BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|13027820 growth hormone 1 isoform 5 [Homo sapiens] (30 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|13027820 growth hormone 1 isoform 5 [Homo sapiens] 68 1e-12 gi|13027824 growth hormone 2 isoform 2 [Homo sapiens] 44 3e-05 gi|12408685 chorionic somatomammotropin hormone 1 isoform 2 [Hom... 40 3e-04 >gi|13027820 growth hormone 1 isoform 5 [Homo sapiens] Length = 30 Score = 68.2 bits (165), Expect = 1e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Query: 1 MATEAGRWQPPDWADLQADLQQVRHKLTQR 30 MATEAGRWQPPDWADLQADLQQVRHKLTQR Sbjct: 1 MATEAGRWQPPDWADLQADLQQVRHKLTQR 30 >gi|13027824 growth hormone 2 isoform 2 [Homo sapiens] Length = 256 Score = 43.9 bits (102), Expect = 3e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Query: 4 EAGRWQPPDWADLQADLQQV 23 EAGRWQPPDWADLQ+ LQQV Sbjct: 237 EAGRWQPPDWADLQSVLQQV 256 >gi|12408685 chorionic somatomammotropin hormone 1 isoform 2 [Homo sapiens] Length = 256 Score = 40.4 bits (93), Expect = 3e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Query: 4 EAGRWQPPDWADLQADLQQV 23 EAGR QPPDWAD QADLQQV Sbjct: 237 EAGRRQPPDWADPQADLQQV 256 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.318 0.128 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,234,755 Number of Sequences: 37866 Number of extensions: 17056 Number of successful extensions: 72 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 69 Number of HSP's gapped (non-prelim): 3 length of query: 30 length of database: 18,247,518 effective HSP length: 5 effective length of query: 25 effective length of database: 18,058,188 effective search space: 451454700 effective search space used: 451454700 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.