  DGK ++   R +M   + G  SL   
Sbjct: 1661 KKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRM-INEFGYCSLDYG 1719

Query: 1353 VVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAPTYIPT-LEPVSRIRSLSPRSVS 1411
            V    D GI T  A+N  G    S  L V+    L   + +P   + + RI  L      
Sbjct: 1720 VAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELE----- 1774

Query: 1412 RSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQLERLYKPVFVLKPVSFKCLEG 1471
                                    RM+    L      Q E+  KP  VL P   + LEG
Sbjct: 1775 ------------------------RMAHEGALTGVTTDQKEK-QKPDIVLYPEPVRVLEG 1809

Query: 1472 QTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWTVV 1531
            +TARF  +V G P P+  W+ +GQ I      +V  + DG   L IV     D+GE  V 
Sbjct: 1810 ETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRV--RYDGIHYLDIVDCKSYDTGEVKVT 1867

Query: 1532 AQNRAGRSSISVILTVEAVE--HQVKPMFVEKLKNVNIKEGSRLEMKVRATGNP-----N 1584
            A+N  G     V L ++  E    V     E     ++ E  +L+ +V+    P      
Sbjct: 1868 AENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTET 1927

Query: 1585 PDIVWLKNSDIIVPHKYP----------KIRIEGTKGEAALKIDSTVSQDSAWYTATAIN 1634
             ++V LK ++ I   K P          K R E    EA   ++    +    Y      
Sbjct: 1928 KEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRK 1987

Query: 1635 KAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDL 1694
                     K   E E      E K+ IP  T++  +I   EL P               
Sbjct: 1988 TKDELLHWTKELTEEEKKALAEEGKITIP--TFKPDKI---ELSP--------------- 2027

Query: 1695 YDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMI 1754
                  + P   +++ S  + +   AHF  R+  +G P    EW  +G  +E ++R+   
Sbjct: 2028 ----SMEAPKIFERIQSQTVGQGSDAHFRVRV--VGKPDPECEWYKNGVKIERSDRIYWY 2081

Query: 1755 -NEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGL 1813
              E   C L      + DS  I  +A N  G   + A L+V+ ++ +    +L +     
Sbjct: 2082 WPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQD----- 2136

Query: 1814 QRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVN 1873
                             V   +K+                    A F C  T  P  KV 
Sbjct: 2137 -----------------VVAKEKDTM------------------ATFECE-TSEPFVKVK 2160

Query: 1874 WYLNGQLIRKSKRFRVRYDG-IHYLDIV----------DCKSYDTGEVKVTAEN-PEGVI 1921
            WY +G  + +  ++R+  D  +H+L I+           C   +   VK TA+   EG +
Sbjct: 2161 WYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAV 2220

Query: 1922 EHKVK--LEIQQREDFRSVLRRAPEPRP--------EFHVHEPGKLQFEVQKVDRPVDTT 1971
               VK   +I+  E +   L     P          +  +   GK     +   R     
Sbjct: 2221 VEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSR---RGRQNL 2277

Query: 1972 ETKEVVKLKRAER---ITHEKV-------PEESEELRSKFKRRTEEGYYEAITAVELKSR 2021
              K+V K  + E    I  +K        P     L+    ++  EG       V+L+ +
Sbjct: 2278 TVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEG-----DIVQLEVK 2332

Query: 2022 KKDESYEELLRKTKDEL-----LHWTKE------LTEEEKKALAEEGKITIPTFKPDKIE 2070
               ES E +  K   E+     +H   +      L E+  K  A     TIP      + 
Sbjct: 2333 VSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPA-----LG 2387

Query: 2071 LSPS----MEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYW 2126
            LS S    + +  +   ++   V +G+ A    +V        +WY N  +I+  DR+  
Sbjct: 2388 LSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQA 2447

Query: 2127 YWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAK 2186
               +     LVI    A D     +    I G   ++  L V+  ++I   + L+D+   
Sbjct: 2448 I-VKGTKQRLVINRTHASDEGPYKL----IVGRVETNCNLSVEKIKII---RGLRDLTCT 2499

Query: 2187 EKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSC 2246
            E   +  FE E S   + V W     E+    KY++ +  K++ L++L +   D   Y+ 
Sbjct: 2500 ETQNVV-FEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTF 2558

Query: 2247 VLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVEL 2306
               E+    T+ KL V G  +   K L D  V ES     EC V+  + +G+W  +   L
Sbjct: 2559 YAGEN---MTSGKLTVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHL 2613

Query: 2307 KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQK 2366
                     S   ++ L +     +D GEY++ +   KT+ KLK++   + I + L +  
Sbjct: 2614 PLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA--VKIKKTLKNLT 2671

Query: 2367 VCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNY 2425
            V E       V+++  +V+GV W+K+G  ++ +++  I +    + L I++    D   Y
Sbjct: 2672 VTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVY 2731

Query: 2426 SFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQI 2485
             F +  LG   S R+ V +V +I   KDV  +E      E  VS  D   VKW+    +I
Sbjct: 2732 GFRLGRLG--ASARLHVETVKIIKKPKDVTALENATVAFEVSVS-HDTVPVKWFHKSVEI 2788

Query: 2486 KPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCT 2545
            KP D+ + + +    +L++     SD G Y  +VG++E    L VE + I + ++++   
Sbjct: 2789 KPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTMKNIEVP 2848

Query: 2546 ETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFY 2605
            ET+   FE E+SH  +  +W     EI+ S K+KI   GK+++L ++N   +D  +YTF 
Sbjct: 2849 ETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFV 2908

Query: 2606 AGENMTSGKLTVAGGAISKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNI 2665
             G +  S  LTV    I+  L D    E     FE  V       +WL++G  +  T+  
Sbjct: 2909 CGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKC 2968

Query: 2666 RSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEA--VKIKKTLKNLTVTETQD 2723
            +  +      L I      D  +YT+    + ++A L VEA  ++ +K +K++ V E + 
Sbjct: 2969 QMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKR 3028

Query: 2724 AVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGR 2783
            A+F  E++ P++  VQW+K+   L+  ++  I  +  ++ L I +  + D   Y    G 
Sbjct: 3029 AMFECEVSEPDIT-VQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG 3087

Query: 2784 LGASARLHVE--TVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEI--KPSDK 2839
              ++A+L VE   V+I    K+V  +E      E  V+ D V   W+   +EI  +  ++
Sbjct: 3088 NVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER 3147

Query: 2840 HRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFV---ETLHITKTMKNIEVPET 2896
            H+ V ER++H++ +     SDAGEYT V G+      L+V   E   + + ++ + V   
Sbjct: 3148 HKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSG 3207

Query: 2897 KTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVC 2955
            K A F   +S    P + W K    +    K K +  G+ + L+++    ED+A YT   
Sbjct: 3208 KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEA 3267

Query: 2956 GNDQVSAT------------------LTVTPIMITSMLKDINAEEKDTITFEVTVNYEGI 2997
             ND   AT                  + V P  I + L+D    E     F+  V+   +
Sbjct: 3268 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL 3327

Query: 2998 SYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVA----GKATSTATLYV 3053
               W     +IK +   +M   + T+ L I   +  D   YTFVA    G+ +STA L +
Sbjct: 3328 KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3387

Query: 3054 EARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHR 3113
            EA      + I+            E E+   + +  ++  ++E   +  +++ K      
Sbjct: 3388 EAPESILHERIEQ-----------EIEMEMKEFSSSFLSAEEEGLHSAELQLSKINETLE 3436

Query: 3114 LLIPSTRMSDAGKY-TVVAGGNVSTAKLFVE---GRDVRIRSIKK-EVQVIEKQRAVVEF 3168
            LL      S++  Y T        T  +F++     D+ +  +    V VI   +  ++ 
Sbjct: 3437 LL------SESPVYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQ- 3489

Query: 3169 EVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVA----GR 3224
                      W+ +G+ +       +K+V +   H + I  T+  D GEYT +A    G+
Sbjct: 3490 ----------WFFNGVLLTPSAD--YKFVFDGDDHSLIILFTKLEDEGEYTCMASNDYGK 3537

Query: 3225 NRSSVTLYVNA-----------------------PEPPQVLQELQPVTVQSGKPARFCAV 3261
               S  L +N+                       P PP  L+EL+P+    G PA F   
Sbjct: 3538 TICSAYLKINSKGEGHKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAIFEYT 3597

Query: 3262 ISGRPQPKISWYKEEQLLSTGFKCKFLHD-GQEYTLLLIEAFPEDAAVYTCEAKNDYGVA 3320
            + G P P ++W+KE + L T      +H+     T ++ +   ED+ +Y C+A+N  G +
Sbjct: 3598 VVGEPAPTVTWFKENKQLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENMLGES 3657

Query: 3321 TTSASLSV---------------EVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQ 3365
            T +A L V                 PE      + P+  PA+     + + SE + A F 
Sbjct: 3658 TCAAELLVLLEDTDMTDTPCKAKSTPEAPEDFPQTPLKGPAV-----EALDSEQEIATF- 3711

Query: 3366 CRVSGTDLKVSWYSKD-KKIKPSRFFRMTQFEDTYQL---EIAEAYPED----EGTYTFV 3417
              V  T LK +  +++ +++      +  +      L   E+     +D    E T  F+
Sbjct: 3712 --VKDTILKAALITEENQQLSYEHIAKANELSSQLPLGAQELQSILEQDKLTPESTREFL 3769

Query: 3418 ASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSED 3477
              N      S     L+ P       ++ +I    K    EG     E +T+   SD+E 
Sbjct: 3770 CIN-----GSIHFQPLKEPS----PNLQLQIVQSQKTFSKEGILMPEEPETQAVLSDTEK 3820

Query: 3478 IDHKSMAAKRYAS 3490
            I   +M+ ++  S
Sbjct: 3821 IFPSAMSIEQINS 3833



 Score =  485 bits (1249), Expect = e-136
 Identities = 416/1591 (26%), Positives = 697/1591 (43%), Gaps = 122/1591 (7%)

Query: 1830 GVTTDQKEKQKPDIVLYPEPVR-----------VLEGETARFRCRVTGYPQPKVNWYLNG 1878
            GV T + E +K    L+   +R           V EGETA F C ++ + +  V W+ N 
Sbjct: 5055 GVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELS-HEKMHVVWFKND 5113

Query: 1879 QLIRKSKRFRVRYDG-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRS 1937
              +  S+   +  +G  H L++ +    D  ++K   +      + KV            
Sbjct: 5114 AKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVL----------- 5162

Query: 1938 VLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHE-KVPEESEE 1996
                  E  P F V    K   E  ++    + ++   V   K  E I    K   +++ 
Sbjct: 5163 ------EADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKYSIKADG 5216

Query: 1997 LRS--KFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKD----------ELLHWTKE 2044
            LR   K K+   +   E +        K + + E  L K +           E  H+  E
Sbjct: 5217 LRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIE 5276

Query: 2045 LTEEEKKA----------------LAEEGKITIPTFKPDKIELSPSM------------- 2075
            L+E +                   + E+GK  I      ++ ++  +             
Sbjct: 5277 LSEPDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANL 5336

Query: 2076 ---EAPKIF-ERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPED 2131
               E P IF   +    V +  +A F   V  +P     W K   +I   DR +    + 
Sbjct: 5337 KVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKT-FRWLKGTQEITGDDR-FELIKDG 5394

Query: 2132 NVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTM 2191
                +VI+    ED A  M +A     +  +   L+++  +L  F   L+DV AKEK++ 
Sbjct: 5395 TKHSMVIKSAAFEDEAKYMFEA----EDKHTSGKLIIEGIRL-KFLTPLKDVTAKEKES- 5448

Query: 2192 ATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVED 2251
            A F  E S   ++VKW+K+   +H      M  + K H +   T      +D S + VE 
Sbjct: 5449 AVFTVELSHDNIRVKWFKNDQRLHTTRSVSMQDEGKTHSI---TFKDLSIDDTSQIRVEA 5505

Query: 2252 ENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGK 2311
              + + AKL V      F  +LQD    E     L+C +S  +   KW+ +  E+K +  
Sbjct: 5506 MGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAPVKWFKDGKEIKPSKN 5565

Query: 2312 YTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGD 2371
              I +   ++ L +K   K D G+Y+      KT+ KL ++ R I +++ L   +V E +
Sbjct: 5566 AVIKADGKKRMLILKKALKSDIGQYTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETE 5625

Query: 2372 IVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPA 2431
              + E ++S + +   W   G+ +  +    I  + + H L++ +   +  G   F    
Sbjct: 5626 TARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAAN 5685

Query: 2432 LGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRV 2491
            +  S   RV    + ++ PLKDV V  G  A  +C++S  D+  V+WYL  ++++P D+V
Sbjct: 5686 VKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPSDKV 5744

Query: 2492 QAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEK--IKIIRGLRDLTCTETQN 2549
                +G    L +      D G  +L     +T+ NL V++  ++  + L D T  E   
Sbjct: 5745 VPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGAT 5804

Query: 2550 VVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGEN 2609
             V E E+S     V W     EI  S KY+I A G++ KL + +   +D   YT  A + 
Sbjct: 5805 AVLECEVSRENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDF 5864

Query: 2610 MTSGKLTVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRS 2667
             TS  L V    +   +PLTD  V E + A FECE++  ++K +W +DG  +        
Sbjct: 5865 KTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKVKWFKDGAEIKKGKKYDI 5924

Query: 2668 ESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKV--EAVKIKKTLKNLTVTETQDAV 2725
             S G  R L+I    LDD  EY+ +V T++TS  L V  E     K L N+ V+ET    
Sbjct: 5925 ISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIK 5984

Query: 2726 FTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRL--GR 2783
               E++ P  + V W K    +    +Y I  +G    L I+N  + D   Y  RL   R
Sbjct: 5985 LVCEVSKPGAE-VIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSR 6043

Query: 2784 LGASARLHVETVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLV 2843
                 ++H    + I KP+++  LE     F  S+S ++ PV+W      ++  DK+ ++
Sbjct: 6044 TDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFPVQWKRDDKTLESGDKYDVI 6103

Query: 2844 SERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFV-ETLHITKTMKNIEVPETKTASFE 2902
            ++ K   L++++ +  D G Y  +VG     A L V E L I   +K+  V E +   F 
Sbjct: 6104 ADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVVPLKDTRVKEQQEVVFN 6163

Query: 2903 CEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQ--- 2959
            CEV+     + W +N   I  S K+ I+ +  ++ L I +   +D A Y     N +   
Sbjct: 6164 CEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGEN 6223

Query: 2960 --VSATLTVTP--IMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQ 3015
               +A L V    + I   LKDI   EK ++TF   VN   ++ KW KNG E+   ++  
Sbjct: 6224 VKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTLKWTKNGEEVPFDNRVS 6283

Query: 3016 MRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRA 3075
             R  K  H L I++  F D  +Y   AG+  S A L +     EF +H++D  V E   A
Sbjct: 6284 YRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTEFVEHLEDQTVTEFDDA 6343

Query: 3076 MFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNV 3135
            +F C++S     V+W ++ +E++   + K +K+  +HRL+I   R+ D  +Y        
Sbjct: 6344 VFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRK 6403

Query: 3136 STAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEF--EVNEDDVDAHWYKDGIEINFQVQ-E 3192
            S A+LFVE  ++ +  I+    ++E   A V F  E+N+D V+  W ++ + +   VQ +
Sbjct: 6404 SRARLFVE--EIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVV---VQGD 6458

Query: 3193 RHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQS 3252
            +H+ + E +IHR+ I + +  D GEY F+A    +   L + A   P++    Q + V  
Sbjct: 6459 KHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAA--APKIKTADQDLVVDV 6516

Query: 3253 GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYT-LLLIEAFPEDAAVYTC 3311
            GKP          P+ +  W+KE + LST    K +    E T   ++EA   D   Y  
Sbjct: 6517 GKPLTMVVPYDAYPKAEAEWFKENEPLST----KTIDTTAEQTSFRILEAKKGDKGRYKI 6572

Query: 3312 EAKNDYGVATTSASLSVEVPEVVSPDQEMPV 3342
              +N +G A     ++++V +V  P + + V
Sbjct: 6573 VLQNKHGKA--EGFINLKVIDVPGPVRNLEV 6601



 Score =  479 bits (1232), Expect = e-134
 Identities = 411/1565 (26%), Positives = 678/1565 (43%), Gaps = 97/1565 (6%)

Query: 2079 KIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVI 2138
            K    ++ QTV +G  A F V  +        W+KN  K+  S R      E    +L +
Sbjct: 5078 KFMSPLEDQTVKEGETATF-VCELSHEKMHVVWFKNDAKLHTS-RTVLISSEGKTHKLEM 5135

Query: 2139 RDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECET 2198
            ++VT +D + I  +      E SS A L V       FT +L D  A EKD + T +CE 
Sbjct: 5136 KEVTLDDISQIKAQV----KELSSTAQLKVLEADPY-FTVKLHDKTAVEKDEI-TLKCEV 5189

Query: 2199 SEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTA 2258
            S+  V VKW+KDG E+    KY + +D     L I   D  D  +Y C    D   KT A
Sbjct: 5190 SKD-VPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVCDCGTD---KTKA 5245

Query: 2259 KLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRR 2318
             + VE  +++  K L  +EV    +   E  +S  ++ G+W      L ++    I    
Sbjct: 5246 NVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTASPDCEIIEDG 5305

Query: 2319 GRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVK 2378
             +  L + +      GE SF     K+   LK+K  P+  +  LSD KV E D  + E +
Sbjct: 5306 KKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEAKFECE 5365

Query: 2379 VSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSG 2438
            VS E     W+K  QE+   DR  ++ D   H ++I+    ED   Y F   A    TSG
Sbjct: 5366 VSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFE--AEDKHTSG 5423

Query: 2439 RVSVYSVDV--ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVK 2496
            ++ +  + +  +TPLKDV   E   AV   ++S  ++  VKW+ ND+++     V    +
Sbjct: 5424 KLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIR-VKWFKNDQRLHTTRSVSMQDE 5482

Query: 2497 GTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRG-------LRDLTCTETQN 2549
            G    +        D         RVE     S  K+ ++ G       L+D T  E   
Sbjct: 5483 GKTHSITFKDLSIDDTSQI-----RVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDE 5537

Query: 2550 VVFEVELSHSGIDVLWNFKD-KEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGE 2608
            V+ + E+S +   V W FKD KEIKPS    I+A GK   L +   +K D G+YT   G 
Sbjct: 5538 VILQCEISKADAPVKW-FKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGT 5596

Query: 2609 NMTSGKLTVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIR 2666
            + TSGKL +    I   +PL    V E++ A FE E++  D    W   G+ L  T +  
Sbjct: 5597 DKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCE 5656

Query: 2667 SESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVE--AVKIKKTLKNLTVTETQDA 2724
             + +G    L++   +LD  G   ++ A  K+SA L+V+   + + + LK++TVT  + A
Sbjct: 5657 IKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETA 5716

Query: 2725 VFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRL 2784
             F  EL++ ++  V+W   G  LE ++K     +G +++L +++  + D           
Sbjct: 5717 TFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDF 5775

Query: 2785 GASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRL 2842
               A L V+   V+  K  +D T  E AT   E  VS +   VKWF    EI  S K+ +
Sbjct: 5776 KTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILKSKKYEI 5835

Query: 2843 VSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHIT--KTMKNIEVPETKTAS 2900
            V++ +V KL++ + +P D   YT      +    L V   H+   + + +++V E + A 
Sbjct: 5836 VADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMAR 5895

Query: 2901 FECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQV 2960
            FECE+S  N    W K+G EI+  +K+ I+ +G +  L+I     +D AEY+      + 
Sbjct: 5896 FECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTART 5955

Query: 2961 SATLTVTP--IMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRT 3018
            S  LTV     + T  L +I   E DTI     V+  G    W K   EI  T + ++ T
Sbjct: 5956 SGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILT 6015

Query: 3019 KKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFE 3078
            +     L I+N H  DA +Y      + +   + V     EF    +++++LE ++A F 
Sbjct: 6016 EGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFV 6075

Query: 3079 CEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTA 3138
            C +S+    VQW +DD+ L+  D+  +  +     L++    + D G Y V+ G   + A
Sbjct: 6076 CSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAA 6135

Query: 3139 KLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVV 3198
             L V  + +RI    K+ +V E+Q  V   EVN +   A W+++       + +  KY++
Sbjct: 6136 HLTVIEK-LRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRN----EEAIFDSSKYII 6190

Query: 3199 ERR--IHRMFISETRQSDAGEY----TFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQS 3252
             ++  ++ + I +    D   Y    T   G N  S    +   E  ++++ L+ +    
Sbjct: 6191 LQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETME 6250

Query: 3253 GKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCE 3312
             K   F   ++ R    + W K  + +    +  +  D  ++ L + +    D   Y   
Sbjct: 6251 KKSVTFWCKVN-RLNVTLKWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVT 6309

Query: 3313 AKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTD 3372
            A  D  VA     L +E P                +  L+D   +E   A F C++S   
Sbjct: 6310 AGQDKSVAEL---LIIEAPT-------------EFVEHLEDQTVTEFDDAVFSCQLSREK 6353

Query: 3373 LKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYT------------FVASN 3420
              V WY   ++IK  + ++  +    ++L I +   +DE  Y             FV   
Sbjct: 6354 ANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGVEDRKSRARLFVEEI 6413

Query: 3421 AVGQVSSTANLSLEAPES---ILHERIEQEIEMEMKE---LFSEGESEHSERDTRDAFSD 3474
             V  +    ++ LEAP +    L E  + ++E++      +  +G+      + +     
Sbjct: 6414 PVEIIRPPQDI-LEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQ 6472

Query: 3475 SEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKYVLE-GEPVVFTCRLIACPTP 3533
              DI  +     R+ ++     +  E       +      V++ G+P+       A P  
Sbjct: 6473 ICDIKPRDQGEYRFIAKDKEARAKLELAAAPKIKTADQDLVVDVGKPLTMVVPYDAYPKA 6532

Query: 3534 EMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTA 3593
            E  WF  N P+ T          D     +S  I   +  D G Y+++  N  G AE   
Sbjct: 6533 EAEWFKENEPLST-------KTIDTTAEQTSFRILEAKKGDKGRYKIVLQNKHGKAEGFI 6585

Query: 3594 SLLVI 3598
            +L VI
Sbjct: 6586 NLKVI 6590



 Score =  457 bits (1175), Expect = e-127
 Identities = 429/1683 (25%), Positives = 722/1683 (42%), Gaps = 131/1683 (7%)

Query: 1786 DHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVL 1845
            D  + TL++  +K   E+ Q   G    + + +  + A    LT V     ++  P I  
Sbjct: 4292 DQNTYTLVI--DKVNTEDHQ---GEYVCEALNDSGKTATSAKLTVV-----KRAAPVIKR 4341

Query: 1846 YPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKS 1904
              EP+ V  G  A+F C +   P  +  W+  G+ I +S +  +R    I  L+I+  + 
Sbjct: 4342 KIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYISSLEILRTQV 4401

Query: 1905 YDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKV 1964
             D GE    A N  G +     L +      + V +  PE +PE    E   L+  ++K 
Sbjct: 4402 VDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKPE--PKEEVVLKSVLRK- 4458

Query: 1965 DRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKD 2024
             RP    E +  V+ K+ E++    VPE                  + +  VE+ +  K 
Sbjct: 4459 -RP---EEEEPKVEPKKLEKVKKPAVPEPPPP--------------KPVEEVEVPTVTKR 4500

Query: 2025 ESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERI 2084
            E   ++   TK   +     L   E K   E     + T KP  +E  P+  A  +    
Sbjct: 4501 E--RKIPEPTKVPEIKPAIPLPAPEPKPKPEA---EVKTIKPPPVEPEPTPIAAPV---- 4551

Query: 2085 QSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAE 2144
                          V VVGK        K   K  + +      P   V +     + AE
Sbjct: 4552 -------------TVPVVGK--------KAEAKAPKEEAAKPKGPIKGVPKKTPSPIEAE 4590

Query: 2145 DSASIMVKAINIAGETSSHAFLLVQAKQL-ITFTQELQDVVAKEKD---TMATFECETSE 2200
                  ++  +   +    A    Q K + + F +E++D++  E +   + A FEC  S 
Sbjct: 4591 RRK---LRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDIILTESEFVGSSAIFECLVSP 4647

Query: 2201 PFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKT-TAK 2259
                  W KDG  + E  K+R  +D K   L I+ +  SDA +Y+CVL      KT TAK
Sbjct: 4648 STAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAK 4707

Query: 2260 LIVEGAVVEFVKEL-QDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRR 2318
            L+VE   V FVK L +++ V +     L C ++ E         DV  + +GK  +  + 
Sbjct: 4708 LVVEELPVRFVKTLEEEVTVVKGQPLYLSCELNKE--------RDVVWRKDGK-IVVEKP 4758

Query: 2319 GR---------QNLTVKDVTKEDQGEYSFVIDGKK----TTCKLKMKPRPIAILQGLSDQ 2365
            GR         + LT+ D    D G Y+  ++       ++C   ++     +++ + DQ
Sbjct: 4759 GRIVPGVIGLMRALTINDADDTDAGTYTVTVENANNLECSSCVKVVEVIRDWLVKPIRDQ 4818

Query: 2366 KVCEGDIVQLEVKVSLESVEGVWMKDGQEV--QPSDRVHIVIDKQSHMLLIEDMTKEDAG 2423
             V           ++ ++    W K   E+  +P+D+  I+ D     L I++   ED  
Sbjct: 4819 HVKPKGTAIFACDIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIKNAMPEDIA 4878

Query: 2424 NYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDE 2483
             Y+  I          +    V+++ P++DV + E   A  + ++S  D+   +W L  E
Sbjct: 4879 EYAVEIEGKRYPAKLTLGEREVELLKPIEDVTIYEKESASFDAEISEADIPG-QWKLKGE 4937

Query: 2484 QIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKI--IRGLRD 2541
             ++P    +   +G K+ L +++      G          T   L+V++I++     L+D
Sbjct: 4938 LLRPSPTCEIKAEGGKRFLTLHKVKLDQAGEVLYQALNAITTAILTVKEIELDFAVPLKD 4997

Query: 2542 LTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGK 2601
            +T  E +   FE  L+    +V+W+     IK S K+ I A GK + L + +   DDEG 
Sbjct: 4998 VTVPERRQARFECVLTREA-NVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFDDEGV 5056

Query: 2602 YTFYAGENMTSGKLTVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHL 2659
            YT       TS +L V G  +    PL DQTV E + A F CE+++      W ++   L
Sbjct: 5057 YTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKL 5116

Query: 2660 PLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVT 2719
              +  +   S+G   +L +    LDDI +   +V    ++A+LKV       T+K    T
Sbjct: 5117 HTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKT 5176

Query: 2720 ETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGF 2779
              +    T++        V+W K+G  +  + KY+I   G    L+IK   + D+  Y  
Sbjct: 5177 AVEKDEITLKCEVSKDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDKGEYVC 5236

Query: 2780 RLGRLGASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPS 2837
              G     A + VE   +K+ K    V      T  FE+ +S   V  +W  K   +  S
Sbjct: 5237 DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHGQWKLKGQPLTAS 5296

Query: 2838 DKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHI--TKTMKNIEVPE 2895
                ++ + K H L+L N      GE +      +  A L V+ L +     + +++V E
Sbjct: 5297 PDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFE 5356

Query: 2896 TKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVC 2955
               A FECEVS       WLK   EI   ++F+++  G  H ++I + + ED A+Y F  
Sbjct: 5357 KDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEA 5416

Query: 2956 GNDQVSATLTVTPIMITSM--LKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDK 3013
             +   S  L +  I +  +  LKD+ A+EK++  F V ++++ I  KW KN   + +T  
Sbjct: 5417 EDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRS 5476

Query: 3014 CQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKK 3073
              M+ +  THS+  +++   D +     A   +S A L V      F   ++D   +EK 
Sbjct: 5477 VSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKD 5536

Query: 3074 RAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGG 3133
              + +CE+S+ D  V+W KD +E++ +    I+ +     L++     SD G+YT   G 
Sbjct: 5537 EVILQCEISKADAPVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGT 5596

Query: 3134 NVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQER 3193
            + ++ KL +E R++++      V+V+E + A  E E++EDD+ A+W   G E   Q  + 
Sbjct: 5597 DKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKG-EALLQTPD- 5654

Query: 3194 HKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSG 3253
             +   E +IH + +   R    G   F A   +SS  L V  P    +L+ L+ VTV +G
Sbjct: 5655 CEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVK-PRVIGLLRPLKDVTVTAG 5713

Query: 3254 KPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEA 3313
            + A F   +S    P + WY + + L    K     +G+ +TL L +   EDA      A
Sbjct: 5714 ETATFDCELSYEDIP-VEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTA 5772

Query: 3314 KNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDL 3373
            K+      T A+L V+ P            P     PL+D    EG  A  +C VS  + 
Sbjct: 5773 KD----FKTHANLFVKEP------------PVEFTKPLEDQTVEEGATAVLECEVSRENA 5816

Query: 3374 KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSL 3433
            KV W+    +I  S+ + +       +L I +  PED  TYT  A +      ++ NL++
Sbjct: 5817 KVKWFKNGTEILKSKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKD----FKTSCNLNV 5872

Query: 3434 EAP 3436
              P
Sbjct: 5873 VPP 5875



 Score =  446 bits (1147), Expect = e-124
 Identities = 418/1656 (25%), Positives = 706/1656 (42%), Gaps = 121/1656 (7%)

Query: 1848 EPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDG-IHYLDIVDCKSYD 1906
            E V + E E+A F   ++    P   W L G+L+R S    ++ +G   +L +   K   
Sbjct: 4907 EDVTIYEKESASFDAEISEADIPG-QWKLKGELLRPSPTCEIKAEGGKRFLTLHKVKLDQ 4965

Query: 1907 TGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFE-VQKVD 1965
             GEV   A N        VK EI+   DF   L+    P       E  + +FE V   +
Sbjct: 4966 AGEVLYQALNAITTAILTVK-EIEL--DFAVPLKDVTVP-------ERRQARFECVLTRE 5015

Query: 1966 RPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEA------------I 2013
              V  ++  +++K      I  +          S+F    +EG Y A            +
Sbjct: 5016 ANVIWSKGPDIIKSSDKFDIIADGKKHILVINDSQFD---DEGVYTAEVEGKKTSARLFV 5072

Query: 2014 TAVELK--SRKKDESYEE-----LLRKTKDELLH--WTKE-----------LTEEEKKAL 2053
            T + LK  S  +D++ +E      + +   E +H  W K            ++ E K   
Sbjct: 5073 TGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKNDAKLHTSRTVLISSEGKTHK 5132

Query: 2054 AEEGKIT---IPTFKPDKIELSPS-----MEAPKIFE-RIQSQTVGQGSDAHFRVRVVGK 2104
             E  ++T   I   K    ELS +     +EA   F  ++  +T  +  +   +  V   
Sbjct: 5133 LEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEV--S 5190

Query: 2105 PDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIA--GETSS 2162
             D   +W+K+G +I  S       P+ ++    +R +     A +  K   +   G   +
Sbjct: 5191 KDVPVKWFKDGEEIVPS-------PKYSIKADGLRRILKIKKADLKDKGEYVCDCGTDKT 5243

Query: 2163 HAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRM 2222
             A + V+A+ LI   + L  V     +T A FE E SEP V  +W   G  +       +
Sbjct: 5244 KANVTVEAR-LIKVEKPLYGVEVFVGET-AHFEIELSEPDVHGQWKLKGQPLTASPDCEI 5301

Query: 2223 HSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESY 2282
              D K H L +         + S    +  N K+ A L V+   + F+  L D++V E  
Sbjct: 5302 IEDGKKHILILHNCQLGMTGEVS---FQAANAKSAANLKVKELPLIFITPLSDVKVFEKD 5358

Query: 2283 SGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDG 2342
              + EC VS E    +W     E+  + ++ +     + ++ +K    ED+ +Y F  + 
Sbjct: 5359 EAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEAKYMFEAED 5418

Query: 2343 KKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVH 2402
            K T+ KL ++   +  L  L D    E +     V++S +++   W K+ Q +  +  V 
Sbjct: 5419 KHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQRLHTTRSVS 5478

Query: 2403 IVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVD--VITPLKDVNVIEGT 2460
            +  + ++H +  +D++ +D       + A+G+S+  +++V   D      L+D   +E  
Sbjct: 5479 MQDEGKTHSITFKDLSIDDTS--QIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKD 5536

Query: 2461 KAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVG 2520
            + +L+C++S  D   VKW+ + ++IKP         G K+ L++ +   SD G Y    G
Sbjct: 5537 EVILQCEISKAD-APVKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQYTCDCG 5595

Query: 2521 RVETNCNLSVE--KIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKY 2578
              +T+  L +E  +IK++R L  +   ET+   FE E+S   I   W  K + +  +   
Sbjct: 5596 TDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEALLQTPDC 5655

Query: 2579 KIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPLTDQTVAESQE 2636
            +I+  GKI+ L + N   D  G   F A    +S  L V    I   +PL D TV   + 
Sbjct: 5656 EIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGET 5715

Query: 2637 AVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATS 2696
            A F+CE++  D   EW   GK L  ++ +   S+G    L +   KL+D GE        
Sbjct: 5716 ATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDF 5775

Query: 2697 KTSAKL--KVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYA 2754
            KT A L  K   V+  K L++ TV E   AV   E++  N K V+W KNG  +  ++KY 
Sbjct: 5776 KTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAK-VKWFKNGTEILKSKKYE 5834

Query: 2755 ISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHV--ETVKIIKKPKDVTALENATV 2812
            I   G +  L I +C   D   Y         S  L+V    V+ ++   D+   E    
Sbjct: 5835 IVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMA 5894

Query: 2813 AFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLE 2872
             FE  +S +   VKWF    EIK   K+ ++S+  V  L++      D  EY+  V    
Sbjct: 5895 RFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTAR 5954

Query: 2873 CKAKLFV--ETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIV 2930
                L V  E    TK + NIEV ET T    CEVS      +W K   EI  + +++I+
Sbjct: 5955 TSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEIL 6014

Query: 2931 VQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAE--EKDTITF 2988
             +G+   L+I N   ED+  Y     + +    + V  +    + K  N E  E +   F
Sbjct: 6015 TEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEF 6074

Query: 2989 EVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATST 3048
              +++ E    +W ++   ++S DK  +        L +++    D   Y  + G A + 
Sbjct: 6075 VCSISKESFPVQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAA 6134

Query: 3049 ATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKE 3108
            A L V    +     +KD +V E++  +F CEV+      +W ++++ +  + +  I ++
Sbjct: 6135 AHLTV-IEKLRIVVPLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQK 6193

Query: 3109 KYVHRLLIPSTRMSDAGKYTVV----AGGNV-STAKLFVEGRDVRIRSIKKEVQVIEKQR 3163
              V+ L I    + D   Y V      G NV S A L VE  D+RI    K+++ +EK+ 
Sbjct: 6194 DLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKS 6253

Query: 3164 AVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAG 3223
                 +VN  +V   W K+G E+ F    R  Y V++  H + I +    D GEY   AG
Sbjct: 6254 VTFWCKVNRLNVTLKWTKNGEEVPF--DNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAG 6311

Query: 3224 RNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGF 3283
            +++S   L +    P + ++ L+  TV     A F   +S R +  + WY+  + +  G 
Sbjct: 6312 QDKSVAELLI-IEAPTEFVEHLEDQTVTEFDDAVFSCQLS-REKANVKWYRNGREIKEGK 6369

Query: 3284 KCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVY 3343
            K KF  DG  + L++ +   +D   Y C      GV    +   + V E+          
Sbjct: 6370 KYKFEKDGSIHRLIIKDCRLDDECEYAC------GVEDRKSRARLFVEEI---------- 6413

Query: 3344 PPAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEI 3403
            P  II P QD + + G    F   ++   ++V W   +  +      +M      ++L+I
Sbjct: 6414 PVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGDKHQMMSEGKIHRLQI 6473

Query: 3404 AEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESI 3439
             +  P D+G Y F+A +      + A L L A   I
Sbjct: 6474 CDIKPRDQGEYRFIAKDK----EARAKLELAAAPKI 6505



 Score =  431 bits (1108), Expect = e-119
 Identities = 492/2068 (23%), Positives = 821/2068 (39%), Gaps = 219/2068 (10%)

Query: 1457 PVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDG-TQSL 1515
            PV   K    +   G  A+F  ++   P     WF  G++I    + K  I+      SL
Sbjct: 4337 PVIKRKIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYE--SDKCSIRSSKYISSL 4394

Query: 1516 IIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAV--EHQVKPMFVEK---------LKN 1564
             I+     D GE+T  A N  G  S +  LTV     E +V+ +  E+         LK+
Sbjct: 4395 EILRTQVVDCGEYTCKASNEYGSVSCTATLTVTVPGGEKKVRKLLPERKPEPKEEVVLKS 4454

Query: 1565 VNIKEGSRLEMKVR----------ATGNPNPD---------IVWLKNSDIIVPHKYPKIR 1605
            V  K     E KV           A   P P           V  +   I  P K P+I+
Sbjct: 4455 VLRKRPEEEEPKVEPKKLEKVKKPAVPEPPPPKPVEEVEVPTVTKRERKIPEPTKVPEIK 4514

Query: 1606 --IEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIP 1663
              I     E   K ++ V                   T   V  + E   P+ E     P
Sbjct: 4515 PAIPLPAPEPKPKPEAEVKTIKPPPVEPEPTPIAAPVTVPVVGKKAEAKAPKEEAAK--P 4572

Query: 1664 RGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPF----------FKKKLTSLR 1713
            +G  +      P+  P  +   + +   G   +K   + PF          F K++  + 
Sbjct: 4573 KGPIKG----VPKKTPSPIEAERRKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEIKDII 4628

Query: 1714 LKRF----GPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYS 1769
            L         A FEC ++P    T +  W+ DG  +  + + R I +     L       
Sbjct: 4629 LTESEFVGSSAIFECLVSP---STAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQL 4685

Query: 1770 RDSGIITC--RATNKYGTDHTSATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGA 1827
             D+G  TC  R  NK  T  ++A L+V+         +LP     ++ ++ LE       
Sbjct: 4686 SDAGEYTCVLRLGNKEKT--STAKLVVE---------ELP-----VRFVKTLE------- 4722

Query: 1828 LTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLI-RKSKR 1886
                                E V V++G+     C +    +  V W  +G+++  K  R
Sbjct: 4723 --------------------EEVTVVKGQPLYLSCELN--KERDVVWRKDGKIVVEKPGR 4760

Query: 1887 FRVRYDGI-HYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRR-APE 1944
                  G+   L I D    D G   VT EN          LE         V+R    +
Sbjct: 4761 IVPGVIGLMRALTINDADDTDAGTYTVTVENANN-------LECSSCVKVVEVIRDWLVK 4813

Query: 1945 PRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKR--AERITHEKVPEESEELRSKFK 2002
            P  + HV   G   F     D   DT   K         AE     ++  +   L  K K
Sbjct: 4814 PIRDQHVKPKGTAIFAC---DIAKDTPNIKWFKGYDEIPAEPNDKTEILRDGNHLYLKIK 4870

Query: 2003 RRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEEGKITIP 2062
                E   E   AVE++ ++        L + + ELL   +++T  EK++ + + +I+  
Sbjct: 4871 NAMPEDIAEY--AVEIEGKRYPAKLT--LGEREVELLKPIEDVTIYEKESASFDAEISEA 4926

Query: 2063 TFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSD 2122
               P + +L   +                            +P P CE     +K E   
Sbjct: 4927 DI-PGQWKLKGELL---------------------------RPSPTCE-----IKAEGGK 4953

Query: 2123 RIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQD 2182
            R            L +  V  + +  ++ +A+N      + A L V+  +L  F   L+D
Sbjct: 4954 RF-----------LTLHKVKLDQAGEVLYQALNAI----TTAILTVKEIEL-DFAVPLKD 4997

Query: 2183 VVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAE 2242
            V   E+   A FEC  +     V W K    +   DK+ + +D K H   IL I+ S  +
Sbjct: 4998 VTVPER-RQARFECVLTRE-ANVIWSKGPDIIKSSDKFDIIADGKKH---ILVINDSQFD 5052

Query: 2243 DYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHN 2302
            D      E E  KT+A+L V G  ++F+  L+D  V E  +    C +S E +   W+ N
Sbjct: 5053 DEGVYTAEVEGKKTSARLFVTGIRLKFMSPLEDQTVKEGETATFVCELSHEKMHVVWFKN 5112

Query: 2303 DVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGL 2362
            D +L ++    I+S      L +K+VT +D  +    +    +T +LK+          L
Sbjct: 5113 DAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSSTAQLKVLEADPYFTVKL 5172

Query: 2363 SDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDA 2422
             D+   E D + L+ +VS + V   W KDG+E+ PS +  I  D    +L I+    +D 
Sbjct: 5173 HDKTAVEKDEITLKCEVS-KDVPVKWFKDGEEIVPSPKYSIKADGLRRILKIKKADLKDK 5231

Query: 2423 GNYSFTIPALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLND 2482
            G Y           +  V    + V  PL  V V  G  A  E ++S PDV   +W L  
Sbjct: 5232 GEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHFEIELSEPDVHG-QWKLKG 5290

Query: 2483 EQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKI--IRGLR 2540
            + +      + I  G K  L+++       G         ++  NL V+++ +  I  L 
Sbjct: 5291 QPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKSAANLKVKELPLIFITPLS 5350

Query: 2541 DLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEG 2600
            D+   E     FE E+S       W    +EI    ++++   G  + + + +   +DE 
Sbjct: 5351 DVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFELIKDGTKHSMVIKSAAFEDEA 5410

Query: 2601 KYTFYAGENMTSGKLTVAGGAIS--KPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKH 2658
            KY F A +  TSGKL + G  +    PL D T  E + AVF  E+++ + + +W ++ + 
Sbjct: 5411 KYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAKEKESAVFTVELSHDNIRVKWFKNDQR 5470

Query: 2659 LPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKT--LKNL 2716
            L  T ++  + +G    +      +DD  +   +     + AKL V       T  L++ 
Sbjct: 5471 LHTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDY 5530

Query: 2717 TVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESV 2776
            T  E  + +   E++  +   V+W K+G  ++ ++   I   G    L +K     D   
Sbjct: 5531 TGVEKDEVILQCEISKADAP-VKWFKDGKEIKPSKNAVIKADGKKRMLILKKALKSDIGQ 5589

Query: 2777 YGFRLGRLGASARLHVE--TVKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEI 2834
            Y    G    S +L +E   +K+++    V  +E  T  FE  +S D +   W  K   +
Sbjct: 5590 YTCDCGTDKTSGKLDIEDREIKLVRPLHSVEVMETETARFETEISEDDIHANWKLKGEAL 5649

Query: 2835 KPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVE--TLHITKTMKNIE 2892
              +    +  E K+H L+L N      G        ++  A L V+   + + + +K++ 
Sbjct: 5650 LQTPDCEIKEEGKIHSLVLHNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVT 5709

Query: 2893 VPETKTASFECEVSHFNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYT 2952
            V   +TA+F+CE+S+ ++P  W   G ++E S+K     +GK+H L + +   ED+ E  
Sbjct: 5710 VTAGETATFDCELSYEDIPVEWYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQ 5769

Query: 2953 FVCGNDQVSATLTV--TPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKS 3010
                + +  A L V   P+  T  L+D   EE  T   E  V+ E    KW KNG EI  
Sbjct: 5770 LTAKDFKTHANLFVKEPPVEFTKPLEDQTVEEGATAVLECEVSRENAKVKWFKNGTEILK 5829

Query: 3011 TDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVL 3070
            + K ++        L I +    D   YT  A    ++  L V   H+EF + + D++V 
Sbjct: 5830 SKKYEIVADGRVRKLVIHDCTPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVR 5889

Query: 3071 EKKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVV 3130
            EK+ A FECE+S  +  V+W KD  E++   +  I  +  V  L+I    + D  +Y+  
Sbjct: 5890 EKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCE 5949

Query: 3131 AGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQV 3190
                 ++  L V   +         ++V E     +  EV++   +  WYK   EI    
Sbjct: 5950 VRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEI--IE 6007

Query: 3191 QERHKYVVERRIHRMFISETRQSDAGEYT--FVAGRNRSSVTLYVNAPEPPQVLQELQPV 3248
              R++ + E R   + I      DAG Y     + R    V ++  A E    + + Q +
Sbjct: 6008 TGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDGKVKVHELAAE---FISKPQNL 6064

Query: 3249 TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAV 3308
             +  G+ A F   IS    P + W ++++ L +G K   + DG++  L++ +A  +D   
Sbjct: 6065 EILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGT 6123

Query: 3309 YTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRV 3368
            Y        G A  +A L+V             +    I+ PL+DT   E Q   F C V
Sbjct: 6124 YVVMV----GAARAAAHLTV-------------IEKLRIVVPLKDTRVKEQQEVVFNCEV 6166

Query: 3369 SGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ-VSS 3427
            +    K  W+  ++ I  S  + + Q +  Y L I +A+ +D+  Y    +N  G+ V S
Sbjct: 6167 NTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKS 6226

Query: 3428 TANLSLEAPESILHERIEQEIEMEMKEL 3455
             ANL +E  +  + E ++    ME K +
Sbjct: 6227 AANLIVEEEDLRIVEPLKDIETMEKKSV 6254



 Score =  427 bits (1098), Expect = e-118
 Identities = 449/1826 (24%), Positives = 751/1826 (41%), Gaps = 184/1826 (10%)

Query: 1456 KPVFVLKPVSFKCL-EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQS 1514
            + V +LKP+    + E ++A FD ++    +P   W   G+ +    T ++   E G + 
Sbjct: 4898 REVELLKPIEDVTIYEKESASFDAEISEADIPGQ-WKLKGELLRPSPTCEIKA-EGGKRF 4955

Query: 1515 LIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLE 1574
            L +       +GE    A N    +  + ILTV+ +E      F   LK+V + E  +  
Sbjct: 4956 LTLHKVKLDQAGEVLYQALN----AITTAILTVKEIELD----FAVPLKDVTVPERRQAR 5007

Query: 1575 MKVRATGNPNPDIVWLKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAIN 1634
             +   T   N  ++W K  DII       I  +G K    L I+ +   D   YTA    
Sbjct: 5008 FECVLTREAN--VIWSKGPDIIKSSDKFDIIADGKKH--ILVINDSQFDDEGVYTAEVEG 5063

Query: 1635 KAGRDTTRCKVN-VEVEFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGD 1693
            K  + + R  V  + ++F  P  ++       T +  E A    E  H            
Sbjct: 5064 K--KTSARLFVTGIRLKFMSPLEDQ-------TVKEGETATFVCELSH------------ 5102

Query: 1694 LYDKEKQQKPFFKK--KLTSLR---LKRFGPAH-FECRLTPIGDPTMVVEWLHDGKPLEA 1747
                EK    +FK   KL + R   +   G  H  E +   + D + +   +   K L +
Sbjct: 5103 ----EKMHVVWFKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQV---KELSS 5155

Query: 1748 ANRLRMINEFGYCS--LDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQ 1805
              +L+++    Y +  L    A  +D   + C  +              KD + +V   +
Sbjct: 5156 TAQLKVLEADPYFTVKLHDKTAVEKDEITLKCEVSKDVPVKW------FKDGEEIVPSPK 5209

Query: 1806 LPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLE---------GE 1856
                  GL+RI ++++   +     V     +K K ++ +    ++V +         GE
Sbjct: 5210 YSIKADGLRRILKIKKADLKDKGEYVCDCGTDKTKANVTVEARLIKVEKPLYGVEVFVGE 5269

Query: 1857 TARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYDGI-HYLDIVDCKSYDTGEVKVTAE 1915
            TA F   ++  P     W L GQ +  S    +  DG  H L + +C+   TGEV   A 
Sbjct: 5270 TAHFEIELSE-PDVHGQWKLKGQPLTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAA 5328

Query: 1916 NPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKE 1975
            N +     KVK           +      P  +  V E  + +FE +       + E K 
Sbjct: 5329 NAKSAANLKVK----------ELPLIFITPLSDVKVFEKDEAKFECEV------SREPKT 5372

Query: 1976 VVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTK 2035
               LK  + IT                                     D+ +E +   TK
Sbjct: 5373 FRWLKGTQEIT------------------------------------GDDRFELIKDGTK 5396

Query: 2036 DELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDA 2095
              ++  +    +E K     E K T      + I L       K    ++  T  +   A
Sbjct: 5397 HSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRL-------KFLTPLKDVTAKEKESA 5449

Query: 2096 HFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAIN 2155
             F V  +   +   +W+KN  ++  + R      E     +  +D++ +D++ I V+A+ 
Sbjct: 5450 VFTVE-LSHDNIRVKWFKNDQRL-HTTRSVSMQDEGKTHSITFKDLSIDDTSQIRVEAMG 5507

Query: 2156 IAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVH 2215
            ++ E       L   +    FT +LQD    EKD +   +CE S+    VKW+KDG E+ 
Sbjct: 5508 MSSEAK-----LTVLEGDPYFTGKLQDYTGVEKDEV-ILQCEISKADAPVKWFKDGKEIK 5561

Query: 2216 EGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQD 2275
                  + +D K   L +     SD   Y+C    D   KT+ KL +E   ++ V+ L  
Sbjct: 5562 PSKNAVIKADGKKRMLILKKALKSDIGQYTCDCGTD---KTSGKLDIEDREIKLVRPLHS 5618

Query: 2276 IEVPESYSGELECIVSPENIEGKW--------YHNDVELKSNGKYTITSRRGRQNLTVKD 2327
            +EV E+ +   E  +S ++I   W           D E+K  GK          +L + +
Sbjct: 5619 VEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKI--------HSLVLHN 5670

Query: 2328 VTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGV 2387
               +  G   F     K++  L++KPR I +L+ L D  V  G+    + ++S E +   
Sbjct: 5671 CRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIPVE 5730

Query: 2388 WMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDV 2447
            W   G++++PSD+V    + + H L + D+  EDAG    T        +  V    V+ 
Sbjct: 5731 WYLKGKKLEPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFVKEPPVEF 5790

Query: 2448 ITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRT 2507
              PL+D  V EG  AVLEC+VS  +   VKW+ N  +I    + + +  G  ++LVI+  
Sbjct: 5791 TKPLEDQTVEEGATAVLECEVS-RENAKVKWFKNGTEILKSKKYEIVADGRVRKLVIHDC 5849

Query: 2508 HASDEGPYKLIVGRVETNCNLSV--EKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLW 2565
               D   Y       +T+CNL+V    ++ +R L DL   E +   FE ELS     V W
Sbjct: 5850 TPEDIKTYTCDAKDFKTSCNLNVVPPHVEFLRPLTDLQVREKEMARFECELSRENAKVKW 5909

Query: 2566 NFKD-KEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTV--AGGAI 2622
             FKD  EIK   KY I + G +  L +   + DDE +Y+       TSG LTV       
Sbjct: 5910 -FKDGAEIKKGKKYDIISKGAVRILVINKCLLDDEAEYSCEVRTARTSGMLTVLEEEAVF 5968

Query: 2623 SKPLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATK 2682
            +K L +  V+E+      CEV+ P ++  W +  + +  T      ++G KR L+I    
Sbjct: 5969 TKNLANIEVSETDTIKLVCEVSKPGAEVIWYKGDEEIIETGRYEILTEGRKRILVIQNAH 6028

Query: 2683 LDDIGEYTYKVATSKTSAKLKVE--AVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQW 2740
            L+D G Y  ++ +S+T  K+KV   A +     +NL + E + A F   ++  +   VQW
Sbjct: 6029 LEDAGNYNCRLPSSRTDGKVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFP-VQW 6087

Query: 2741 IKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHV-ETVKIIK 2799
             ++   LES +KY +   G    L +K+  + D   Y   +G   A+A L V E ++I+ 
Sbjct: 6088 KRDDKTLESGDKYDVIADGKKRVLVVKDATLQDMGTYVVMVGAARAAAHLTVIEKLRIVV 6147

Query: 2800 KPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPS 2859
              KD    E   V F   V+ +    KWF     I  S K+ ++ +  V+ L +++    
Sbjct: 6148 PLKDTRVKEQQEVVFNCEVNTEGAKAKWFRNEEAIFDSSKYIILQKDLVYTLRIRDAHLD 6207

Query: 2860 DAGEYTAVV-----GQLECKAKLFV--ETLHITKTMKNIEVPETKTASFECEVSHFNVPS 2912
            D   Y   +       ++  A L V  E L I + +K+IE  E K+ +F C+V+  NV  
Sbjct: 6208 DQANYNVSLTNHRGENVKSAANLIVEEEDLRIVEPLKDIETMEKKSVTFWCKVNRLNVTL 6267

Query: 2913 MWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTV--TPIM 2970
             W KNG E+    +    V    H L I +    D  EY    G D+  A L +   P  
Sbjct: 6268 KWTKNGEEVPFDNRVSYRVDKYKHMLTIKDCGFPDEGEYIVTAGQDKSVAELLIIEAPTE 6327

Query: 2971 ITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNV 3030
                L+D    E D   F   ++ E  + KW +NG EIK   K +       H L I++ 
Sbjct: 6328 FVEHLEDQTVTEFDDAVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDC 6387

Query: 3031 HFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQW 3090
               D  +Y        S A L+VE   +E  +  +DI        +F  E+++  + VQW
Sbjct: 6388 RLDDECEYACGVEDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQW 6447

Query: 3091 MKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIR 3150
            ++++  +   D+ ++  E  +HRL I   +  D G+Y  +A    + AKL +     +I+
Sbjct: 6448 LRNNMVVVQGDKHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIK 6506

Query: 3151 SIKKE--VQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFIS 3208
            +  ++  V V +    VV ++      +A W+K+   ++ +  +      E+   R  I 
Sbjct: 6507 TADQDLVVDVGKPLTMVVPYDA-YPKAEAEWFKENEPLSTKTIDT---TAEQTSFR--IL 6560

Query: 3209 ETRQSDAGEYTFVAGRNRSSVTLYVN 3234
            E ++ D G Y  V          ++N
Sbjct: 6561 EAKKGDKGRYKIVLQNKHGKAEGFIN 6586



 Score =  345 bits (886), Expect = 6e-94
 Identities = 482/2168 (22%), Positives = 867/2168 (39%), Gaps = 337/2168 (15%)

Query: 2078 PKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWY-WPEDNV--- 2133
            P   E++++  + +GS    +VR  G P+P+  W KN      SD I  + +P+  +   
Sbjct: 1510 PMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKN------SDIIVPHKYPKIRIEGT 1563

Query: 2134 ---CELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ--------------------A 2170
                 L I    ++DSA     AIN AG  ++   + V+                    A
Sbjct: 1564 KGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEVEFAEPEPERKLIIPRGTYRA 1623

Query: 2171 KQL---------ITFTQELQ---DVVAKEKDTM-----------------ATFECETS-- 2199
            K++         + + QE     D+  KEK                    A FEC  +  
Sbjct: 1624 KEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHFECRLTPI 1683

Query: 2200 -EPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDEN----- 2253
             +P + V+W  DG  +   ++ RM ++     L      + D+   +C            
Sbjct: 1684 GDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTS 1743

Query: 2254 ----VKTTAKLIVEGAVVEFVKELQDIEVPE--SYSGEL-------------ECIVSPEN 2294
                VK    L+ E  + E  K LQ IE  E  ++ G L             + ++ PE 
Sbjct: 1744 ATLIVKDEKSLVEESQLPEGRKGLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEP 1803

Query: 2295 I---EGK-----------------WYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQG 2334
            +   EG+                 WY N   ++ + ++ +    G   L + D    D G
Sbjct: 1804 VRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD-GIHYLDIVDCKSYDTG 1862

Query: 2335 EYSFVIDGKKTTCKLKMK------------------PRPIAILQGLSDQKVCEGDIVQLE 2376
            E     +  +   + K+K                  PRP        +  V E   +Q E
Sbjct: 1863 EVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRP--------EFHVHEPGKLQFE 1914

Query: 2377 VKVSLESVEGVWMKDGQEVQPSDRV-HIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLS 2435
            V+     V+    K+  +++ ++R+ H  + ++S  L  +   + + G Y   I A+ L 
Sbjct: 1915 VQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYE-AITAVELK 1973

Query: 2436 TSGRVSVYSVDVITPLKDV------NVIEGTKAVL--ECKVSVPDVTSVKWYLNDEQIKP 2487
            +  +   Y  +++   KD        + E  K  L  E K+++P     K  L+     P
Sbjct: 1974 SRKKDESYE-ELLRKTKDELLHWTKELTEEEKKALAEEGKITIPTFKPDKIELSPSMEAP 2032

Query: 2488 D--DRVQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCT 2545
               +R+Q+   G            SD      +VG+ +  C      +KI R  R     
Sbjct: 2033 KIFERIQSQTVG----------QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYW 2082

Query: 2546 ETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFY 2605
               NV   V             +D   + S+   ++A         +N+           
Sbjct: 2083 PEDNVCELV------------IRDVTAEDSASIMVKA---------INI----------- 2110

Query: 2606 AGENMTSGKLTVAGGAI---SKPLTDQTVAESQE-AVFECEVANPDSKGEWLRDGKHLPL 2661
            AGE  +   L V    +   ++ L D    E    A FECE + P  K +W +DG  +  
Sbjct: 2111 AGETSSHAFLLVQAKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHE 2170

Query: 2662 TNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATS---KTSAKLKVEA--VKIKKTLKNL 2716
             +  R  SD     L I      D  +Y+  +      KT+AKL VE   V+  K L+++
Sbjct: 2171 GDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDI 2230

Query: 2717 TVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGTIYSLRIKNCAIVDESV 2776
             V E+        ++  N++G +W  N V L+SN KY I+ +    +L +K+    D+  
Sbjct: 2231 EVPESYSGELECIVSPENIEG-KWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGE 2289

Query: 2777 YGFRLGRLGASARLHVET--VKIIKKPKDVTALENATVAFEVSVSHDTVPVKWFHKSVEI 2834
            Y F +     + +L ++   + I++   D    E   V  EV VS ++V   W     E+
Sbjct: 2290 YSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGVWMKDGQEV 2349

Query: 2835 KPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQL--ECKAKLFVETLHITKTMKNIE 2892
            +PSD+  +V +++ H L++++++  DAG Y+  +  L      ++ V ++ +   +K++ 
Sbjct: 2350 QPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIPALGLSTSGRVSVYSVDVITPLKDVN 2409

Query: 2893 VPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEY 2951
            V E   A  EC+VS  +V S+ W  N  +I+  ++ + +V+G   +L+I  T   D   Y
Sbjct: 2410 VIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPY 2469

Query: 2952 TFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKST 3011
              + G  + +  L+V  I I   L+D+   E   + FEV +++ GI   W     EIK +
Sbjct: 2470 KLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPS 2529

Query: 3012 DKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLE 3071
             K ++      + L + N+   D   YTF AG+  ++  L V    I   K + D  V E
Sbjct: 2530 SKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAIS--KPLTDQTVAE 2587

Query: 3072 KKRAMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRMSDAGKYTVVA 3131
             + A+FECEV+ PD   +W++D + L +T+ I+ + + +  RL+I +T++ D G+YT   
Sbjct: 2588 SQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKV 2647

Query: 3132 GGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDA-HWYKDGIEINFQV 3190
              + ++AKL VE   V+I+   K + V E Q AV   E+   +V    W K+G+ +  + 
Sbjct: 2648 ATSKTSAKLKVEA--VKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVL--ES 2703

Query: 3191 QERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPVTV 3250
             E++   V+  I+ + I      D   Y F  GR  +S  L+V   E  +++++ + VT 
Sbjct: 2704 NEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGASARLHV---ETVKIIKKPKDVTA 2760

Query: 3251 QSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYT 3310
                   F   +S    P + W+ +   +    K + + + + + L+L    P DA  YT
Sbjct: 2761 LENATVAFEVSVSHDTVP-VKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYT 2819

Query: 3311 CEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRVSG 3370
                   G     A L VE   +    + + V               E + A F+C VS 
Sbjct: 2820 AVV----GQLECKAKLFVETLHITKTMKNIEV--------------PETKTASFECEVSH 2861

Query: 3371 TDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTAN 3430
             ++   W     +I+ S  F++      +QL I     ED   YTFV  N   QVS+T  
Sbjct: 2862 FNVPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGN--DQVSATLT 2919

Query: 3431 LSLEAPESILHERIEQEIEMEMKELFSEGESEHSERDTRDAFSDSEDI---DHKSMAAKR 3487
            ++     S+L     ++I  E K+  +   + + E  +     +  +I   D   M  K+
Sbjct: 2920 VTPIMITSML-----KDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKK 2974

Query: 3488 Y--------------------ASRISSTSS-WPEYFKPSFTQKLTFKYVLEGEPVVFTCR 3526
                                 A + +ST++ + E     F + +    VLE +  +F C 
Sbjct: 2975 LTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECE 3034

Query: 3527 LIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSSLEIKRVQDRDSGSYRLLAINSE 3586
             ++ P   + W  +++ +    R  I+ E  +H     L I   +  D+G Y ++A    
Sbjct: 3035 -VSEPDITVQWMKDDQELQITDRIKIQKEKYVHR----LLIPSTRMSDAGKYTVVA---- 3085

Query: 3587 GSAESTASLLVIQKGQDEKYLEFLKRAERTHENVEALVERGEDRIKVDLRFTGSPFNKKQ 3646
            G   STA L V  +G+D + +  +K+  +  E   A+VE   +   VD  +         
Sbjct: 3086 GGNVSTAKLFV--EGRDVR-IRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYKDGIEINF 3142

Query: 3647 DVEQKG---MMRTIHFKTMSSAKKTDY-MYDEEYLESKSDIRGWLNVGE--SFLDKETKV 3700
             V+++    + R IH   +S  +++D   Y      ++S +  ++N  E    L +   V
Sbjct: 3143 QVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLYVNAPEPPQVLQELQPV 3202

Query: 3701 KLQRLREAR-------------------KTLMEKKKLSLLDTSSEISSRTLRSEASDKDI 3741
             +Q  + AR                   + L    K   L    E +   + +   D  +
Sbjct: 3203 TVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLLIEAFPEDAAV 3262

Query: 3742 LF--SREDMKIR--SMSDLAESYKVDHSAESIVQNPHALSNQMDQNIESEELPTSFQTIV 3797
                ++ D  +   S S   E  +V    + +   P A+   +   + SE  P  FQ  V
Sbjct: 3263 YTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSEGQPARFQCRV 3322

Query: 3798 DEEIFQTEIRMSQEALVKESLPK--------DHLYGEILVNENTQARGQLEEIMANTTIG 3849
                  T++++S  +  K+  P         +  Y   +     +  G    + +N    
Sbjct: 3323 SG----TDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQ 3378

Query: 3850 ESSTYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASERIKKDDLRELQ 3909
             SST   ++   E +    E + Q I     E   + ++ EE E + S         ELQ
Sbjct: 3379 VSSTANLSLEAPESILH--ERIEQEIEMEMKEFSSSFLSAEE-EGLHSA--------ELQ 3427

Query: 3910 LSASTRIDEFKTEQKEENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQG 3969
            LS      E  +E        +   F    +   P F++E+ + ++  GD         G
Sbjct: 3428 LSKINETLELLSESP-----VYPTKFDSEKEGTGPIFIKEVSNADISMGDVATLSVTVIG 3482

Query: 3970 YPQPIVTWYNNDMPIPRNQNF-IIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTT 4028
             P+P + W+ N + +  + ++  +   +++S++ L +   ++EG  TC+  N YG    +
Sbjct: 3483 IPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFT-KLEDEGEYTCMASNDYGKTICS 3541

Query: 4029 SMLKVKAK 4036
            + LK+ +K
Sbjct: 3542 AYLKINSK 3549



 Score =  344 bits (882), Expect = 2e-93
 Identities = 497/2294 (21%), Positives = 888/2294 (38%), Gaps = 327/2294 (14%)

Query: 2091 QGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIM 2150
            +G  A F ++VVG+P PE  W+ +G +I           ED    L+I   T  DS    
Sbjct: 1424 EGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKEDGTQSLIIVPATPSDSGEWT 1483

Query: 2151 VKAINIAGETSSHAFLLVQAKQLIT---FTQELQDVVAKEKDTMATFECETSEPFVKVKW 2207
            V A N AG +S    L V+A +      F ++L++V  KE   +      T  P   + W
Sbjct: 1484 VVAQNRAGRSSISVILTVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVW 1543

Query: 2208 YK--DGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVEDENVKTT-AKLIVEG 2264
             K  D +  H+  K R+   +    L I +  + D+  Y+   +      TT  K+ VE 
Sbjct: 1544 LKNSDIIVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVEV 1603

Query: 2265 AVVEFVKELQDIEVPESYSGELECIVSPENI----------EGKWYHNDVELKSNGKYTI 2314
               E   E + I    +Y  +       E +          EG  Y  + + K   K  +
Sbjct: 1604 EFAEPEPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKL 1663

Query: 2315 TSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEG---- 2370
            TS R ++            G   F        C+L     P  +++ L D K  E     
Sbjct: 1664 TSLRLKRF-----------GPAHF-------ECRLTPIGDPTMVVEWLHDGKPLEAANRL 1705

Query: 2371 ------DIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGN 2424
                      L+  V+     G+          +D     +  +    L+E+    +   
Sbjct: 1706 RMINEFGYCSLDYGVAYSRDSGIITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRK 1765

Query: 2425 YSFTIP---------ALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTS 2475
                I          AL   T+ +      D++   + V V+EG  A   C+V+      
Sbjct: 1766 GLQRIEELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPK 1825

Query: 2476 VKWYLNDEQIKPDDRVQAIVKGTKQRLVINRTHASDEGPYKLIV----GRVETNCNLSVE 2531
            V WYLN + I+   R +    G     +++   + D G  K+      G +E    L ++
Sbjct: 1826 VNWYLNGQLIRKSKRFRVRYDGIHYLDIVD-CKSYDTGEVKVTAENPEGVIEHKVKLEIQ 1884

Query: 2532 KIKIIRGLR--------DLTCTETQNVVFEVELSHSGIDVLWNFKDKEIKPSSKYKIEAH 2583
            + +  R +         +    E   + FEV+     +D     + KE+    + +   H
Sbjct: 1885 QREDFRSVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTT---ETKEVVKLKRAERITH 1941

Query: 2584 GKI----YKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISKPLTDQTVAESQEAVF 2639
             K+     +L      + +EG Y       + S K   +   + +   D+ +  ++E   
Sbjct: 1942 EKVPEESEELRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTE 2001

Query: 2640 ECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLDDIGEYTYKVATSKTS 2699
            E        K     +GK                  + I   K D            K  
Sbjct: 2002 E-------EKKALAEEGK------------------ITIPTFKPD------------KIE 2024

Query: 2700 AKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEK-YAISVK 2758
                +EA KI + +++ TV +  DA F V +        +W KNGV +E +++ Y    +
Sbjct: 2025 LSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPE 2084

Query: 2759 GTIYSLRIKNCAIVDESVYGFRL----GRLGASARLHVETVKII---KKPKDVTALENAT 2811
              +  L I++    D +    +     G   + A L V+  ++I   ++ +DV A E  T
Sbjct: 2085 DNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2144

Query: 2812 VA-FEVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQ 2870
            +A FE   S   V VKW+   +E+   DK+R+ S+RKVH L +  I  SDA +Y+ V+ +
Sbjct: 2145 MATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2204

Query: 2871 ---LECKAKLFVE--TLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMSE 2925
               ++  AKL VE   +   K +++IEVPE+ +   EC VS  N+   W  N VE++ + 
Sbjct: 2205 DENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNG 2264

Query: 2926 KFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTP--IMITSMLKDINAEEK 2983
            K+ I  +     L + + + ED  EY+FV    + +  L + P  I I   L D    E 
Sbjct: 2265 KYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEG 2324

Query: 2984 DTITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAG 3043
            D +  EV V+ E +   W+K+G E++ +D+  +   K +H L I ++   DA +Y+F   
Sbjct: 2325 DIVQLEVKVSLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTIP 2384

Query: 3044 KATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDIT-VQWMKDDQELQITDR 3102
                + +  V    ++    +KD+ V+E  +A+ EC+VS PD+T V+W  +D++++  DR
Sbjct: 2385 ALGLSTSGRVSVYSVDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDR 2444

Query: 3103 IKIQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQ 3162
            ++   +    RL+I  T  SD G Y ++ G   +   L VE   ++I    +++   E Q
Sbjct: 2445 VQAIVKGTKQRLVINRTHASDEGPYKLIVGRVETNCNLSVE--KIKIIRGLRDLTCTETQ 2502

Query: 3163 RAVVEFEVNEDDVDAHW-YKDGIEINFQVQERHKYVVER--RIHRMFISETRQSDAGEYT 3219
              V E E++   +D  W +KD      +++   KY +E   +I+++ +    + D G+YT
Sbjct: 2503 NVVFEVELSHSGIDVLWNFKDK-----EIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYT 2557

Query: 3220 FVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARF-CAVISGRPQPKISWYKEEQL 3278
            F AG N +S  L V       + + L   TV   + A F C V +  P  K  W ++ + 
Sbjct: 2558 FYAGENMTSGKLTVAGGA---ISKPLTDQTVAESQEAVFECEVAN--PDSKGEWLRDGKH 2612

Query: 3279 LSTGFKCKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQ 3338
            L      +   DG +  L++     +D   YT      Y VAT+  S  ++V  V     
Sbjct: 2613 LPLTNNIRSESDGHKRRLIIAATKLDDIGEYT------YKVATSKTSAKLKVEAV----- 2661

Query: 3339 EMPVYPPAIITPLQDTVTSEGQPARFQCRVSGTDLK-VSWYSKDKKIKPSRFFRMTQFED 3397
                    I   L++   +E Q A F   ++  ++K V W      ++ +  + ++    
Sbjct: 2662 -------KIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNGVVLESNEKYAISVKGT 2714

Query: 3398 TYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFS 3457
             Y L I      DE  Y F     +G++ ++A L +E  + I  ++ +    +E   +  
Sbjct: 2715 IYSLRIKNCAIVDESVYGF----RLGRLGASARLHVETVKII--KKPKDVTALENATVAF 2768

Query: 3458 EGESEHS-------ERDTRDAFSD-----SEDIDHKSMA-------AKRYASRISSTSSW 3498
            E    H         +      SD     SE   HK M        A  Y + +      
Sbjct: 2769 EVSVSHDTVPVKWFHKSVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEYTAVVGQLECK 2828

Query: 3499 PEYFKPSFTQKLTFKY--VLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAES 3556
             + F  +     T K   V E +   F C +     P M W  N   I    +  I  + 
Sbjct: 2829 AKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSM-WLKNGVEIEMSEKFKIVVQG 2887

Query: 3557 DLHHHSSSLEIKRVQDRDSGSYRLLA----------------------INSEGSAESTAS 3594
             LH     L I      DS  Y  +                       IN+E     T  
Sbjct: 2888 KLHQ----LIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKDTITFE 2943

Query: 3595 LLVIQKGQDEKYLEF---LKRAERTHENVEALVERGEDRI-----KVDLRFTGSPFNKKQ 3646
            + V  +G   K+L+    +K  ++     + L      R        D  F         
Sbjct: 2944 VTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTA 3003

Query: 3647 D--VEQKGMMRTIHFKTMSSAKKTDYMYDEEYLESKSDIRGWLNVGESFLDKETKVKLQR 3704
               VE + +    H K +   +K   M++ E  E    ++ W+   +  L    ++K+Q+
Sbjct: 3004 TLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQ-WMKDDQE-LQITDRIKIQK 3061

Query: 3705 LREARKTLMEKKKLSLLDTSSEISSRTLRSEASDKDILFSREDMKIRSMSDLAESYKVDH 3764
             +   + L+   ++S     + ++        S   +     D++IRS+    +  +   
Sbjct: 3062 EKYVHRLLIPSTRMSDAGKYTVVAG----GNVSTAKLFVEGRDVRIRSIKKEVQVIEKQR 3117

Query: 3765 SAESIVQNPHALSNQMDQNIESEELPTSFQT------IVDEEI---FQTEIRMSQEALVK 3815
            +      N     + +D +   + +  +FQ       +V+  I   F +E R S      
Sbjct: 3118 AVVEFEVN----EDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYT 3173

Query: 3816 ESLPKDHLYGEILVN--ENTQARGQLEEIMANTTIGESSTYITNVCEKEEVYETPENVSQ 3873
                ++     + VN  E  Q   +L+ +   +  G+ + +   +  + +   +     Q
Sbjct: 3174 FVAGRNRSSVTLYVNAPEPPQVLQELQPVTVQS--GKPARFCAVISGRPQPKISWYKEEQ 3231

Query: 3874 AITP-------HASESFGTLVNVEESEEIASERI--KKDDLRELQLSASTRIDEFKTEQK 3924
             ++        H  + + TL+ +E   E A+      K+D      SAS  ++  +    
Sbjct: 3232 LLSTGFKCKFLHDGQEY-TLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSP 3290

Query: 3925 EENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPI 3984
            ++ M  +           PP+ +  ++     EG    F C   G     V+WY+ D  I
Sbjct: 3291 DQEMPVY-----------PPAIITPLQDTVTSEGQPARFQCRVSGTDLK-VSWYSKDKKI 3338

Query: 3985 PRNQNFIIHSLENYSILTLSSVHHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAH 4044
              ++ F +   E+   L ++  + ++EG+ T V  N  G V +T+ L ++A +       
Sbjct: 3339 KPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFVASNAVGQVSSTANLSLEAPES------ 3392

Query: 4045 KVPVFHDYLDEEEELALVFDQAKGAHPSMSQEGQTNLHLLKTNPPVPPSGDTELLSFPVE 4104
               + H+ +++E E+ +   +   +  S  +EG   LH                     E
Sbjct: 3393 ---ILHERIEQEIEMEM--KEFSSSFLSAEEEG---LH-------------------SAE 3425

Query: 4105 IQVTAATPIPEQDKESKEVFQTEELEPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEM 4164
            +Q++       +  E+ E+     + P     ++    P    +F+ +++N    M    
Sbjct: 3426 LQLS-------KINETLELLSESPVYPTKFDSEKEGTGP----IFIKEVSNADISM---- 3470

Query: 4165 PKHARCREGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQ 4224
                    GD   L   + G P+P + WF NGVLL  +  ++F      H L I     +
Sbjct: 3471 --------GDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDDHSLIILFTKLE 3522

Query: 4225 DSGKYKCVAENNSG 4238
            D G+Y C+A N+ G
Sbjct: 3523 DEGEYTCMASNDYG 3536



 Score =  191 bits (486), Expect = 1e-47
 Identities = 323/1397 (23%), Positives = 547/1397 (39%), Gaps = 219/1397 (15%)

Query: 3000 KWLKNGVEIKSTDKCQMR-TKKLTHSLNIRNVHFGDAADYTF----VAGKATSTATLYVE 3054
            +W KNGV+I+ +D+      +     L IR+V   D+A        +AG+ +S A L V+
Sbjct: 2064 EWYKNGVKIERSDRIYWYWPEDNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQ 2123

Query: 3055 ARH-IEFRKHIKDIKVLEKKR-AMFECEVSEPDITVQWMKDDQELQITDRIKIQKEKYVH 3112
            A+  I F + ++D+   EK   A FECE SEP + V+W KD  E+   D+ ++  ++ VH
Sbjct: 2124 AKQLITFTQELQDVVAKEKDTMATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVH 2183

Query: 3113 RLLIPSTRMSDAGKYT--VVAGGNV-STAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFE 3169
             L I +   SDA  Y+  +V   NV +TAKL VEG  V      ++++V E     +E  
Sbjct: 2184 FLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECI 2243

Query: 3170 VNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHR--MFISETRQSDAGEYTFVAGRNRS 3227
            V+ ++++  WY + +E+    +   KY +  R  R  + + +  + D GEY+FV    ++
Sbjct: 2244 VSPENIEGKWYHNDVEL----KSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKT 2299

Query: 3228 SVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKF 3287
            +  L +  P P  +LQ L    V  G   +    +S      + W K+ Q +    +   
Sbjct: 2300 TCKLKMK-PRPIAILQGLSDQKVCEGDIVQLEVKVSLESVEGV-WMKDGQEVQPSDRVHI 2357

Query: 3288 LHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEV-VSPDQEMPVYPPA 3346
            + D Q + LL+ +   EDA  Y                 S  +P + +S    + VY   
Sbjct: 2358 VIDKQSHMLLIEDMTKEDAGNY-----------------SFTIPALGLSTSGRVSVYSVD 2400

Query: 3347 IITPLQDTVTSEGQPARFQCRVSGTDL-KVSWYSKDKKIKPSRFFRMTQFEDTYQLEIAE 3405
            +ITPL+D    EG  A  +C+VS  D+  V WY  D++IKP    +        +L I  
Sbjct: 2401 VITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVQAIVKGTKQRLVINR 2460

Query: 3406 AYPEDEGTYTFVASNAVGQVSSTANLSLEAPESILHERIEQEIEMEMKELFSEGESEHSE 3465
             +  DEG Y  +    VG+V +  NLS+E  + I    +      E + +  E E  HS 
Sbjct: 2461 THASDEGPYKLI----VGRVETNCNLSVEKIKII--RGLRDLTCTETQNVVFEVELSHSG 2514

Query: 3466 RDTRDAFSDSE---DIDHKSMA-AKRYASRI-----------------SSTSSWPEYFKP 3504
             D    F D E      +K  A  K Y   +                 + TS        
Sbjct: 2515 IDVLWNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGG 2574

Query: 3505 SFTQKLTFKYVLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAESDLHHHSSS 3564
            + ++ LT + V E +  VF C  +A P  +  W  + + +P  L   I++ESD   H   
Sbjct: 2575 AISKPLTDQTVAESQEAVFECE-VANPDSKGEWLRDGKHLP--LTNNIRSESD--GHKRR 2629

Query: 3565 LEIKRVQDRDSGSYRLLAINSEGSAESTASLLVIQKGQDEKYLEFLKRA----ERTHENV 3620
            L I   +  D G Y      S+ SA+     + I+K      +   + A    E TH NV
Sbjct: 2630 LIIAATKLDDIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNV 2689

Query: 3621 EALVERGEDRIKVDLRFTGSPFNKKQDVEQKGMMRTIHFKTMSSAKKTDYMYDEEYLESK 3680
                 +G   IK  +       N+K  +  KG + ++  K  +   ++ Y +    L + 
Sbjct: 2690 -----KGVQWIKNGVVLES---NEKYAISVKGTIYSLRIKNCAIVDESVYGFRLGRLGAS 2741

Query: 3681 SDIRGWLNVGESFLDKETKVKLQRLREARKTLMEKKKLSLLDTSSEISSRTLRSEASDKD 3740
            +     L+V    + K+ K  +  L  A  T+  +  +S      +   +++  + SDK 
Sbjct: 2742 AR----LHVETVKIIKKPK-DVTALENA--TVAFEVSVSHDTVPVKWFHKSVEIKPSDKH 2794

Query: 3741 ILFSREDMKIRSMSDLAESYKVDHSA---------ESIVQNPHALSNQMDQNIESEELPT 3791
             L S   +    + +++ S   +++A         +  V+  H       +NIE  E  T
Sbjct: 2795 RLVSERKVHKLMLQNISPSDAGEYTAVVGQLECKAKLFVETLHITKTM--KNIEVPETKT 2852

Query: 3792 SFQTIVDEEIFQTEIRMSQEALVKESLPKDHLYGEILVNENTQARGQLEEIMANTTIGES 3851
            +         F+ E+       V     K+ +  E+        +G+L +++   T  E 
Sbjct: 2853 AS--------FECEVSHFN---VPSMWLKNGVEIEMSEKFKIVVQGKLHQLIIMNTSTED 2901

Query: 3852 STYITNVCEKEEVYETPENVSQAITPHASESFGTLVNVEESEEIASE------RIKKDDL 3905
            S   T VC  ++V  T       +TP    S    +N EE + I  E       I    L
Sbjct: 2902 SAEYTFVCGNDQVSAT-----LTVTPIMITSMLKDINAEEKDTITFEVTVNYEGISYKWL 2956

Query: 3906 RELQLSASTRIDEFKTEQKEENMRFFENSFRKRP-----------------QRCPPSFLQ 3948
            +      ST   + +T++   ++      F                     +     F +
Sbjct: 2957 KNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGKATSTATLYVEARHIEFRK 3016

Query: 3949 EIESQEVYEGDSCNFVCHFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSVHH 4008
             I+  +V E     F C     P   V W  +D  +       I   +    L + S   
Sbjct: 3017 HIKDIKVLEKKRAMFECEVSE-PDITVQWMKDDQELQITDRIKIQKEKYVHRLLIPSTRM 3075

Query: 4009 QNEGSITCV---------LFNQYGTVKTTSMLK---VKAKQK---------HDVKAH--- 4044
             + G  T V         LF +   V+  S+ K   V  KQ+          DV AH   
Sbjct: 3076 SDAGKYTVVAGGNVSTAKLFVEGRDVRIRSIKKEVQVIEKQRAVVEFEVNEDDVDAHWYK 3135

Query: 4045 -------KVPVFHDYLDEEEELALVFDQAK----GAHPSMSQEGQTNLHLLKTNPPVPPS 4093
                   +V   H Y+ E     +   + +    G +  ++   ++++ L   N P PP 
Sbjct: 3136 DGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGRNRSSVTLY-VNAPEPPQ 3194

Query: 4094 GDTELLSFPVEIQ---------VTAATPIPEQDKESKEVFQTEELEPKAMPQDQ------ 4138
               EL   PV +Q         V +  P P+     +E   +   + K +   Q      
Sbjct: 3195 VLQELQ--PVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFKCKFLHDGQEYTLLL 3252

Query: 4139 VTQSPKHRFVFLSDITN-------------EPPKML---QEMPKHARC----------RE 4172
            +   P+   V+  +  N             E P+++   QEMP +              E
Sbjct: 3253 IEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEVVSPDQEMPVYPPAIITPLQDTVTSE 3312

Query: 4173 GDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVNCSHQLYIKDVNSQDSGKYKCV 4232
            G     +C +SG    V +W+     +K ++ F+  +   ++QL I +   +D G Y  V
Sbjct: 3313 GQPARFQCRVSGTDLKV-SWYSKDKKIKPSRFFRMTQFEDTYQLEIAEAYPEDEGTYTFV 3371

Query: 4233 AENNSGAVESVSDLTVE 4249
            A N  G V S ++L++E
Sbjct: 3372 ASNAVGQVSSTANLSLE 3388



 Score =  169 bits (427), Expect = 9e-41
 Identities = 351/1649 (21%), Positives = 635/1649 (38%), Gaps = 235/1649 (14%)

Query: 890  YKSEAGVEVKKEVGVSITGTTVREERFEV----LHGREAKVTETARVPAPVEIPVTPPTL 945
            +K++A +   + V +S  G T + E  EV    +   +A+V E +   A +++    P  
Sbjct: 5110 FKNDAKLHTSRTVLISSEGKTHKLEMKEVTLDDISQIKAQVKELSST-AQLKVLEADPYF 5168

Query: 946  VSGLKNVTVIEGESVTLECHISGYPSPTVTWYREDYQIESSIDFQITFQSGIARLM-IRE 1004
               L + T +E + +TL+C +S      V W+++  +I  S  + I    G+ R++ I++
Sbjct: 5169 TVKLHDKTAVEKDEITLKCEVS--KDVPVKWFKDGEEIVPSPKYSIK-ADGLRRILKIKK 5225

Query: 1005 AFAEDSGRFTCSAVNEAGTVSTSCYLAVQVSEEFEKETTAVTEKFTTEEKRFVESRDVVM 1064
            A  +D G + C    + GT  T   + V+      ++     E F  E   F    ++ +
Sbjct: 5226 ADLKDKGEYVC----DCGTDKTKANVTVEARLIKVEKPLYGVEVFVGETAHF----EIEL 5277

Query: 1065 TDTSLTEEQAGPGEPAAPYFITKPVVQKLVEGGS----VVFGCQVG---------GNPKP 1111
            ++  +  +    G+P     +T     +++E G     ++  CQ+G          N K 
Sbjct: 5278 SEPDVHGQWKLKGQP-----LTASPDCEIIEDGKKHILILHNCQLGMTGEVSFQAANAKS 5332

Query: 1112 HVYWKKSGVPL---------------TTGYRYKVSYNKQTGECKLVISMTFADDAGEYTI 1156
                K   +PL                  +  +VS   +T            DD  E  I
Sbjct: 5333 AANLKVKELPLIFITPLSDVKVFEKDEAKFECEVSREPKTFRWLKGTQEITGDDRFE-LI 5391

Query: 1157 VVRNKHGETSASASLLEEADY--ELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEY 1214
                KH     SA+  +EA Y  E   K     L    +      P    TA        
Sbjct: 5392 KDGTKHSMVIKSAAFEDEAKYMFEAEDKHTSGKLIIEGIRLKFLTPLKDVTAK------- 5444

Query: 1215 EKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEED 1274
                EKE A+   +++ D + V+ +  DQ  H +     +  + E +    T ++L  +D
Sbjct: 5445 ----EKESAVFTVELSHDNIRVKWFKNDQRLHTT---RSVSMQDEGKTHSITFKDLSIDD 5497

Query: 1275 GE----EKMAVDISESEAVESG---FDSRIKNYRILEGMGVTFHCKMSGYPLPKIAWYKD 1327
                  E M +       V  G   F  ++++Y  +E   V   C++S    P + W+KD
Sbjct: 5498 TSQIRVEAMGMSSEAKLTVLEGDPYFTGKLQDYTGVEKDEVILQCEISKADAP-VKWFKD 5556

Query: 1328 GKRIKHGERYQMDFLQDGRASLRI-PVVLPEDEGIYTAFASNIKGNAICSGKLYVEP-AA 1385
            GK IK  +   +    DG+  + I    L  D G YT      K     SGKL +E    
Sbjct: 5557 GKEIKPSKNAVIK--ADGKKRMLILKKALKSDIGQYTCDCGTDK----TSGKLDIEDREI 5610

Query: 1386 PLGAPTYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMS-------PARMS 1438
             L  P +  ++E +    +     +S   I  +      A +              + + 
Sbjct: 5611 KLVRPLH--SVEVMETETARFETEISEDDIHANWKLKGEALLQTPDCEIKEEGKIHSLVL 5668

Query: 1439 PGRRLEETD---------ESQLERLYKP--VFVLKPV-SFKCLEGQTARFDLKVVGRPMP 1486
               RL++T          +S      KP  + +L+P+       G+TA FD ++    +P
Sbjct: 5669 HNCRLDQTGGVDFQAANVKSSAHLRVKPRVIGLLRPLKDVTVTAGETATFDCELSYEDIP 5728

Query: 1487 ETFWFHDGQQIVNDYTHKVVIKEDG-TQSLIIVPATPSDSGEWTVVAQNRAGRSSISVIL 1545
               W+  G+++  + + KVV + +G   +L +      D+GE  + A++    +++ V  
Sbjct: 5729 -VEWYLKGKKL--EPSDKVVPRSEGKVHTLTLRDVKLEDAGEVQLTAKDFKTHANLFV-- 5783

Query: 1546 TVEAVEHQVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDIIVPHKYPKIR 1605
                   +    F + L++  ++EG+   ++   +   N  + W KN   I+  K  +I 
Sbjct: 5784 ------KEPPVEFTKPLEDQTVEEGATAVLECEVS-RENAKVKWFKNGTEILKSKKYEIV 5836

Query: 1606 IEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNV---EVEFAEPEPERKLII 1662
             +G   +  L I     +D   YT  A +      T C +NV    VEF  P  + ++  
Sbjct: 5837 ADGRVRK--LVIHDCTPEDIKTYTCDAKD----FKTSCNLNVVPPHVEFLRPLTDLQV-- 5888

Query: 1663 PRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKKKLTSLRLKRFGPAHF 1722
                 R KE+A  E E        + +++G    K K+     K  +  L + +      
Sbjct: 5889 -----REKEMARFECELSRENAKVKWFKDGAEIKKGKKYDIISKGAVRILVINK------ 5937

Query: 1723 ECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDY-GVAYSRDSGIITCRATN 1781
             C L          E+  + +    +  L ++ E    + +   +  S    I      +
Sbjct: 5938 -CLLDD------EAEYSCEVRTARTSGMLTVLEEEAVFTKNLANIEVSETDTIKLVCEVS 5990

Query: 1782 KYGTDHTSATLIVKDEKSLVEESQ---LPEGRKGLQRIE--ELERMAHEGA-LTGVTTDQ 1835
            K G +     +  K ++ ++E  +   L EGRK +  I+   LE   +    L    TD 
Sbjct: 5991 KPGAE----VIWYKGDEEIIETGRYEILTEGRKRILVIQNAHLEDAGNYNCRLPSSRTDG 6046

Query: 1836 KEK---QKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLNGQLIRKSKRFRVRYD 1892
            K K      + +  P+ + +LEGE A F C ++    P V W  + + +    ++ V  D
Sbjct: 6047 KVKVHELAAEFISKPQNLEILEGEKAEFVCSISKESFP-VQWKRDDKTLESGDKYDVIAD 6105

Query: 1893 G-IHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFRSVLRRAPEPRPEFHV 1951
            G    L + D    D G   V                                 R   H+
Sbjct: 6106 GKKRVLVVKDATLQDMGTYVV----------------------------MVGAARAAAHL 6137

Query: 1952 HEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEELRSKFKRRTEEGYYE 2011
                KL+  V     P+  T  KE     + E + + +V   +E  ++K+  R EE  ++
Sbjct: 6138 TVIEKLRIVV-----PLKDTRVKE-----QQEVVFNCEV--NTEGAKAKW-FRNEEAIFD 6184

Query: 2012 AITAVELKSRKKDESYEELLRKTK-DELLHWTKELTEEEKKALAEEGKITIPTFKPDKIE 2070
            +   + L   +KD  Y   +R    D+  ++   LT    + +     + +         
Sbjct: 6185 SSKYIIL---QKDLVYTLRIRDAHLDDQANYNVSLTNHRGENVKSAANLIV--------- 6232

Query: 2071 LSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGVKIERSDRIYWYWPE 2130
                 E  +I E ++     +     F  + V + +   +W KNG ++   +R+  Y  +
Sbjct: 6233 ---EEEDLRIVEPLKDIETMEKKSVTFWCK-VNRLNVTLKWTKNGEEVPFDNRVS-YRVD 6287

Query: 2131 DNVCELVIRDVTAEDSASIMVKAINIAGETSSHAFLLVQAKQLITFTQELQDVVAKEKDT 2190
                 L I+D    D    +V     AG+  S A LL+  +    F + L+D    E D 
Sbjct: 6288 KYKHMLTIKDCGFPDEGEYIV----TAGQDKSVAELLI-IEAPTEFVEHLEDQTVTEFDD 6342

Query: 2191 MATFECETSEPFVKVKWYKDGMEVHEGDKYRMHSDRKVHFLSILTIDTSDAEDYSCVLVE 2250
             A F C+ S     VKWY++G E+ EG KY+   D  +H L I      D  +Y+C +  
Sbjct: 6343 -AVFSCQLSREKANVKWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLDDECEYACGV-- 6399

Query: 2251 DENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNG 2310
             E+ K+ A+L VE   VE ++  QDI             ++ + +E +W  N++ +    
Sbjct: 6400 -EDRKSRARLFVEEIPVEIIRPPQDILEAPGADVVFLAELNKDKVEVQWLRNNMVVVQGD 6458

Query: 2311 KYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMKPRPIAILQGLSDQKVCEG 2370
            K+ + S      L + D+   DQGEY F+   K+   KL++   P  I     D  V  G
Sbjct: 6459 KHQMMSEGKIHRLQICDIKPRDQGEYRFIAKDKEARAKLELAAAP-KIKTADQDLVVDVG 6517

Query: 2371 DIVQLEVKV-SLESVEGVWMKDGQEVQPSDRVHIVIDKQSHMLLIEDMTKEDAGNYSFTI 2429
              + + V   +    E  W K+ + +  +  +    ++ S  +L  +  K D G Y   +
Sbjct: 6518 KPLTMVVPYDAYPKAEAEWFKENEPLS-TKTIDTTAEQTSFRIL--EAKKGDKGRYKIVL 6574

Query: 2430 PALGLSTSGRVSVYSVDVITPLKDVNVIE 2458
                    G +++  +DV  P++++ V E
Sbjct: 6575 QNKHGKAEGFINLKVIDVPGPVRNLEVTE 6603



 Score =  159 bits (402), Expect = 7e-38
 Identities = 237/1127 (21%), Positives = 408/1127 (36%), Gaps = 160/1127 (14%)

Query: 1096  GGSVVFGCQVGGNPKPHVYWKKSGVPLTTGYRYKVSYNKQTGECKLVISMTFADDAGEYT 1155
             G +  F   V   P   V W  +GV L      K+ Y   +G   L I     DD+G Y 
Sbjct: 25891 GQNTRFILNVQSKPTAEVKWYHNGVELQESS--KIHYTNTSGVLTLEILDCHTDDSGTYR 25948

Query: 1156  IVVRNKHGETSASASL-LEEADYELLMKSQQEMLYQTQVTAFVQEPKVGETAPGFVYSEY 1214
              V  N  GE S  A+L +   DY      +++      V      P++  T   +  S +
Sbjct: 25949 AVCTNYKGEASDYATLDVTGGDYTTYASQRRDEEVPRSVF-----PELTRTE-AYAVSSF 26002

Query: 1215  EKEYEKEQALIRKKMAKDTVVVRTYVEDQEFHISSFEERLIKEIEYRIIKTTLEELLEED 1274
             +K  E E +   ++       V++ + +    +SS+E     E++   +           
Sbjct: 26003 KKTSEMEASSSVRE-------VKSQMTETRESLSSYEHSASAEMKSAAL----------- 26044

Query: 1275  GEEKMAVDISESEAVESGFDSRI----KNYRILEGMGVTFHCKMSGYPLPKIAWYKDGKR 1330
              EEK   + S +  +++   +RI    ++  + EG    F C   G P+P + W + G+ 
Sbjct: 26045 -EEKSLEEKSTTRKIKTTLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQV 26103

Query: 1331  IKHGERYQMDFLQDGRASLRIPVVLPEDEGIYTAFASNIKGNAICSGKLYVEPAAPLGAP 1390
             +    R+Q+   +  +++  I  V   DEG Y+    N +G       L ++ A      
Sbjct: 26104 LSTSARHQVTTTK-YKSTFEISSVQASDEGNYSVVVENSEGKQEAEFTLTIQKARVTEKA 26162

Query: 1391  TYIPTLEPVSRIRSLSPRSVSRSPIRMSPARMSPARMSPARMSPARMSPGRRLEETDESQ 1450
                P      R++S  PR  S   ++      SP    P  +SP    P    E+     
Sbjct: 26163 VTSP-----PRVKSPEPRVKSPEAVKSPKRVKSPEPSHPKAVSPTETKP-TPTEKVQHLP 26216

Query: 1451  LERLYKPVFVLKPVSFKCLEGQTARFDLKVVGRPMPETFWFHDGQQIVNDYTHKVVIKED 1510
             +    K    LK  + K +   T   +  V+     E  W+ DG+++  +   +     D
Sbjct: 26217 VSAPPKITQFLKAEASKEIAKLTCVVESSVL--RAKEVTWYKDGKKLKENGHFQFHYSAD 26274

Query: 1511  GTQSLIIVPATPSDSGEWTVVAQNRAGRSSISVILTVEAVEH------------------ 1552
             GT  L I   T SD GE+        G S  ++    +A +                   
Sbjct: 26275 GTYELKINNLTESDQGEYVCEISGEGGTSKTNLQFMGQAFKSIHEKVSKISETKKSDQKT 26334

Query: 1553  -----------------QVKPMFVEKLKNVNIKEGSRLEMKVRATGNPNPDIVWLKNSDI 1595
                                KP+ V  L++  +   S  +  V+ATG P P  +W K+   
Sbjct: 26335 TESTVTRKTEPKAPEPISSKPVIVTGLQDTTVSSDSVAKFAVKATGEPRPTAIWTKDGKA 26394

Query: 1596  IVPHKYPKIRIEGTKGEAALKIDSTVSQDSAWYTATAINKAGRDTTRCKVNVE-VEFAEP 1654
             I   +  K ++   KG   L+I  T + DS  YT T  N AG  ++ CK+ ++ ++  E 
Sbjct: 26395 IT--QGGKYKLSEDKGGFFLEIHKTDTSDSGLYTCTVKNSAGSVSSSCKLTIKAIKDTEA 26452

Query: 1655  EPERKLIIPRGTYRAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFK----KKLT 1710
             +          T + K +   E+    LR      EE  + + + Q+K   K    K L 
Sbjct: 26453 QKVSTQKTSEITPQKKAVVQEEISQKALRS-----EEIKMSEAKSQEKLALKEEASKVLI 26507

Query: 1711  SLRLKRFGPAHFECRLT--PIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVAY 1768
             S  +K+      E  +    I   +   E +     ++A +    INE     L   +A 
Sbjct: 26508 SEEVKKSAATSLEKSIVHEEITKTSQASEEVRTHAEIKAFSTQMSINEGQRLVLKANIAG 26567

Query: 1769  SRD-----SGI-ITCRATNKYGTDHTSATLIVK-----DEKSLVEESQLPEGRKGLQRIE 1817
             + D     +G+ +T     +YG   +  TL +K     DE  L   S+  EG    Q   
Sbjct: 26568 ATDVKWVLNGVELTNSEEYRYGVSGSDQTLTIKQASHRDEGILTCISKTKEGIVKCQ--- 26624

Query: 1818  ELERMAHEGALTGVTTDQKEKQKPDIVLYPEPVRVLEGETARFRCRVTGYPQPKVNWYLN 1877
                          +T  ++    P  +  P    + EG+   F C ++G P P++ W+ N
Sbjct: 26625 -----------YDLTLSKELSDAPAFISQPRSQNINEGQNVLFTCEISGEPSPEIEWFKN 26673

Query: 1878  GQLIRKSKRFRV-RYDGIHYLDIVDCKSYDTGEVKVTAENPEGVIEHKVKLEIQQREDFR 1936
                I  S    + R   ++ L+I +    D+G+  + A+N  G       L         
Sbjct: 26674 NLPISISSNVSISRSRNVYSLEIRNASVSDSGKYTIKAKNFRGQCSATASL--------- 26724

Query: 1937  SVLRRAPEPRPEFHVHEPGKLQFEVQKVDRPVDTTETKEVVKLKRAERITHEKVPEESEE 1996
              VL    EP  E  +   G    +     + V  + +K+                     
Sbjct: 26725 MVLPLVEEPSREVVLRTSGDTSLQGSFSSQSVQMSASKQEASF---------------SS 26769

Query: 1997  LRSKFKRRTEEGYYEAITAVELKSRKKDESYEELLRKTKDELLHWTKELTEEEKKALAEE 2056
               S       E  + +++A  + S +  ES+ E+   +   + + T+  +   K   A  
Sbjct: 26770 FSSSSASSMTEMKFASMSAQSMSSMQ--ESFVEMSSSSFMGISNMTQLESSTSKMLKAGI 26827

Query: 2057  GKITIPTFKPDKIELSPSMEAPKIFERIQSQTVGQGSDAHFRVRVVGKPDPECEWYKNGV 2116
               I      P KIE  PS             ++ +G          G+P PE  W   G 
Sbjct: 26828 RGI------PPKIEALPS-----------DISIDEGKVLTVACAFTGEPTPEVTWSCGGR 26870

Query: 2117  KIERSDRIYWYWPE-DNVCELVIRDVTAEDSASIMVKAINIAGETSS 2162
             KI   ++  ++    D++  L+I DV  +D     +   N  G  S+
Sbjct: 26871 KIHSQEQGRFHIENTDDLTTLIIMDVQKQDGGLYTLSLGNEFGSDSA 26917



 Score =  130 bits (326), Expect = 5e-29
 Identities = 218/1038 (21%), Positives = 396/1038 (38%), Gaps =