BLASTP 2.2.11 [Jun-05-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= gi|239756605 PREDICTED: similar to ribosomal protein S11 [Homo sapiens] (67 letters) Database: hs.faa 37,866 sequences; 18,247,518 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gi|239756605 PREDICTED: similar to ribosomal protein S11 [Homo s... 140 3e-34 gi|4506681 ribosomal protein S11 [Homo sapiens] 99 9e-22 >gi|239756605 PREDICTED: similar to ribosomal protein S11 [Homo sapiens] Length = 67 Score = 140 bits (352), Expect = 3e-34 Identities = 67/67 (100%), Positives = 67/67 (100%) Query: 1 MWSSRKHLSDKIRCYKNMSIHLSTFFRDVQIGHIVTVGECRPLSKTVRFNVLKVTKAAGT 60 MWSSRKHLSDKIRCYKNMSIHLSTFFRDVQIGHIVTVGECRPLSKTVRFNVLKVTKAAGT Sbjct: 1 MWSSRKHLSDKIRCYKNMSIHLSTFFRDVQIGHIVTVGECRPLSKTVRFNVLKVTKAAGT 60 Query: 61 KKQFQKF 67 KKQFQKF Sbjct: 61 KKQFQKF 67 >gi|4506681 ribosomal protein S11 [Homo sapiens] Length = 158 Score = 98.6 bits (244), Expect = 9e-22 Identities = 48/53 (90%), Positives = 50/53 (94%) Query: 15 YKNMSIHLSTFFRDVQIGHIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF 67 +KNMS+HLS FRDVQIG IVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF Sbjct: 106 HKNMSVHLSPCFRDVQIGDIVTVGECRPLSKTVRFNVLKVTKAAGTKKQFQKF 158 Database: hs.faa Posted date: Aug 4, 2009 4:42 PM Number of letters in database: 18,247,518 Number of sequences in database: 37,866 Lambda K H 0.327 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,207,954 Number of Sequences: 37866 Number of extensions: 62018 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 103 Number of HSP's gapped (non-prelim): 2 length of query: 67 length of database: 18,247,518 effective HSP length: 40 effective length of query: 27 effective length of database: 16,732,878 effective search space: 451787706 effective search space used: 451787706 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 55 (25.8 bits)
Search results were obtained with NCBI BLAST and RefSeq entries.
Guide to the Human Genome
Copyright © 2010 by Stewart Scherer. All rights reserved.